F427356

General Info

Members Datasets Scaffolds Average Seq Length
376 170 752 180

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10862632|Ga0157371_108626321
Length 187
Sequence MWKSVAVFCGSHLGNNKLFAQHAEEIGLILAHKNVQLIYGGGTNGLMGIVANTVLKNKGNVTGVIPSLLNEKESQHSLLTTLHIVEDMHTRKKMMYELSDAAIILPGGYGTMDELFEMITWNQLNIHNKKIVLLNSDNYYDNLLAHFDKMYAEKFLHTHWKESLVIIYDPQALVFLLDEDTHQTHRE

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0
Rhizoplane 1.6
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 12.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10862632 3300013102 Bacteria 685
2 rootH2_10107113 3300003320 Bacteria 1215
3 rootL2_10024689 3300003322 Bacteria 3164
4 Ga0065712_10004031 3300005290 Bacteria 6848
5 Ga0065712_10012180 3300005290 Bacteria 3103
6 Ga0065715_10001430 3300005293 Bacteria 16426
7 Ga0065707_10102959 3300005295 Unclassified 2776
8 Ga0065707_10359806 3300005295 Bacteria 906
9 Ga0070658_10098479 3300005327 Bacteria 2415
10 Ga0070658_10407604 3300005327 Unclassified 1168
11 Ga0070658_11117610 3300005327 Bacteria 685
12 Ga0070683_100452624 3300005329 Bacteria 1225
13 Ga0070670_100040099 3300005331 Bacteria 4027
14 Ga0070670_100251698 3300005331 Bacteria 1539
15 Ga0070670_100300863 3300005331 Bacteria 1403
16 Ga0070666_10000165 3300005335 Bacteria 45323
17 Ga0070666_10519771 3300005335 Bacteria 864
18 Ga0070680_100005478 3300005336 Bacteria 9601
19 Ga0070680_100324138 3300005336 Unclassified 1308
20 Ga0068868_100076024 3300005338 Bacteria 2684
21 Ga0068868_100142541 3300005338 Bacteria 1968
22 Ga0070660_100007527 3300005339 Bacteria 7591
23 Ga0070660_100037210 3300005339 Bacteria 3689
24 Ga0070660_100194640 3300005339 Bacteria 1643
25 Ga0070660_100457955 3300005339 Bacteria 1059
26 Ga0070660_100687206 3300005339 Bacteria 858
27 Ga0070687_100138869 3300005343 Bacteria 1412
28 Ga0070668_100023132 3300005347 Unclassified 4697
29 Ga0070675_100031707 3300005354 Bacteria 4274
30 Ga0070673_100193963 3300005364 Bacteria 1746
31 Ga0070673_100360424 3300005364 Bacteria 1292
32 Ga0070688_100183086 3300005365 Bacteria 1454
33 Ga0070688_100365053 3300005365 Bacteria 1060
34 Ga0070688_100728728 3300005365 Unclassified 770
35 Ga0070659_100028842 3300005366 Bacteria 4287
36 Ga0070659_100254571 3300005366 Bacteria 1456
37 Ga0070667_100131589 3300005367 Bacteria 2184
38 Ga0070667_100203907 3300005367 Unclassified 1755
39 Ga0070663_100108251 3300005455 Bacteria 2084
40 Ga0070678_100520957 3300005456 Bacteria 1052
41 Ga0070681_10030830 3300005458 Bacteria 5382
42 Ga0070681_10266679 3300005458 Unclassified 1624
43 Ga0070681_10290202 3300005458 Unclassified 1546
44 Ga0070681_10730248 3300005458 Bacteria 907
45 Ga0068867_100170156 3300005459 Bacteria 1725
46 Ga0068867_100783354 3300005459 Unclassified 849
47 Ga0068867_101234547 3300005459 Unclassified 688
48 Ga0070698_100764069 3300005471 Unclassified 910
49 Ga0070679_100001303 3300005530 Bacteria 22036
50 Ga0070679_100022264 3300005530 Bacteria 6193
51 Ga0070679_100062127 3300005530 Bacteria 3723
52 Ga0070679_100269616 3300005530 Bacteria 1656
53 Ga0070679_100492816 3300005530 Bacteria 1169
54 Ga0068853_100063816 3300005539 Bacteria 3191
55 Ga0068853_100098126 3300005539 Bacteria 2587
56 Ga0068853_100144430 3300005539 Bacteria 2137
57 Ga0068853_100396926 3300005539 Bacteria 1290
58 Ga0068853_100476301 3300005539 Bacteria 1176
59 Ga0068853_101128359 3300005539 Bacteria 756
60 Ga0070672_100012191 3300005543 Bacteria 6022
61 Ga0070686_100258783 3300005544 Bacteria 1274
62 Ga0070665_100457465 3300005548 Bacteria 1286
63 Ga0070704_100075565 3300005549 Unclassified 2462
64 Ga0068855_100000736 3300005563 Bacteria 40224
