F427334

General Info

Members Datasets Scaffolds Average Seq Length
376 216 752 355

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10347938|Ga0114129_103479382
Length 377
Sequence MVRTLQNSTYVLYFRVMSDPRDRQLAELLVDTCVGVQPGWQVVVAGSPPGRPLLEEIVRVVAERDAYALLRLTFDDASLTPRTWVRAAPIERLAIPAALDVHTIENCDALIVVVSPENTRDASDIPQDRMAAVQGAYRPALERMFRNELPWVGCQYPTPALAQEAGMSTDDFADFLYGACLRDWQAEGERMRRYAERFDAADEVRIVGAETDLRLSLAGRMMKVDAGGANIPGGEFFGCPVEDSAEGTIAFTEFPAVYAGREMNGIRLRFEGGRVVDASAETNEDYLLETLDADEGSRGLGELGIGCNPGITRYMRNTLFDEKIDGTVHLALGNGLPDLGGTNVSRIHWDIVKDLRLPGTRIELDGEIVQQDGAWLI

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
138 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.84
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10347938 3300009147 Bacteria 1964
2 JGI24738J21930_10012503 3300002075 Unclassified 1854
3 Ga0070658_10144757 3300005327 Unclassified 1987
4 Ga0070683_100020509 3300005329 Bacteria 5882
5 Ga0070683_100103313 3300005329 Bacteria 2685
6 Ga0070683_100272955 3300005329 Bacteria 1608
7 Ga0070683_100367651 3300005329 Bacteria 1370
8 Ga0068869_100091118 3300005334 Bacteria 2293
9 Ga0068869_100187327 3300005334 Bacteria 1625
10 Ga0070680_100104021 3300005336 Bacteria 2359
11 Ga0070682_100098570 3300005337 Bacteria 1925
12 Ga0070660_100052756 3300005339 Bacteria 3135
13 Ga0070660_100137805 3300005339 Unclassified 1956
14 Ga0070691_10023959 3300005341 Bacteria 2835
15 Ga0070661_100017203 3300005344 Bacteria 5126
16 Ga0070661_100085221 3300005344 Bacteria 2334
17 Ga0070692_10044611 3300005345 Bacteria 2284
18 Ga0070692_10062060 3300005345 Bacteria 1971
19 Ga0070668_100076504 3300005347 Bacteria 2614
20 Ga0070668_100109606 3300005347 Bacteria 2196
21 Ga0070675_100381356 3300005354 Unclassified 1255
22 Ga0070671_100068778 3300005355 Bacteria 2953
23 Ga0070671_100167738 3300005355 Unclassified 1856
24 Ga0070674_100032145 3300005356 Bacteria 3483
25 Ga0070674_100069142 3300005356 Bacteria 2490
26 Ga0070674_100106820 3300005356 Unclassified 2049
27 Ga0070674_100120346 3300005356 Unclassified 1943
28 Ga0070688_100046554 3300005365 Bacteria 2686
29 Ga0070659_100029405 3300005366 Bacteria 4246
30 Ga0070714_100264151 3300005435 Archaea 1594
31 Ga0070713_100026706 3300005436 Bacteria 4537
32 Ga0070700_100083142 3300005441 Bacteria 2072
33 Ga0070663_100093404 3300005455 Bacteria 2232
34 Ga0070678_100297011 3300005456 Unclassified 1371
35 Ga0070685_10098258 3300005466 Bacteria 1783
36 Ga0070685_10256322 3300005466 Bacteria 1161
37 Ga0070706_100287407 3300005467 Bacteria 1535
38 Ga0070698_100003473 3300005471 Bacteria 17340
39 Ga0070698_100179040 3300005471 Bacteria 2059
40 Ga0070679_100066390 3300005530 Bacteria 3596
41 Ga0070679_100261930 3300005530 Bacteria 1684
42 Ga0070679_100269634 3300005530 Unclassified 1656
43 Ga0070684_100005680 3300005535 Bacteria 9581
44 Ga0070684_100062038 3300005535 Bacteria 3274
45 Ga0070684_100087827 3300005535 Bacteria 2761
46 Ga0070684_100174342 3300005535 Unclassified 1954
47 Ga0070672_100048511 3300005543 Bacteria 3300
48 Ga0070672_100250247 3300005543 Unclassified 1492
49 Ga0070686_100246092 3300005544 Unclassified 1304
50 Ga0070695_100181927 3300005545 Bacteria 1490
51 Ga0070693_100126059 3300005547 Bacteria 1594
52 Ga0070665_100064344 3300005548 Bacteria 3677
53 Ga0070704_100019459 3300005549 Bacteria 4362
54 Ga0068855_100018781 3300005563 Bacteria 8311
55 Ga0068855_100049326 3300005563 Bacteria 4965
56 Ga0068855_100067282 3300005563 Bacteria 4174
57 Ga0068855_100296150 3300005563 Unclassified 1793
58 Ga0070664_100263634 3300005564 Bacteria 1551
59 Ga0068857_100001657 3300005577 Bacteria 17868
60 Ga0068857_100133138 3300005577 Bacteria 2243
