F427327

General Info

Members Datasets Scaffolds Average Seq Length
376 251 752 136

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10089648|Ga0111539_100896483
Length 158
Sequence VAGTADAQGAAVTDTPQVLFVCVHNAGRSQMAAALLDHHAKGRVQVRSAGSDPAETLNPAVVAAMAEVGIDLSRELPRPLADQAVRAADVVVTMGCGDACPIHPGRRYEDWLVQDPAGQPVEIVRGIRDQIDARVRRLLAQLLPAPDRQARTRAATPW

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
132 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
246 2643221692 Nocardia sp. Root136 Isolate Unclassified
247 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
248 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
249 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
250 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
251 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 0.27
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0
Rhizoplane 4.26
Rhizosphere 89.63
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10089648 3300009094 Bacteria 3614
2 JGI25406J46586_10003005 3300003203 Bacteria 7960
3 JGI25407J50210_10000106 3300003373 Bacteria 11628
4 JGI25407J50210_10034763 3300003373 Bacteria 1299
5 Ga0070683_100370642 3300005329 Bacteria 1364
6 Ga0070682_100172108 3300005337 Bacteria 1506
7 Ga0068868_100894190 3300005338 Bacteria 807
8 Ga0070692_10496462 3300005345 Bacteria 790
9 Ga0070675_100081432 3300005354 Bacteria 2700
10 Ga0070675_100144652 3300005354 Bacteria 2035
11 Ga0070671_100167224 3300005355 Bacteria 1860
12 Ga0070674_100014165 3300005356 Bacteria 4951
13 Ga0070674_100209307 3300005356 Bacteria 1510
14 Ga0070688_100125340 3300005365 Bacteria 1725
15 Ga0070709_11088577 3300005434 Bacteria 639
16 Ga0070714_101185251 3300005435 Bacteria 745
17 Ga0070713_100158489 3300005436 Bacteria 2019
18 Ga0070711_101548601 3300005439 Bacteria 579
19 Ga0070700_101572428 3300005441 Bacteria 561
20 Ga0070694_100335664 3300005444 Bacteria 1167
21 Ga0070708_100026386 3300005445 Bacteria 4972
22 Ga0070708_101418617 3300005445 Bacteria 648
23 Ga0070678_100047838 3300005456 Bacteria 3076
24 Ga0070662_100397619 3300005457 Bacteria 1136
25 Ga0068867_100290510 3300005459 Bacteria 1344
26 Ga0070685_10190698 3300005466 Bacteria 1326
27 Ga0070685_10220389 3300005466 Bacteria 1243
28 Ga0070707_100243487 3300005468 Bacteria 1750
29 Ga0070707_100272843 3300005468 Bacteria 1644
30 Ga0070698_100156245 3300005471 Bacteria 2226
31 Ga0070698_100268193 3300005471 Bacteria 1639
32 Ga0070698_100579087 3300005471 Bacteria 1062
33 Ga0070698_100611545 3300005471 Bacteria 1030
34 Ga0070698_100664512 3300005471 Bacteria 983
35 Ga0070699_100000073 3300005518 Bacteria 95396
36 Ga0070684_100222808 3300005535 Bacteria 1721
37 Ga0070697_100000002 3300005536 Bacteria 418511
38 Ga0070697_100001656 3300005536 Bacteria 16977
39 Ga0070672_100152947 3300005543 Bacteria 1909
40 Ga0070686_100720937 3300005544 Unclassified 797
41 Ga0070696_100559630 3300005546 Bacteria 917
42 Ga0070665_100231255 3300005548 Bacteria 1849
43 Ga0070664_100251129 3300005564 Bacteria 1590
44 Ga0070702_100050014 3300005615 Bacteria 2386