65 Ga0068855_100001274 3300005563 Bacteria 31259
66 Ga0068855_100029312 3300005563 Bacteria 6581
67 Ga0068855_100650009 3300005563 Bacteria 1133
68 Ga0068857_100082830 3300005577 Bacteria 2866
69 Ga0068857_100296577 3300005577 Bacteria 1490
70 Ga0068854_100018982 3300005578 Unclassified 4624
71 Ga0068854_100147827 3300005578 Bacteria 1809
72 Ga0068856_100045058 3300005614 Bacteria 4341
73 Ga0068856_100115589 3300005614 Bacteria 2683
74 Ga0068856_100652710 3300005614 Unclassified 1073
75 Ga0068852_100019694 3300005616 Bacteria 5348
76 Ga0068852_100379879 3300005616 Bacteria 1386
77 Ga0068852_101682655 3300005616 Bacteria 657
78 Ga0068859_100000163 3300005617 Bacteria 64401
79 Ga0068859_102218413 3300005617 Bacteria 606
80 Ga0068864_100002828 3300005618 Bacteria 14323
81 Ga0068864_100037552 3300005618 Bacteria 4134
82 Ga0068864_100219505 3300005618 Unclassified 1754
83 Ga0068866_10685025 3300005718 Bacteria 701
84 Ga0068861_100049605 3300005719 Bacteria 3179
85 Ga0068851_10128190 3300005834 Bacteria 1370
86 Ga0068870_10207364 3300005840 Bacteria 1192
87 Ga0068863_100000696 3300005841 Bacteria 33755
88 Ga0068863_100108975 3300005841 Unclassified 2636
89 Ga0068863_100533695 3300005841 Bacteria 1157
90 Ga0068863_101124182 3300005841 Bacteria 790
91 Ga0068858_100006245 3300005842 Bacteria 11609
92 Ga0068858_100329007 3300005842 Bacteria 1461
93 Ga0068860_100016791 3300005843 Bacteria 7136
94 Ga0068860_100066294 3300005843 Bacteria 3429
95 Ga0068860_100378176 3300005843 Bacteria 1398
96 Ga0068862_100020084 3300005844 Bacteria 5577
97 Ga0068862_100213428 3300005844 Bacteria 1744
98 Ga0068862_100623096 3300005844 Bacteria 1038
99 Ga0081539_10264665 3300005985 Unclassified 756
100 Ga0075366_10413217 3300006195 Bacteria 831
101 Ga0075366_10463807 3300006195 Bacteria 782
102 Ga0097621_100001082 3300006237 Bacteria 19034
103 Ga0097621_100066770 3300006237 Bacteria 2963
104 Ga0097621_100355483 3300006237 Bacteria 1304
105 Ga0068871_100000076 3300006358 Bacteria 55186
106 Ga0068871_100018124 3300006358 Bacteria 5345
107 Ga0068871_100085329 3300006358 Bacteria 2622
108 Ga0075428_100007967 3300006844 Bacteria 11752
109 Ga0075431_100724693 3300006847 Bacteria 971
110 Ga0075429_100006086 3300006880 Bacteria 10437
111 Ga0075429_100536914 3300006880 Bacteria 1025
112 Ga0068865_100303053 3300006881 Bacteria 1280
113 Ga0097620_100000163 3300006931 Bacteria 64401
114 Ga0097620_102218540 3300006931 Bacteria 606
115 Ga0105240_10129272 3300009093 Bacteria 3031
116 Ga0111539_10816821 3300009094 Unclassified 1085
117 Ga0105247_10025204 3300009101 Bacteria 3588
118 Ga0105241_10000776 3300009174 Bacteria 24269
119 Ga0105241_10044857 3300009174 Bacteria 3352
120 Ga0105241_10293124 3300009174 Bacteria 1394
121 Ga0105242_10056860 3300009176 Bacteria 3202
122 Ga0105242_10246327 3300009176 Bacteria 1609
123 Ga0105242_10275578 3300009176 Bacteria 1526
124 Ga0105248_10041543 3300009177 Bacteria 5156
125 Ga0105248_10145818 3300009177 Bacteria 2671
126 Ga0105237_10003655 3300009545 Bacteria 18145
127 Ga0105237_10043159 3300009545 Bacteria 4544
128 Ga0105237_10049699 3300009545 Bacteria 4214
129 Ga0105237_10117777 3300009545 Unclassified 2650
130 Ga0105249_10001077 3300009553 Bacteria 24238
131 Ga0105249_10009028 3300009553 Bacteria 8714
132 Ga0105249_10029764 3300009553 Bacteria 4933
133 Ga0105249_10205302 3300009553 Bacteria 1930
134 Ga0105249_10281525 3300009553 Bacteria 1661
135 Ga0105249_10292310 3300009553 Unclassified 1631
136 Ga0105249_10426085 3300009553 Bacteria 1361
137 Ga0105249_10562215 3300009553 Bacteria 1192
138 Ga0105239_10002610 3300010375 Bacteria 22800
139 Ga0105246_10039820 3300011119 Bacteria 3168