61 Ga0068854_100080360 3300005578 Unclassified 2406
62 Ga0068854_100089854 3300005578 Bacteria 2283
63 Ga0068854_100249340 3300005578 Bacteria 1417
64 Ga0068856_100030064 3300005614 Bacteria 5309
65 Ga0068856_100061282 3300005614 Bacteria 3716
66 Ga0070702_100170161 3300005615 Unclassified 1416
67 Ga0068852_100057896 3300005616 Bacteria 3354
68 Ga0068861_100011118 3300005719 Bacteria 6250
69 Ga0068861_100101335 3300005719 Bacteria 2290
70 Ga0068851_10045406 3300005834 Bacteria 2220
71 Ga0068870_10063429 3300005840 Unclassified 1993
72 Ga0068870_10073602 3300005840 Bacteria 1869
73 Ga0068862_100088210 3300005844 Bacteria 2699
74 Ga0081455_10012200 3300005937 Bacteria 8581
75 Ga0081455_10039908 3300005937 Bacteria 4144
76 Ga0081455_10059667 3300005937 Bacteria 3220
77 Ga0081540_1002631 3300005983 Bacteria 14595
78 Ga0081540_1010298 3300005983 Bacteria 6343
79 Ga0081540_1026069 3300005983 Bacteria 3347
80 Ga0081539_10000452 3300005985 Bacteria 87416
81 Ga0070717_10003729 3300006028 Bacteria 10945
82 Ga0075432_10009808 3300006058 Bacteria 3256
83 Ga0075428_100093008 3300006844 Bacteria 3287
84 Ga0075428_100448659 3300006844 Bacteria 1382
85 Ga0075430_100085767 3300006846 Bacteria 2636
86 Ga0075431_100038410 3300006847 Bacteria 4930
87 Ga0075433_10076980 3300006852 Archaea 2938
88 Ga0068865_100214302 3300006881 Unclassified 1502
89 Ga0075435_100077880 3300007076 Bacteria 2718
90 Ga0105240_10195035 3300009093 Unclassified 2379
91 Ga0111539_10011207 3300009094 Bacteria 11268
92 Ga0111539_10120305 3300009094 Bacteria 3076
93 Ga0111539_10131267 3300009094 Archaea 2933
94 Ga0105245_10050693 3300009098 Bacteria 3721
95 Ga0105245_10093371 3300009098 Bacteria 2772
96 Ga0105245_10137879 3300009098 Bacteria 2294
97 Ga0105245_10188580 3300009098 Bacteria 1974
98 Ga0105245_10197152 3300009098 Unclassified 1932
99 Ga0114129_10177748 3300009147 Archaea 2898
100 Ga0105243_10014915 3300009148 Bacteria 5881
101 Ga0105243_10026456 3300009148 Bacteria 4440
102 Ga0105243_10050737 3300009148 Bacteria 3279
103 Ga0105241_10197706 3300009174 Bacteria 1677
104 Ga0105242_10018030 3300009176 Bacteria 5513
105 Ga0105242_10118167 3300009176 Unclassified 2271
106 Ga0105242_10308289 3300009176 Bacteria 1447
107 Ga0105248_10044555 3300009177 Bacteria 4976
108 Ga0105248_10080349 3300009177 Bacteria 3665
109 Ga0105238_10080869 3300009551 Bacteria 3238
110 Ga0105238_10370073 3300009551 Unclassified 1423
111 Ga0105249_10012350 3300009553 Bacteria 7526
112 Ga0105249_10555393 3300009553 Unclassified 1199
113 Ga0105239_10013170 3300010375 Bacteria 9189
114 Ga0105239_10020046 3300010375 Bacteria 7378
115 Ga0105239_10090022 3300010375 Bacteria 3385
116 Ga0105239_10190210 3300010375 Bacteria 2298
117 Ga0105239_10372668 3300010375 Bacteria 1613
118 Ga0157371_10077509 3300013102 Bacteria 2353
119 Ga0157370_10099855 3300013104 Bacteria 2720
120 Ga0157369_10116433 3300013105 Bacteria 2838
121 Ga0157374_10153774 3300013296 Bacteria 2238
122 Ga0157372_10043895 3300013307 Bacteria 4952
123 Ga0157372_10046891 3300013307 Bacteria 4799
124 Ga0157372_10051000 3300013307 Unclassified 4604
125 Ga0157372_10360555 3300013307 Bacteria 1694
126 Ga0157375_10175790 3300013308 Bacteria 2290
127 Ga0163163_10213521 3300014325 Bacteria 1978
128 Ga0157380_10102654 3300014326 Unclassified 2385
129 Ga0157377_10082238 3300014745 Bacteria 1885
130 Ga0157376_10244067 3300014969 Unclassified 1674
131 Ga0163161_10034871 3300017792 Bacteria 3600
132 Ga0163161_10130011 3300017792 Unclassified 1898
133 Ga0206353_11676942 3300020082 Bacteria 1835
134 Ga0207692_10060206 3300025898 Bacteria 1963
135 Ga0207688_10004416 3300025901 Bacteria 7653
136 Ga0207688_10012955 3300025901 Bacteria 4533