45 Ga0070702_100081511 3300005615 Bacteria 1939
46 Ga0068852_100659961 3300005616 Bacteria 1054
47 Ga0068859_100245524 3300005617 Bacteria 1880
48 Ga0068864_100388304 3300005618 Bacteria 1324
49 Ga0068866_10615368 3300005718 Bacteria 735
50 Ga0068861_100474659 3300005719 Bacteria 1125
51 Ga0068870_10134506 3300005840 Bacteria 1440
52 Ga0081455_10009934 3300005937 Bacteria 9733
53 Ga0081455_10014550 3300005937 Bacteria 7703
54 Ga0081455_10070495 3300005937 Bacteria 2902
55 Ga0081538_10004088 3300005981 Bacteria 13563
56 Ga0081538_10008171 3300005981 Bacteria 8929
57 Ga0081538_10221246 3300005981 Bacteria 750
58 Ga0081539_10002830 3300005985 Bacteria 23193
59 Ga0081539_10029700 3300005985 Bacteria 3409
60 Ga0070717_10000677 3300006028 Bacteria 21967
61 Ga0070717_10049866 3300006028 Bacteria 3438
62 Ga0075363_100366285 3300006048 Bacteria 843
63 Ga0075364_10407401 3300006051 Bacteria 928
64 Ga0070712_100392208 3300006175 Bacteria 1145
65 Ga0070712_101369171 3300006175 Bacteria 617
66 Ga0075367_10076754 3300006178 Bacteria 2016
67 Ga0068871_100546408 3300006358 Bacteria 1049
68 Ga0075428_100003635 3300006844 Bacteria 16907
69 Ga0075434_100066173 3300006871 Bacteria 3599
70 Ga0068865_100666684 3300006881 Bacteria 886
71 Ga0097620_100245533 3300006931 Bacteria 1880
72 Ga0097620_100768016 3300006931 Bacteria 1052
73 Ga0075435_100504548 3300007076 Bacteria 1046
74 Ga0075435_100848526 3300007076 Bacteria 796
75 Ga0111539_10054987 3300009094 Bacteria 4733
76 Ga0105245_11636231 3300009098 Bacteria 696
77 Ga0114129_10002806 3300009147 Bacteria 24303
78 Ga0114129_10905226 3300009147 Bacteria 1118
79 Ga0105242_10100634 3300009176 Bacteria 2448
80 Ga0105242_10192117 3300009176 Bacteria 1808
81 Ga0105242_10927307 3300009176 Bacteria 873
82 Ga0105249_10055057 3300009553 Bacteria 3637
83 Ga0105239_10162700 3300010375 Bacteria 2494
84 Ga0157378_10111965 3300013297 Bacteria 2503
85 Ga0163162_10456825 3300013306 Bacteria 1409
86 Ga0163162_10624750 3300013306 Bacteria 1202
87 Ga0157375_10274976 3300013308 Bacteria 1846
88 Ga0157375_10276868 3300013308 Bacteria 1840
89 Ga0163163_10927253 3300014325 Bacteria 934
90 Ga0157380_10625219 3300014326 Bacteria 1070
91 Ga0157377_10007906 3300014745 Bacteria 5160
92 Ga0157377_10069019 3300014745 Bacteria 2038
93 Ga0157379_10237551 3300014968 Bacteria 1652
94 Ga0206356_11854678 3300020070 Bacteria 1758
95 Ga0207653_10147664 3300025885 Bacteria 863
96 Ga0207692_10349939 3300025898 Bacteria 911
97 Ga0207688_10004008 3300025901 Bacteria 8023
98 Ga0207688_10172228 3300025901 Bacteria 1287
99 Ga0207645_10230221 3300025907 Bacteria 1223
100 Ga0207643_10034181 3300025908 Bacteria 2848
101 Ga0207643_10139303 3300025908 Bacteria 1448
102 Ga0207684_10000003 3300025910 Bacteria 766933
103 Ga0207693_10367798 3300025915 Bacteria 1125
104 Ga0207662_10220395 3300025918 Bacteria 1235
105 Ga0207646_10000552 3300025922 Bacteria 49343
106 Ga0207646_11221377 3300025922 Bacteria 658
107 Ga0207650_10119058 3300025925 Bacteria 2053
108 Ga0207650_11109632 3300025925 Bacteria 673
109 Ga0207659_10173405 3300025926 Bacteria 1703