140 Ga0157373_10000637 3300013100 Bacteria 27502
141 Ga0157373_10001085 3300013100 Bacteria 20966
142 Ga0157373_10045097 3300013100 Bacteria 3148
143 Ga0157371_10000168 3300013102 Bacteria 95185
144 Ga0157371_10000927 3300013102 Bacteria 32867
145 Ga0157371_10001216 3300013102 Bacteria 27432
146 Ga0157371_10001331 3300013102 Bacteria 25968
147 Ga0157371_10003350 3300013102 Bacteria 14602
148 Ga0157371_10042331 3300013102 Bacteria 3246
149 Ga0157370_10003228 3300013104 Bacteria 19253
150 Ga0157370_10004831 3300013104 Bacteria 15322
151 Ga0157370_10188400 3300013104 Unclassified 1915
152 Ga0157370_10357865 3300013104 Bacteria 1345
153 Ga0157370_10400669 3300013104 Bacteria 1263
154 Ga0157370_10780186 3300013104 Bacteria 870
155 Ga0157369_10010144 3300013105 Bacteria 10751
156 Ga0157369_10013455 3300013105 Bacteria 9247
157 Ga0157369_10024032 3300013105 Bacteria 6781
158 Ga0157369_10162081 3300013105 Bacteria 2360
159 Ga0157378_10015905 3300013297 Bacteria 6589
160 Ga0157378_10193151 3300013297 Bacteria 1921
161 Ga0157378_11157684 3300013297 Bacteria 812
162 Ga0163162_10000214 3300013306 Bacteria 53543
163 Ga0163162_10000785 3300013306 Bacteria 29535
164 Ga0163162_10003791 3300013306 Bacteria 14497
165 Ga0163162_10147912 3300013306 Bacteria 2466
166 Ga0163162_10643971 3300013306 Bacteria 1184
167 Ga0163162_11174728 3300013306 Bacteria 870
168 Ga0157372_10018127 3300013307 Bacteria 7568
169 Ga0157372_10021003 3300013307 Bacteria 7049
170 Ga0157372_10146387 3300013307 Bacteria 2724
171 Ga0157372_10178610 3300013307 Bacteria 2457
172 Ga0157372_10215566 3300013307 Bacteria 2225
173 Ga0157372_10431210 3300013307 Bacteria 1536
174 Ga0157372_10630512 3300013307 Bacteria 1249
175 Ga0157372_10942447 3300013307 Bacteria 1001
176 Ga0157372_11000541 3300013307 Bacteria 968
177 Ga0157372_11292886 3300013307 Unclassified 842
178 Ga0157375_10000125 3300013308 Bacteria 75607
179 Ga0157375_10107198 3300013308 Bacteria 2887
180 Ga0157375_10202834 3300013308 Bacteria 2139
181 Ga0163163_10000281 3300014325 Bacteria 50719
182 Ga0157380_10113554 3300014326 Bacteria 2281
183 Ga0157380_10340148 3300014326 Bacteria 1399
184 Ga0157380_10435603 3300014326 Bacteria 1255
185 Ga0157380_10756357 3300014326 Bacteria 984
186 Ga0157377_10218988 3300014745 Bacteria 1218
187 Ga0157377_10308534 3300014745 Unclassified 1047
188 Ga0157379_10021126 3300014968 Bacteria 5760
189 Ga0157379_10086232 3300014968 Bacteria 2815
190 Ga0157379_10100120 3300014968 Bacteria 2602
191 Ga0157379_10264952 3300014968 Bacteria 1562
192 Ga0157376_10002516 3300014969 Bacteria 12416
193 Ga0157376_10020155 3300014969 Bacteria 5153
194 Ga0157376_10103773 3300014969 Bacteria 2490
195 Ga0157376_10105208 3300014969 Bacteria 2474
196 Ga0157376_10391791 3300014969 Bacteria 1341
197 Ga0163161_10000612 3300017792 Bacteria 28547
198 Ga0163161_10104134 3300017792 Unclassified 2115
199 Ga0163161_10342130 3300017792 Unclassified 1187
200 Ga0209646_1000876 3300025246 Bacteria 9991
201 Ga0207666_1003071 3300025271 Unclassified 2034
202 Ga0207656_10022742 3300025321 Bacteria 2519
203 Ga0207682_10119336 3300025893 Bacteria 1168
204 Ga0207710_10326281 3300025900 Bacteria 779
205 Ga0207680_10000068 3300025903 Bacteria 45911
206 Ga0207647_10221503 3300025904 Bacteria 1090
207 Ga0207643_10006704 3300025908 Bacteria 6176
208 Ga0207705_10001654 3300025909 Bacteria 17699
209 Ga0207705_10203289 3300025909 Bacteria 1501
210 Ga0207705_10338796 3300025909 Unclassified 1157
211 Ga0207684_10606414 3300025910 Bacteria 935
212 Ga0207654_10047325 3300025911 Bacteria 2457
213 Ga0207654_10051399 3300025911 Unclassified 2372
214 Ga0207654_10132328 3300025911 Bacteria 1580