137 Ga0207688_10079363 3300025901 Unclassified 1872
138 Ga0207684_10118307 3300025910 Bacteria 2270
139 Ga0207707_10120103 3300025912 Bacteria 2297
140 Ga0207707_10215742 3300025912 Bacteria 1670
141 Ga0207671_10186976 3300025914 Bacteria 1614
142 Ga0207662_10094557 3300025918 Unclassified 1843
143 Ga0207657_10025527 3300025919 Bacteria 5447
144 Ga0207649_10135153 3300025920 Unclassified 1680
145 Ga0207652_10116679 3300025921 Bacteria 2372
146 Ga0207652_10151504 3300025921 Bacteria 2076
147 Ga0207681_10105321 3300025923 Unclassified 2042
148 Ga0207681_10263585 3300025923 Unclassified 1350
149 Ga0207694_10098349 3300025924 Bacteria 2316
150 Ga0207687_10010149 3300025927 Bacteria 6159
151 Ga0207687_10038418 3300025927 Bacteria 3272
152 Ga0207706_10028315 3300025933 Bacteria 5004
153 Ga0207706_10053701 3300025933 Unclassified 3557
154 Ga0207706_10088817 3300025933 Bacteria 2717
155 Ga0207686_10137606 3300025934 Unclassified 1684
156 Ga0207709_10018081 3300025935 Bacteria 3944
157 Ga0207709_10085353 3300025935 Unclassified 2047
158 Ga0207669_10084714 3300025937 Unclassified 2043
159 Ga0207704_10073662 3300025938 Bacteria 2176
160 Ga0207704_10200936 3300025938 Bacteria 1459
161 Ga0207691_10028260 3300025940 Bacteria 5253
162 Ga0207691_10063125 3300025940 Bacteria 3360
163 Ga0207711_10029707 3300025941 Bacteria 4611
164 Ga0207711_10346343 3300025941 Bacteria 1375
165 Ga0207689_10155201 3300025942 Unclassified 1887
166 Ga0207661_10030884 3300025944 Bacteria 4131
167 Ga0207661_10119122 3300025944 Unclassified 2245
168 Ga0207661_10146306 3300025944 Bacteria 2039
169 Ga0207667_10117266 3300025949 Bacteria 2744
170 Ga0207667_10221693 3300025949 Unclassified 1937
171 Ga0207712_10077198 3300025961 Unclassified 2413
172 Ga0207668_10187950 3300025972 Unclassified 1635
173 Ga0207703_10167310 3300026035 Bacteria 1931
174 Ga0207678_10134095 3300026067 Bacteria 2113
175 Ga0207702_10192996 3300026078 Bacteria 1883
176 Ga0207702_10271939 3300026078 Bacteria 1598
177 Ga0207641_10167748 3300026088 Bacteria 2001
178 Ga0207648_10085815 3300026089 Bacteria 2746
179 Ga0207648_10141261 3300026089 Bacteria 2122
180 Ga0207674_10060564 3300026116 Bacteria 3827
181 Ga0207674_10062642 3300026116 Bacteria 3757
182 Ga0207675_100004997 3300026118 Bacteria 12773
183 Ga0207675_100014864 3300026118 Bacteria 7265
184 Ga0207698_10036830 3300026142 Bacteria 3596
185 Ga0207428_10003880 3300027907 Bacteria 14334
186 Ga0207428_10015395 3300027907 Bacteria 6617
187 Ga0207428_10102318 3300027907 Unclassified 2212
188 Ga0268266_10141455 3300028379 Bacteria 2160
189 Ga0268265_10119215 3300028380 Bacteria 2171
190 Ga0268264_10184551 3300028381 Unclassified 1897
191 Ga0265319_1014763 3300028563 Bacteria 3052
192 Ga0265318_10007919 3300028577 Bacteria 4768
193 Ga0265327_10015580 3300031251 Unclassified 4895
194 Ga0307408_100099940 3300031548 Bacteria 2208
195 Ga0307408_100266886 3300031548 Bacteria 1419
196 Ga0307405_10010234 3300031731 Bacteria 4848
197 Ga0307405_10136991 3300031731 Bacteria 1701
198 Ga0307407_10006162 3300031903 Bacteria 5298
199 Ga0307412_10014823 3300031911 Bacteria 4607
200 Ga0307409_100079511 3300031995 Bacteria 2643
201 Ga0307409_100104068 3300031995 Bacteria 2363
202 Ga0307416_100011047 3300032002 Bacteria 6000
203 Ga0307416_100015913 3300032002 Bacteria 5210
204 Ga0307416_100026401 3300032002 Bacteria 4279
205 Ga0307416_100144603 3300032002 Bacteria 2168
206 Ga0307416_100268973 3300032002 Bacteria 1672
207 Ga0307414_10038137 3300032004 Bacteria 3224
208 Ga0307415_100101146 3300032126 Bacteria 2114
209 Ga0373951_0007658 3300035091 Bacteria 2452
210 Ga0373933_0036480 3300035724 Bacteria 2878