215 Ga0207707_10026016 3300025912 Bacteria 5117
216 Ga0207707_10224065 3300025912 Unclassified 1637
217 Ga0207707_10294916 3300025912 Unclassified 1403
218 Ga0207695_10000057 3300025913 Bacteria 376090
219 Ga0207695_10000459 3300025913 Bacteria 88603
220 Ga0207695_10013256 3300025913 Bacteria 9836
221 Ga0207671_10003201 3300025914 Bacteria 16484
222 Ga0207660_10025340 3300025917 Bacteria 4025
223 Ga0207660_10378925 3300025917 Bacteria 1137
224 Ga0207660_10595160 3300025917 Bacteria 901
225 Ga0207657_10025089 3300025919 Bacteria 5506
226 Ga0207657_10144950 3300025919 Bacteria 1938
227 Ga0207657_10278345 3300025919 Bacteria 1329
228 Ga0207652_10000023 3300025921 Bacteria 158556
229 Ga0207652_10000960 3300025921 Bacteria 26943
230 Ga0207652_10111647 3300025921 Bacteria 2424
231 Ga0207650_10152787 3300025925 Bacteria 1823
232 Ga0207650_10287988 3300025925 Bacteria 1339
233 Ga0207659_10404623 3300025926 Bacteria 1142
234 Ga0207644_10068464 3300025931 Unclassified 2590
235 Ga0207644_10095424 3300025931 Unclassified 2224
236 Ga0207690_10056579 3300025932 Bacteria 2646
237 Ga0207690_10094017 3300025932 Bacteria 2126
238 Ga0207706_10576138 3300025933 Bacteria 968
239 Ga0207706_10939722 3300025933 Unclassified 729
240 Ga0207686_10001894 3300025934 Bacteria 11586
241 Ga0207686_10168788 3300025934 Unclassified 1541
242 Ga0207691_10003639 3300025940 Bacteria 14957
243 Ga0207711_10026061 3300025941 Bacteria 4904
244 Ga0207711_10563748 3300025941 Bacteria 1062
245 Ga0207689_10001987 3300025942 Bacteria 19318
246 Ga0207689_10038078 3300025942 Bacteria 3984
247 Ga0207689_10046921 3300025942 Bacteria 3568
248 Ga0207689_10358712 3300025942 Bacteria 1212
249 Ga0207661_10032435 3300025944 Bacteria 4047
250 Ga0207667_10010518 3300025949 Bacteria 10813
251 Ga0207667_10016006 3300025949 Bacteria 8491
252 Ga0207667_10035088 3300025949 Bacteria 5382
253 Ga0207667_10036915 3300025949 Bacteria 5230
254 Ga0207667_10472046 3300025949 Bacteria 1274
255 Ga0207667_10985660 3300025949 Bacteria 831
256 Ga0207651_10085341 3300025960 Bacteria 2290
257 Ga0207651_10142504 3300025960 Bacteria 1853
258 Ga0207651_10308367 3300025960 Bacteria 1319
259 Ga0207712_10007626 3300025961 Bacteria 6840
260 Ga0207712_10023714 3300025961 Bacteria 4053
261 Ga0207712_10039196 3300025961 Bacteria 3245
262 Ga0207712_10059710 3300025961 Unclassified 2700
263 Ga0207712_10672353 3300025961 Bacteria 902
264 Ga0207658_10707685 3300025986 Bacteria 910
265 Ga0207658_11037737 3300025986 Bacteria 748
266 Ga0207677_10437698 3300026023 Bacteria 1117
267 Ga0207703_10012177 3300026035 Bacteria 6705
268 Ga0207703_10128079 3300026035 Bacteria 2188
269 Ga0207639_10017651 3300026041 Bacteria 5060
270 Ga0207639_10213801 3300026041 Bacteria 1661
271 Ga0207639_10575080 3300026041 Unclassified 1037
272 Ga0207678_10054750 3300026067 Bacteria 3436
273 Ga0207678_10380919 3300026067 Bacteria 1219
274 Ga0207678_10593554 3300026067 Bacteria 971
275 Ga0207702_10038291 3300026078 Bacteria 4016
276 Ga0207702_10229432 3300026078 Bacteria 1734
277 Ga0207702_10398763 3300026078 Bacteria 1326
278 Ga0207641_10000176 3300026088 Bacteria 88863
279 Ga0207641_10026387 3300026088 Bacteria 4793
280 Ga0207641_10043339 3300026088 Bacteria 3779
281 Ga0207641_10460286 3300026088 Bacteria 1230
282 Ga0207648_10058269 3300026089 Bacteria 3369
283 Ga0207648_10143134 3300026089 Bacteria 2108
284 Ga0207648_10197237 3300026089 Bacteria 1785
285 Ga0207648_10283679 3300026089 Bacteria 1481
286 Ga0207676_10202227 3300026095 Unclassified 1756
287 Ga0207676_10757144 3300026095 Bacteria 945
288 Ga0207674_10100254 3300026116 Bacteria 2877
289 Ga0207675_100240385 3300026118 Unclassified 1750
290 Ga0207675_100485901 3300026118 Bacteria 1228
291 Ga0207683_10068566 3300026121 Bacteria 3132
292 Ga0207683_10201827 3300026121 Bacteria 1808
293 Ga0207698_10048470 3300026142 Bacteria 3225
294 Ga0207698_10313856 3300026142 Unclassified 1465
295 Ga0207698_11154766 3300026142 Bacteria 788
296 Ga0207698_11220688 3300026142 Bacteria 766
297 Ga0207698_11535251 3300026142 Bacteria 681
298 Ga0268266_10375033 3300028379 Bacteria 1341
299 Ga0268265_10011026 3300028380 Bacteria 6105
300 Ga0268265_10461407 3300028380 Bacteria 1189
301 Ga0268265_10579722 3300028380 Bacteria 1069
302 Ga0268265_10586344 3300028380 Bacteria 1063
303 Ga0268264_10018258 3300028381 Bacteria 5737
304 Ga0268264_10455697 3300028381 Bacteria 1240
305 Ga0268264_10570415 3300028381 Bacteria 1112
306 Ga0307513_10069632 3300031456 Bacteria 3681
307 Ga0307413_11390317 3300031824 Bacteria 617
308 Ga0307415_100997519 3300032126 Unclassified 778
309 Ga0395899_0000813 3300037312 Bacteria 30354
310 Ga0395899_0002508 3300037312 Bacteria 14884
311 Ga0395899_0026172 3300037312 Bacteria 4402
312 Ga0395899_0154499 3300037312 Bacteria 1624
313 Ga0395899_0216747 3300037312 Bacteria 1327
314 Ga0395899_0429116 3300037312 Bacteria 869
315 Ga0395900_0048019 3300037418 Bacteria 4396
316 Ga0395900_0060250 3300037418 Bacteria 3906
317 Ga0395900_0069211 3300037418 Bacteria 3627
318 Ga0395900_0104454 3300037418 Bacteria 2910
319 Ga0395900_0132358 3300037418 Unclassified 2555
320 Ga0395900_0345124 3300037418 Bacteria 1463
321 Ga0395898_0000480 3300037466 Bacteria 79611
322 Ga0395898_0002998 3300037466 Bacteria 19157
323 Ga0395898_0047542 3300037466 Bacteria 4210
324 Ga0395898_0081904 3300037466 Bacteria 3111
325 Ga0395905_0024675 3300037471 Bacteria 5674
326 Ga0395905_0040189 3300037471 Bacteria 4387
327 Ga0395905_1109907 3300037471 Bacteria 694
328 Ga0395901_0003224 3300038443 Bacteria 16416
329 Ga0395901_0003385 3300038443 Bacteria 16064
330 Ga0395901_0087664 3300038443 Bacteria 3254
331 Ga0395901_0199110 3300038443 Unclassified 2099
332 Ga0395901_0920264 3300038443 Bacteria 855
333 Ga0451798_0434390 3300041458 Unclassified 762
334 Ga0451800_0035518 3300041459 Bacteria 2322
335 Ga0439441_035945 3300042001 Bacteria 978
336 Ga0439435_0075271 3300042436 Bacteria 1005
337 Ga0466972_0000017 3300044658 Bacteria 199884
338 Ga0466972_0010179 3300044658 Bacteria 4725
339 Ga0466965_0387263 3300044683 Bacteria 771
340 Ga0466966_0000295 3300044684 Bacteria 32723
341 Ga0466968_0240752 3300044735 Bacteria 857
342 Ga0466957_0000760 3300044842 Bacteria 16415
343 Ga0495606_0008633 3300046507 Bacteria 8802
344 Ga0495621_0009137 3300046539 Bacteria 2999
345 Ga0495633_0012070 3300046558 Bacteria 4614
346 Ga0495635_0343877 3300046663 Bacteria 996
347 Ga0495658_0427991 3300046683 Bacteria 845
348 Ga0495670_0018192 3300046691 Bacteria 3459
349 Ga0495670_0074063 3300046691 Bacteria 1727
350 Ga0495674_0484372 3300047319 Unclassified 991
351 Ga0495676_0412594 3300047321 Bacteria 895
352 Ga0496105_0845412 3300048908 Bacteria 693
353 Ga0496107_0684252 3300048910 Bacteria 755
354 Ga0496114_0053499 3300048917 Bacteria 3365
355 Ga0496115_0271982 3300048918 Bacteria 1392
356 Ga0501043_0311962 3300049579 Bacteria 1200
357 Ga0501047_0031890 3300049581 Bacteria 5085
358 Ga0501047_0083436 3300049581 Bacteria 3071
359 Ga0501225_0013315 3300049705 Bacteria 2303
360 Ga0501035_0450945 3300049822 Bacteria 1064
361 Ga0501044_0058351 3300049823 Bacteria 3958
362 Ga0501044_0170834 3300049823 Bacteria 2146
363 Ga0501284_00005 3300050005 Bacteria 164758
364 nmdc:mga0k408_20889_c1 3300050493 Bacteria 3674
365 nmdc:mga09592_775726_c1 3300050508 Bacteria 812