211 Ga0373937_0180160 3300036401 Bacteria 1984
212 Ga0395899_0019960 3300037312 Bacteria 5084
213 Ga0395899_0072064 3300037312 Bacteria 2528
214 Ga0395900_0007593 3300037418 Bacteria 11198
215 Ga0395900_0016329 3300037418 Bacteria 7568
216 Ga0395900_0019243 3300037418 Bacteria 6961
217 Ga0395900_0046935 3300037418 Bacteria 4447
218 Ga0395898_0032204 3300037466 Bacteria 5232
219 Ga0395898_0036532 3300037466 Bacteria 4877
220 Ga0395898_0351653 3300037466 Bacteria 1405
221 Ga0395905_0039699 3300037471 Bacteria 4416
222 Ga0395905_0109801 3300037471 Bacteria 2590
223 Ga0395905_0159516 3300037471 Bacteria 2120
224 Ga0395901_0008098 3300038443 Bacteria 10615
225 Ga0395901_0008404 3300038443 Bacteria 10434
226 Ga0395901_0019907 3300038443 Bacteria 6865
227 Ga0395901_0087717 3300038443 Bacteria 3253
228 Ga0395901_0144797 3300038443 Bacteria 2498
229 Ga0439438_010491 3300041405 Unclassified 2927
230 Ga0439461_0002692 3300041410 Unclassified 2867
231 Ga0439465_0043491 3300041413 Unclassified 1458
232 Ga0451853_2195394 3300041512 Bacteria 5540
233 Ga0439433_0001484 3300041999 Bacteria 4839
234 Ga0439433_0005511 3300041999 Bacteria 2718
235 Ga0439442_011446 3300042002 Bacteria 1807
236 Ga0439448_0000738 3300042005 Bacteria 7903
237 Ga0439449_0024015 3300042007 Bacteria 2280
238 Ga0439449_0033175 3300042007 Bacteria 1924
239 Ga0439457_021380 3300042014 Bacteria 1435
240 Ga0439446_0011465 3300042156 Bacteria 2406
241 Ga0439434_0011632 3300042435 Unclassified 2602
242 Ga0439434_0013300 3300042435 Bacteria 2442
243 Ga0466963_0018035 3300044694 Unclassified 4405
244 Ga0466964_0008588 3300044706 Bacteria 3839
245 Ga0466960_0110275 3300044901 Bacteria 1429
246 Ga0451576_0119948 3300045051 Bacteria 2738
247 Ga0466967_0022211 3300045976 Bacteria 5171
248 Ga0495641_0008081 3300046461 Bacteria 6467
249 Ga0495618_0013372 3300046514 Bacteria 4994
250 Ga0495630_0249913 3300046517 Bacteria 1355
251 Ga0495586_0025485 3300046535 Bacteria 3165
252 Ga0495667_0124169 3300046559 Bacteria 1666
253 Ga0495657_0131273 3300046675 Bacteria 1569
254 Ga0495613_0121065 3300046689 Bacteria 1879
255 Ga0495613_0198564 3300046689 Bacteria 1415
256 Ga0495670_0062569 3300046691 Bacteria 1873
257 Ga0495581_0001427 3300047315 Bacteria 13262
258 Ga0495581_0031097 3300047315 Bacteria 3093
259 Ga0495676_0108289 3300047321 Bacteria 2044
260 Ga0495677_0046958 3300047445 Unclassified 1585
261 Ga0496100_0077074 3300048903 Bacteria 2240
262 Ga0496100_0158008 3300048903 Bacteria 1623
263 Ga0496100_0282908 3300048903 Bacteria 1237
264 Ga0496101_0060490 3300048904 Bacteria 2748
265 Ga0496102_0345718 3300048905 Bacteria 1400
266 Ga0496103_0106235 3300048906 Bacteria 1780
267 Ga0496103_0134407 3300048906 Bacteria 1580
268 Ga0496103_0148202 3300048906 Bacteria 1503
269 Ga0496104_0011461 3300048907 Bacteria 7945
270 Ga0496104_0215106 3300048907 Bacteria 1834
271 Ga0496104_0417166 3300048907 Bacteria 1254
272 Ga0496105_0002296 3300048908 Bacteria 13868
273 Ga0496105_0030967 3300048908 Bacteria 4386
274 Ga0496105_0193374 3300048908 Bacteria 1663
275 Ga0496106_0105253 3300048909 Bacteria 2192
276 Ga0496107_0042959 3300048910 Bacteria 3247
277 Ga0496107_0199375 3300048910 Unclassified 1488
278 Ga0496107_0224767 3300048910 Unclassified 1397
279 Ga0496108_0065614 3300048911 Bacteria 3060
280 Ga0496108_0109219 3300048911 Bacteria 2363
281 Ga0496108_0175519 3300048911 Unclassified 1855
282 Ga0496108_0198768 3300048911 Bacteria 1739
283 Ga0496109_0008847 3300048912 Bacteria 8574
284 Ga0496109_0065146 3300048912 Bacteria 3335
285 Ga0496109_0146530 3300048912 Bacteria 2209
286 Ga0496109_0501231 3300048912 Bacteria 1146
287 Ga0496110_0006394 3300048913 Bacteria 9322