366 nmdc:mga09592_99412_c1 3300050508 Bacteria 2491
367 nmdc:mga0qj67_440258_c1 3300050509 Unclassified 1050
368 nmdc:mga06r32_1150175_c1 3300050510 Unclassified 724
369 nmdc:mga08y16_114222_c1 3300050511 Bacteria 2811
370 nmdc:mga08y16_613919_c1 3300050511 Bacteria 1095
371 Ga0500646_0099131 3300053090 Bacteria 912
372 Ga0500642_0011138 3300053130 Bacteria 3205
373 Ga0500658_0127046 3300053134 Bacteria 1134
374 Ga0500559_0006118 3300053136 Bacteria 5451
375 Ga0500604_0091172 3300053151 Bacteria 996
376 Ga0500636_0084641 3300053177 Bacteria 1823
377 Ga0157371_10862632
378 rootH2_10107113
379 rootL2_10024689
380 Ga0065712_10004031
381 Ga0065712_10012180
382 Ga0065715_10001430
383 Ga0065707_10102959
384 Ga0065707_10359806
385 Ga0070658_10098479
386 Ga0070658_10407604
387 Ga0070658_11117610
388 Ga0070683_100452624
389 Ga0070670_100040099
390 Ga0070670_100251698
391 Ga0070670_100300863
392 Ga0070666_10000165
393 Ga0070666_10519771
394 Ga0070680_100005478
395 Ga0070680_100324138
396 Ga0068868_100076024
397 Ga0068868_100142541
398 Ga0070660_100007527
399 Ga0070660_100037210
400 Ga0070660_100194640
401 Ga0070660_100457955
402 Ga0070660_100687206
403 Ga0070687_100138869
404 Ga0070668_100023132
405 Ga0070675_100031707
406 Ga0070673_100193963
407 Ga0070673_100360424
408 Ga0070688_100183086
409 Ga0070688_100365053
410 Ga0070688_100728728
411 Ga0070659_100028842
412 Ga0070659_100254571
413 Ga0070667_100131589
414 Ga0070667_100203907
415 Ga0070663_100108251
416 Ga0070678_100520957
417 Ga0070681_10030830
418 Ga0070681_10266679
419 Ga0070681_10290202
420 Ga0070681_10730248
421 Ga0068867_100170156
422 Ga0068867_100783354
423 Ga0068867_101234547
424 Ga0070698_100764069
425 Ga0070679_100001303
426 Ga0070679_100022264
427 Ga0070679_100062127
428 Ga0070679_100269616
429 Ga0070679_100492816
430 Ga0068853_100063816
431 Ga0068853_100098126
432 Ga0068853_100144430
433 Ga0068853_100396926
434 Ga0068853_100476301
435 Ga0068853_101128359
436 Ga0070672_100012191
437 Ga0070686_100258783
438 Ga0070665_100457465
439 Ga0070704_100075565
440 Ga0068855_100000736
441 Ga0068855_100001274
442 Ga0068855_100029312
443 Ga0068855_100650009
444 Ga0068857_100082830
445 Ga0068857_100296577
446 Ga0068854_100018982
447 Ga0068854_100147827
448 Ga0068856_100045058
449 Ga0068856_100115589
450 Ga0068856_100652710
451 Ga0068852_100019694
452 Ga0068852_100379879
453 Ga0068852_101682655
454 Ga0068859_100000163
455 Ga0068859_102218413
456 Ga0068864_100002828
457 Ga0068864_100037552
458 Ga0068864_100219505
459 Ga0068866_10685025
460 Ga0068861_100049605
461 Ga0068851_10128190
462 Ga0068870_10207364
463 Ga0068863_100000696
464 Ga0068863_100108975
465 Ga0068863_100533695
466 Ga0068863_101124182
467 Ga0068858_100006245
468 Ga0068858_100329007
469 Ga0068860_100016791
470 Ga0068860_100066294
471 Ga0068860_100378176
472 Ga0068862_100020084
473 Ga0068862_100213428
474 Ga0068862_100623096
475 Ga0081539_10264665
476 Ga0075366_10413217
477 Ga0075366_10463807
478 Ga0097621_100001082
479 Ga0097621_100066770
480 Ga0097621_100355483
481 Ga0068871_100000076
482 Ga0068871_100018124
483 Ga0068871_100085329
484 Ga0075428_100007967
485 Ga0075431_100724693
486 Ga0075429_100006086
487 Ga0075429_100536914
488 Ga0068865_100303053
489 Ga0097620_100000163
490 Ga0097620_102218540
491 Ga0105240_10129272
492 Ga0111539_10816821
493 Ga0105247_10025204
494 Ga0105241_10000776
495 Ga0105241_10044857
496 Ga0105241_10293124
497 Ga0105242_10056860
498 Ga0105242_10246327
499 Ga0105242_10275578
500 Ga0105248_10041543
501 Ga0105248_10145818
502 Ga0105237_10003655
503 Ga0105237_10043159
504 Ga0105237_10049699
505 Ga0105237_10117777
506 Ga0105249_10001077
507 Ga0105249_10009028
508 Ga0105249_10029764
509 Ga0105249_10205302
510 Ga0105249_10281525
511 Ga0105249_10292310
512 Ga0105249_10426085
513 Ga0105249_10562215
514 Ga0105239_10002610
515 Ga0105246_10039820
516 Ga0157373_10000637
517 Ga0157373_10001085
518 Ga0157373_10045097
519 Ga0157371_10000168
520 Ga0157371_10000927
521 Ga0157371_10001216
522 Ga0157371_10001331
523 Ga0157371_10003350
524 Ga0157371_10042331
525 Ga0157370_10003228
526 Ga0157370_10004831
527 Ga0157370_10188400
528 Ga0157370_10357865
529 Ga0157370_10400669
530 Ga0157370_10780186
531 Ga0157369_10010144
532 Ga0157369_10013455
533 Ga0157369_10024032
534 Ga0157369_10162081
535 Ga0157378_10015905
536 Ga0157378_10193151
537 Ga0157378_11157684
538 Ga0163162_10000214
539 Ga0163162_10000785
540 Ga0163162_10003791
541 Ga0163162_10147912
542 Ga0163162_10643971
543 Ga0163162_11174728
544 Ga0157372_10018127
545 Ga0157372_10021003
546 Ga0157372_10146387
547 Ga0157372_10178610
548 Ga0157372_10215566
549 Ga0157372_10431210
550 Ga0157372_10630512
551 Ga0157372_10942447
552 Ga0157372_11000541
553 Ga0157372_11292886
554 Ga0157375_10000125
555 Ga0157375_10107198
556 Ga0157375_10202834
557 Ga0163163_10000281
558 Ga0157380_10113554
559 Ga0157380_10340148
560 Ga0157380_10435603
561 Ga0157380_10756357
562 Ga0157377_10218988
563 Ga0157377_10308534
564 Ga0157379_10021126
565 Ga0157379_10086232
566 Ga0157379_10100120
567 Ga0157379_10264952
568 Ga0157376_10002516
569 Ga0157376_10020155
570 Ga0157376_10103773
571 Ga0157376_10105208
572 Ga0157376_10391791
573 Ga0163161_10000612
574 Ga0163161_10104134
575 Ga0163161_10342130
576 Ga0209646_1000876
577 Ga0207666_1003071
578 Ga0207656_10022742
579 Ga0207682_10119336
580 Ga0207710_10326281
581 Ga0207680_10000068
582 Ga0207647_10221503
583 Ga0207643_10006704
584 Ga0207705_10001654
585 Ga0207705_10203289
586 Ga0207705_10338796
587 Ga0207684_10606414
588 Ga0207654_10047325
589 Ga0207654_10051399
590 Ga0207654_10132328
591 Ga0207707_10026016
592 Ga0207707_10224065
593 Ga0207707_10294916
594 Ga0207695_10000057
595 Ga0207695_10000459
596 Ga0207695_10013256
597 Ga0207671_10003201
598 Ga0207660_10025340
599 Ga0207660_10378925
600 Ga0207660_10595160
601 Ga0207657_10025089
602 Ga0207657_10144950
603 Ga0207657_10278345
604 Ga0207652_10000023
605 Ga0207652_10000960
606 Ga0207652_10111647
607 Ga0207650_10152787
608 Ga0207650_10287988
609 Ga0207659_10404623
610 Ga0207644_10068464
611 Ga0207644_10095424
612 Ga0207690_10056579
613 Ga0207690_10094017
614 Ga0207706_10576138
615 Ga0207706_10939722
616 Ga0207686_10001894
617 Ga0207686_10168788
618 Ga0207691_10003639
619 Ga0207711_10026061
620 Ga0207711_10563748
621 Ga0207689_10001987
622 Ga0207689_10038078
623 Ga0207689_10046921
624 Ga0207689_10358712
625 Ga0207661_10032435
626 Ga0207667_10010518
627 Ga0207667_10016006
628 Ga0207667_10035088
629 Ga0207667_10036915
630 Ga0207667_10472046
631 Ga0207667_10985660
632 Ga0207651_10085341
633 Ga0207651_10142504
634 Ga0207651_10308367
635 Ga0207712_10007626
636 Ga0207712_10023714
637 Ga0207712_10039196
638 Ga0207712_10059710
639 Ga0207712_10672353
640 Ga0207658_10707685
641 Ga0207658_11037737
642 Ga0207677_10437698
643 Ga0207703_10012177
644 Ga0207703_10128079
645 Ga0207639_10017651
646 Ga0207639_10213801
647 Ga0207639_10575080
648 Ga0207678_10054750
649 Ga0207678_10380919
650 Ga0207678_10593554
651 Ga0207702_10038291
652 Ga0207702_10229432
653 Ga0207702_10398763
654 Ga0207641_10000176
655 Ga0207641_10026387
656 Ga0207641_10043339
657 Ga0207641_10460286
658 Ga0207648_10058269
659 Ga0207648_10143134
660 Ga0207648_10197237
661 Ga0207648_10283679
662 Ga0207676_10202227
663 Ga0207676_10757144
664 Ga0207674_10100254