288 Ga0496110_0186810 3300048913 Bacteria 1882
289 Ga0496110_0197592 3300048913 Archaea 1827
290 Ga0496110_0289433 3300048913 Bacteria 1492
291 Ga0496111_0001732 3300048914 Bacteria 12767
292 Ga0496111_0045995 3300048914 Bacteria 3141
293 Ga0496112_0186702 3300048915 Bacteria 2036
294 Ga0496113_0031105 3300048916 Bacteria 3870
295 Ga0496113_0055720 3300048916 Bacteria 2965
296 Ga0496113_0120439 3300048916 Bacteria 2051
297 Ga0496114_0098023 3300048917 Bacteria 2498
298 Ga0501032_0004462 3300049569 Bacteria 10550
299 Ga0501032_0027273 3300049569 Archaea 3926
300 Ga0501033_0122704 3300049570 Archaea 1884
301 Ga0501034_0441613 3300049571 Bacteria 1220
302 Ga0501036_0020069 3300049572 Bacteria 5611
303 Ga0501036_0035014 3300049572 Bacteria 4247
304 Ga0501037_0079409 3300049573 Bacteria 2381
305 Ga0501038_0037025 3300049574 Bacteria 4280
306 Ga0501039_0057980 3300049575 Bacteria 2998
307 Ga0501039_0131918 3300049575 Archaea 1960
308 Ga0501040_0010539 3300049576 Archaea 6045
309 Ga0501040_0028944 3300049576 Bacteria 3736
310 Ga0501041_0002924 3300049577 Bacteria 9797
311 Ga0501041_0010834 3300049577 Bacteria 5378
312 Ga0501042_0027782 3300049578 Bacteria 3980
313 Ga0501043_0006002 3300049579 Bacteria 9765
314 Ga0501043_0008431 3300049579 Archaea 8115
315 Ga0501046_0028563 3300049580 Archaea 4541
316 Ga0501046_0032519 3300049580 Bacteria 4224
317 Ga0501046_0140566 3300049580 Bacteria 1827
318 Ga0501048_0008691 3300049582 Archaea 7655
319 Ga0501048_0025436 3300049582 Bacteria 4313
320 Ga0501067_0026777 3300049583 Bacteria 3193
321 Ga0501067_0029988 3300049583 Bacteria 3015
322 Ga0501067_0122212 3300049583 Bacteria 1449
323 Ga0501068_0016473 3300049584 Archaea 4260
324 Ga0501069_0010037 3300049585 Bacteria 5007
325 Ga0501069_0014328 3300049585 Bacteria 4238
326 Ga0501069_0041507 3300049585 Archaea 2543
327 Ga0501069_0089399 3300049585 Bacteria 1741
328 Ga0501070_0127702 3300049586 Bacteria 2101
329 Ga0501071_0021537 3300049587 Archaea 4489
330 Ga0501071_0026919 3300049587 Bacteria 4041
331 Ga0501071_0080580 3300049587 Bacteria 2381
332 Ga0501072_0003207 3300049588 Bacteria 12282
333 Ga0501072_0008304 3300049588 Bacteria 7887
334 Ga0501072_0164671 3300049588 Bacteria 1769
335 Ga0501074_0001713 3300049590 Bacteria 14966
336 Ga0501074_0091905 3300049590 Bacteria 2173
337 Ga0501075_0001917 3300049591 Bacteria 13721
338 Ga0501075_0009357 3300049591 Bacteria 6853
339 Ga0501075_0015984 3300049591 Bacteria 5398
340 Ga0501076_0006337 3300049592 Archaea 8576
341 Ga0501076_0034415 3300049592 Bacteria 3959
342 Ga0501077_0005602 3300049593 Bacteria 7647
343 Ga0501077_0131439 3300049593 Bacteria 1587
344 Ga0501079_0028148 3300049741 Bacteria 4311
345 Ga0501079_0044040 3300049741 Archaea 3444
346 Ga0501080_0143047 3300049742 Bacteria 2211
347 Ga0501083_0004439 3300049744 Bacteria 9907
348 Ga0501035_0002024 3300049822 Bacteria 20202
349 Ga0501035_0020893 3300049822 Bacteria 6016
350 Ga0501044_0116939 3300049823 Archaea 2671
351 Ga0501045_0021928 3300049824 Bacteria 4570
352 Ga0501045_0069586 3300049824 Bacteria 2587
353 Ga0501045_0087435 3300049824 Archaea 2301
354 nmdc:mga05p37_262088_c1 3300050507 Archaea 2068
355 nmdc:mga05p37_306865_c1 3300050507 Bacteria 1883
356 nmdc:mga09592_146123_c1 3300050508 Bacteria 2039
357 nmdc:mga0qj67_22779_c1 3300050509 Bacteria 4812
358 nmdc:mga06r32_45327_c1 3300050510 Bacteria 4191
359 nmdc:mga08y16_107904_c1 3300050511 Archaea 2898
360 nmdc:mga08y16_62036_c1 3300050511 Bacteria 3904
361 nmdc:mga08y16_689988_c1 3300050511 Bacteria 1022
362 nmdc:mga08x19_103562_c1 3300050514 Bacteria 1891
363 nmdc:mga0a205_125677_c1 3300050515 Archaea 2464
364 nmdc:mga0a205_158068_c1 3300050515 Bacteria 2164