665 Ga0207675_100240385
666 Ga0207675_100485901
667 Ga0207683_10068566
668 Ga0207683_10201827
669 Ga0207698_10048470
670 Ga0207698_10313856
671 Ga0207698_11154766
672 Ga0207698_11220688
673 Ga0207698_11535251
674 Ga0268266_10375033
675 Ga0268265_10011026
676 Ga0268265_10461407
677 Ga0268265_10579722
678 Ga0268265_10586344
679 Ga0268264_10018258
680 Ga0268264_10455697
681 Ga0268264_10570415
682 Ga0307513_10069632
683 Ga0307413_11390317
684 Ga0307415_100997519
685 Ga0395899_0000813
686 Ga0395899_0002508
687 Ga0395899_0026172
688 Ga0395899_0154499
689 Ga0395899_0216747
690 Ga0395899_0429116
691 Ga0395900_0048019
692 Ga0395900_0060250
693 Ga0395900_0069211
694 Ga0395900_0104454
695 Ga0395900_0132358
696 Ga0395900_0345124
697 Ga0395898_0000480
698 Ga0395898_0002998
699 Ga0395898_0047542
700 Ga0395898_0081904
701 Ga0395905_0024675
702 Ga0395905_0040189
703 Ga0395905_1109907
704 Ga0395901_0003224
705 Ga0395901_0003385
706 Ga0395901_0087664
707 Ga0395901_0199110
708 Ga0395901_0920264
709 Ga0451798_0434390
710 Ga0451800_0035518
711 Ga0439441_035945
712 Ga0439435_0075271
713 Ga0466972_0000017
714 Ga0466972_0010179
715 Ga0466965_0387263
716 Ga0466966_0000295
717 Ga0466968_0240752
718 Ga0466957_0000760
719 Ga0495606_0008633
720 Ga0495621_0009137
721 Ga0495633_0012070
722 Ga0495635_0343877
723 Ga0495658_0427991
724 Ga0495670_0018192
725 Ga0495670_0074063
726 Ga0495674_0484372
727 Ga0495676_0412594
728 Ga0496105_0845412
729 Ga0496107_0684252
730 Ga0496114_0053499
731 Ga0496115_0271982
732 Ga0501043_0311962
733 Ga0501047_0031890
734 Ga0501047_0083436
735 Ga0501225_0013315
736 Ga0501035_0450945
737 Ga0501044_0058351
738 Ga0501044_0170834
739 Ga0501284_00005
740 nmdc:mga0k408_20889_c1
741 nmdc:mga09592_775726_c1
742 nmdc:mga09592_99412_c1
743 nmdc:mga0qj67_440258_c1
744 nmdc:mga06r32_1150175_c1
745 nmdc:mga08y16_114222_c1
746 nmdc:mga08y16_613919_c1
747 Ga0500646_0099131
748 Ga0500642_0011138
749 Ga0500658_0127046
750 Ga0500559_0006118
751 Ga0500604_0091172
752 Ga0500636_0084641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

47

177

0.97

PF18306

LDcluster4

SLOG cluster4 family

3

165

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zbl-assembly2.cif.gz_D crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.958 2 171
5zbl-assembly2.cif.gz_C crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9569 2 176
5zbl-assembly1.cif.gz_B crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9567 1 178
5its-assembly2.cif.gz_C crystal structure of log from corynebacterium glutamicum 0.9484 1 178
5zbj-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 0.9448 2 178
ID Description Score Start End Superfamily
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9653 4 178 3.40.50.450
5zblB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9567 1 178 3.40.50.450
af_A4HXF6_126_320_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9474 4 178 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9392 4 178 3.40.50.450
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9364 4 179 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A1G6T4V6-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9918 1 176 GO:0005829
GO:0009691
GO:0016799
AF-A0A5C9C8Q9-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9883 1 159 GO:0005829
GO:0009691
GO:0016799
AF-A0A3C1YP56-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9883 2 157 GO:0005829
GO:0009691
GO:0016799
AF-A0A4U3KTI3-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9851 3 178 GO:0005829
GO:0009691
GO:0016799
AF-A0A357Z7P5-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.983 1 178 GO:0005829
GO:0009691
GO:0016799

Map