365 nmdc:mga0a205_192605_c1 3300050515 Bacteria 1931
366 Ga0495601_0153607 3300053077 Bacteria 1503
367 Ga0495601_0168007 3300053077 Bacteria 1433
368 Ga0495619_0023906 3300053085 Bacteria 3918
369 Ga0495619_0051595 3300053085 Bacteria 2718
370 Ga0495619_0068630 3300053085 Bacteria 2369
371 Ga0501084_0015272 3300054114 Bacteria 6367
372 Ga0501082_0010255 3300060353 Archaea 8067
373 Ga0501082_0061298 3300060353 Bacteria 3238
374 Ga0501082_0166360 3300060353 Bacteria 1916
375 Ga0466962_0026172 3300061719 Bacteria 2802
376 Ga0530510_0054287 3300061734 Bacteria 2895
377 Ga0114129_10347938
378 JGI24738J21930_10012503
379 Ga0070658_10144757
380 Ga0070683_100020509
381 Ga0070683_100103313
382 Ga0070683_100272955
383 Ga0070683_100367651
384 Ga0068869_100091118
385 Ga0068869_100187327
386 Ga0070680_100104021
387 Ga0070682_100098570
388 Ga0070660_100052756
389 Ga0070660_100137805
390 Ga0070691_10023959
391 Ga0070661_100017203
392 Ga0070661_100085221
393 Ga0070692_10044611
394 Ga0070692_10062060
395 Ga0070668_100076504
396 Ga0070668_100109606
397 Ga0070675_100381356
398 Ga0070671_100068778
399 Ga0070671_100167738
400 Ga0070674_100032145
401 Ga0070674_100069142
402 Ga0070674_100106820
403 Ga0070674_100120346
404 Ga0070688_100046554
405 Ga0070659_100029405
406 Ga0070714_100264151
407 Ga0070713_100026706
408 Ga0070700_100083142
409 Ga0070663_100093404
410 Ga0070678_100297011
411 Ga0070685_10098258
412 Ga0070685_10256322
413 Ga0070706_100287407
414 Ga0070698_100003473
415 Ga0070698_100179040
416 Ga0070679_100066390
417 Ga0070679_100261930
418 Ga0070679_100269634
419 Ga0070684_100005680
420 Ga0070684_100062038
421 Ga0070684_100087827
422 Ga0070684_100174342
423 Ga0070672_100048511
424 Ga0070672_100250247
425 Ga0070686_100246092
426 Ga0070695_100181927
427 Ga0070693_100126059
428 Ga0070665_100064344
429 Ga0070704_100019459
430 Ga0068855_100018781
431 Ga0068855_100049326
432 Ga0068855_100067282
433 Ga0068855_100296150
434 Ga0070664_100263634
435 Ga0068857_100001657
436 Ga0068857_100133138
437 Ga0068854_100080360
438 Ga0068854_100089854
439 Ga0068854_100249340
440 Ga0068856_100030064
441 Ga0068856_100061282
442 Ga0070702_100170161
443 Ga0068852_100057896
444 Ga0068861_100011118
445 Ga0068861_100101335
446 Ga0068851_10045406
447 Ga0068870_10063429
448 Ga0068870_10073602
449 Ga0068862_100088210
450 Ga0081455_10012200
451 Ga0081455_10039908
452 Ga0081455_10059667
453 Ga0081540_1002631
454 Ga0081540_1010298
455 Ga0081540_1026069
456 Ga0081539_10000452
457 Ga0070717_10003729
458 Ga0075432_10009808
459 Ga0075428_100093008
460 Ga0075428_100448659
461 Ga0075430_100085767
462 Ga0075431_100038410
463 Ga0075433_10076980
464 Ga0068865_100214302
465 Ga0075435_100077880
466 Ga0105240_10195035
467 Ga0111539_10011207
468 Ga0111539_10120305
469 Ga0111539_10131267
470 Ga0105245_10050693
471 Ga0105245_10093371
472 Ga0105245_10137879
473 Ga0105245_10188580
474 Ga0105245_10197152
475 Ga0114129_10177748
476 Ga0105243_10014915
477 Ga0105243_10026456
478 Ga0105243_10050737
479 Ga0105241_10197706
480 Ga0105242_10018030
481 Ga0105242_10118167
482 Ga0105242_10308289
483 Ga0105248_10044555
484 Ga0105248_10080349
485 Ga0105238_10080869
486 Ga0105238_10370073
487 Ga0105249_10012350
488 Ga0105249_10555393
489 Ga0105239_10013170
490 Ga0105239_10020046
491 Ga0105239_10090022
492 Ga0105239_10190210
493 Ga0105239_10372668
494 Ga0157371_10077509
495 Ga0157370_10099855
496 Ga0157369_10116433
497 Ga0157374_10153774
498 Ga0157372_10043895
499 Ga0157372_10046891
500 Ga0157372_10051000
501 Ga0157372_10360555
502 Ga0157375_10175790
503 Ga0163163_10213521
504 Ga0157380_10102654
505 Ga0157377_10082238
506 Ga0157376_10244067
507 Ga0163161_10034871
508 Ga0163161_10130011
509 Ga0206353_11676942
510 Ga0207692_10060206
511 Ga0207688_10004416
512 Ga0207688_10012955
513 Ga0207688_10079363
514 Ga0207684_10118307
515 Ga0207707_10120103
516 Ga0207707_10215742
517 Ga0207671_10186976
518 Ga0207662_10094557
519 Ga0207657_10025527
520 Ga0207649_10135153
521 Ga0207652_10116679
522 Ga0207652_10151504
523 Ga0207681_10105321
524 Ga0207681_10263585
525 Ga0207694_10098349
526 Ga0207687_10010149
527 Ga0207687_10038418
528 Ga0207706_10028315
529 Ga0207706_10053701
530 Ga0207706_10088817
531 Ga0207686_10137606
532 Ga0207709_10018081
533 Ga0207709_10085353
534 Ga0207669_10084714
535 Ga0207704_10073662
536 Ga0207704_10200936
537 Ga0207691_10028260
538 Ga0207691_10063125
539 Ga0207711_10029707
540 Ga0207711_10346343
541 Ga0207689_10155201
542 Ga0207661_10030884
543 Ga0207661_10119122
544 Ga0207661_10146306
545 Ga0207667_10117266
546 Ga0207667_10221693
547 Ga0207712_10077198
548 Ga0207668_10187950
549 Ga0207703_10167310
550 Ga0207678_10134095
551 Ga0207702_10192996
552 Ga0207702_10271939
553 Ga0207641_10167748
554 Ga0207648_10085815
555 Ga0207648_10141261
556 Ga0207674_10060564
557 Ga0207674_10062642
558 Ga0207675_100004997
559 Ga0207675_100014864
560 Ga0207698_10036830
561 Ga0207428_10003880
562 Ga0207428_10015395
563 Ga0207428_10102318
564 Ga0268266_10141455
565 Ga0268265_10119215
566 Ga0268264_10184551
567 Ga0265319_1014763
568 Ga0265318_10007919
569 Ga0265327_10015580
570 Ga0307408_100099940
571 Ga0307408_100266886
572 Ga0307405_10010234
573 Ga0307405_10136991
574 Ga0307407_10006162
575 Ga0307412_10014823
576 Ga0307409_100079511
577 Ga0307409_100104068
578 Ga0307416_100011047
579 Ga0307416_100015913
580 Ga0307416_100026401
581 Ga0307416_100144603
582 Ga0307416_100268973
583 Ga0307414_10038137
584 Ga0307415_100101146
585 Ga0373951_0007658
586 Ga0373933_0036480
587 Ga0373937_0180160
588 Ga0395899_0019960
589 Ga0395899_0072064
590 Ga0395900_0007593
591 Ga0395900_0016329
592 Ga0395900_0019243
593 Ga0395900_0046935
594 Ga0395898_0032204
595 Ga0395898_0036532
596 Ga0395898_0351653
597 Ga0395905_0039699
598 Ga0395905_0109801
599 Ga0395905_0159516
600 Ga0395901_0008098
601 Ga0395901_0008404
602 Ga0395901_0019907
603 Ga0395901_0087717
604 Ga0395901_0144797
605 Ga0439438_010491
606 Ga0439461_0002692
607 Ga0439465_0043491
608 Ga0451853_2195394
609 Ga0439433_0001484
610 Ga0439433_0005511
611 Ga0439442_011446
612 Ga0439448_0000738
613 Ga0439449_0024015
614 Ga0439449_0033175
615 Ga0439457_021380
616 Ga0439446_0011465
617 Ga0439434_0011632
618 Ga0439434_0013300
619 Ga0466963_0018035
620 Ga0466964_0008588
621 Ga0466960_0110275
622 Ga0451576_0119948
623 Ga0466967_0022211
624 Ga0495641_0008081
625 Ga0495618_0013372
626 Ga0495630_0249913
627 Ga0495586_0025485
628 Ga0495667_0124169
629 Ga0495657_0131273
630 Ga0495613_0121065
631 Ga0495613_0198564
632 Ga0495670_0062569
633 Ga0495581_0001427
634 Ga0495581_0031097
635 Ga0495676_0108289
636 Ga0495677_0046958
637 Ga0496100_0077074
638 Ga0496100_0158008
639 Ga0496100_0282908
640 Ga0496101_0060490
641 Ga0496102_0345718
642 Ga0496103_0106235
643 Ga0496103_0134407
644 Ga0496103_0148202
645 Ga0496104_0011461
646 Ga0496104_0215106
647 Ga0496104_0417166
648 Ga0496105_0002296
649 Ga0496105_0030967
650 Ga0496105_0193374
651 Ga0496106_0105253
652 Ga0496107_0042959
653 Ga0496107_0199375
654 Ga0496107_0224767
655 Ga0496108_0065614
656 Ga0496108_0109219
657 Ga0496108_0175519
658 Ga0496108_0198768
659 Ga0496109_0008847
660 Ga0496109_0065146
661 Ga0496109_0146530
662 Ga0496109_0501231
663 Ga0496110_0006394
664 Ga0496110_0186810
665 Ga0496110_0197592
666 Ga0496110_0289433
667 Ga0496111_0001732
668 Ga0496111_0045995
669 Ga0496112_0186702
670 Ga0496113_0031105
671 Ga0496113_0055720
672 Ga0496113_0120439
673 Ga0496114_0098023
674 Ga0501032_0004462
675 Ga0501032_0027273
676 Ga0501033_0122704
677 Ga0501034_0441613
678 Ga0501036_0020069
679 Ga0501036_0035014
680 Ga0501037_0079409
681 Ga0501038_0037025
682 Ga0501039_0057980
683 Ga0501039_0131918
684 Ga0501040_0010539
685 Ga0501040_0028944
686 Ga0501041_0002924
687 Ga0501041_0010834
688 Ga0501042_0027782
689 Ga0501043_0006002
690 Ga0501043_0008431
691 Ga0501046_0028563
692 Ga0501046_0032519
693 Ga0501046_0140566
694 Ga0501048_0008691
695 Ga0501048_0025436
696 Ga0501067_0026777
697 Ga0501067_0029988
698 Ga0501067_0122212
699 Ga0501068_0016473
700 Ga0501069_0010037
701 Ga0501069_0014328
702 Ga0501069_0041507
703 Ga0501069_0089399
704 Ga0501070_0127702
705 Ga0501071_0021537
706 Ga0501071_0026919
707 Ga0501071_0080580
708 Ga0501072_0003207
709 Ga0501072_0008304
710 Ga0501072_0164671
711 Ga0501074_0001713
712 Ga0501074_0091905
713 Ga0501075_0001917
714 Ga0501075_0009357
715 Ga0501075_0015984
716 Ga0501076_0006337
717 Ga0501076_0034415
718 Ga0501077_0005602
719 Ga0501077_0131439
720 Ga0501079_0028148
721 Ga0501079_0044040
722 Ga0501080_0143047
723 Ga0501083_0004439
724 Ga0501035_0002024
725 Ga0501035_0020893
726 Ga0501044_0116939
727 Ga0501045_0021928
728 Ga0501045_0069586
729 Ga0501045_0087435
730 nmdc:mga05p37_262088_c1
731 nmdc:mga05p37_306865_c1
732 nmdc:mga09592_146123_c1
733 nmdc:mga0qj67_22779_c1
734 nmdc:mga06r32_45327_c1
735 nmdc:mga08y16_107904_c1
736 nmdc:mga08y16_62036_c1
737 nmdc:mga08y16_689988_c1
738 nmdc:mga08x19_103562_c1
739 nmdc:mga0a205_125677_c1
740 nmdc:mga0a205_158068_c1
741 nmdc:mga0a205_192605_c1
742 Ga0495601_0153607
743 Ga0495601_0168007
744 Ga0495619_0023906
745 Ga0495619_0051595
746 Ga0495619_0068630
747 Ga0501084_0015272
748 Ga0501082_0010255
749 Ga0501082_0061298
750 Ga0501082_0166360
751 Ga0466962_0026172
752 Ga0530510_0054287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02073

Peptidase_M29

Thermophilic metalloprotease (M29)

18

375

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iob-assembly1.cif.gz_B e. coli bifunctional glutathionylspermidine synthetase/amidase apo protein 0.8732 25 57
2io9-assembly1.cif.gz_B e. coli bifunctional glutathionylspermidine synthetase/amidase incomplex with mg2+ ,gsh and adp 0.86 25 58
2io8-assembly1.cif.gz_A e. coli bifunctional glutathionylspermidine synthetase/amidase incomplex with mg2+ and adp 0.8575 25 58
2io8-assembly1.cif.gz_B e. coli bifunctional glutathionylspermidine synthetase/amidase incomplex with mg2+ and adp 0.8565 25 58
2io9-assembly1.cif.gz_A e. coli bifunctional glutathionylspermidine synthetase/amidase incomplex with mg2+ ,gsh and adp 0.8552 25 58
ID Description Score Start End Superfamily
3od1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8104 23 59 3.40.50.12590
4icsB01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.7862 4 160 3.40.1830.10
1zjcA01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.777 4 157 3.40.1830.10
af_P75797_272_481_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7724 23 56 3.40.50.1000
2vxcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.7551 21 95 3.40.50.10190
ID Description Score Start End GO Terms
AF-A0A0G1J7E6-F1-model_v4 Leucyl aminopeptidase (Aminopeptidase T) 0.9838 137 299 GO:0004177
GO:0006508
GO:0046872
AF-A0A538KA87-F1-model_v4 Aminopeptidase 0.9829 150 360 GO:0004177
GO:0006508
GO:0046872
AF-A0A7W1GLK6-F1-model_v4 Aminopeptidase 0.9829 194 360 GO:0004177
GO:0006508
GO:0046872
AF-A0A7V4IZZ9-F1-model_v4 Aminopeptidase 0.9814 139 360 GO:0004177
GO:0006508
GO:0046872
AF-A0A7W1NG46-F1-model_v4 deleted 0.9804 184 359

Map