110 Ga0207659_10258575 3300025926 Bacteria 1415
111 Ga0207659_10281299 3300025926 Bacteria 1360
112 Ga0207687_11414004 3300025927 Bacteria 598
113 Ga0207700_10238261 3300025928 Bacteria 1550
114 Ga0207664_10228757 3300025929 Bacteria 1616
115 Ga0207664_11616620 3300025929 Bacteria 570
116 Ga0207706_10815411 3300025933 Bacteria 792
117 Ga0207706_11077376 3300025933 Bacteria 672
118 Ga0207686_10072966 3300025934 Bacteria 2213
119 Ga0207686_10168429 3300025934 Bacteria 1542
120 Ga0207686_10320401 3300025934 Bacteria 1158
121 Ga0207709_10890170 3300025935 Bacteria 723
122 Ga0207669_10503638 3300025937 Bacteria 969
123 Ga0207704_10096347 3300025938 Bacteria 1959
124 Ga0207665_11664066 3300025939 Bacteria 505
125 Ga0207691_10323992 3300025940 Bacteria 1321
126 Ga0207661_10174945 3300025944 Bacteria 1871
127 Ga0207679_10162482 3300025945 Bacteria 1830
128 Ga0207712_10020449 3300025961 Bacteria 4334
129 Ga0207668_10075381 3300025972 Bacteria 2425
130 Ga0207668_10425552 3300025972 Bacteria 1128
131 Ga0207640_10134936 3300025981 Bacteria 1790
132 Ga0207677_10321091 3300026023 Bacteria 1287
133 Ga0207708_10004461 3300026075 Bacteria 10319
134 Ga0207708_11352763 3300026075 Bacteria 624
135 Ga0207648_10487746 3300026089 Bacteria 1126
136 Ga0207648_10829535 3300026089 Bacteria 862
137 Ga0207676_10052508 3300026095 Bacteria 3187
138 Ga0207676_10632867 3300026095 Bacteria 1031
139 Ga0207674_10704432 3300026116 Bacteria 975
140 Ga0207675_100569978 3300026118 Bacteria 1133
141 Ga0207683_10317640 3300026121 Bacteria 1426
142 Ga0207698_10387560 3300026142 Bacteria 1331
143 Ga0207698_10650688 3300026142 Bacteria 1044
144 Ga0207428_10180081 3300027907 Bacteria 1597
145 Ga0207428_10482044 3300027907 Bacteria 902
146 Ga0268266_10316396 3300028379 Bacteria 1460
147 Ga0268266_10382003 3300028379 Bacteria 1329
148 Ga0268265_11561044 3300028380 Bacteria 665
149 Ga0268264_12590521 3300028381 Bacteria 512
150 Ga0265320_10002754 3300031240 Bacteria 12136
151 Ga0307509_10069994 3300031507 Bacteria 3665
152 Ga0307408_100003406 3300031548 Bacteria 10906
153 Ga0307408_101680334 3300031548 Bacteria 604
154 Ga0307408_101955561 3300031548 Bacteria 563
155 Ga0265313_10140274 3300031595 Bacteria 1040
156 Ga0307405_10002371 3300031731 Bacteria 8290
157 Ga0307405_10035400 3300031731 Bacteria 2981
158 Ga0307413_10016593 3300031824 Bacteria 3809
159 Ga0307413_10016811 3300031824 Bacteria 3793
160 Ga0307413_10172277 3300031824 Bacteria 1533
161 Ga0307410_10012550 3300031852 Bacteria 4906
162 Ga0307410_10621486 3300031852 Bacteria 903
163 Ga0307406_10002576 3300031901 Bacteria 9877
164 Ga0307406_10526399 3300031901 Bacteria 963
165 Ga0307407_10001712 3300031903 Bacteria 8164
166 Ga0307412_10037245 3300031911 Bacteria 3124
167 Ga0307412_10164470 3300031911 Bacteria 1653
168 Ga0307409_100115460 3300031995 Bacteria 2260
169 Ga0307416_100010010 3300032002 Bacteria 6242
170 Ga0307416_100043337 3300032002 Bacteria 3522
171 Ga0307416_100099055 3300032002 Bacteria 2530
172 Ga0307414_10038991 3300032004 Bacteria 3196
173 Ga0307411_10008001 3300032005 Bacteria 5443
174 Ga0307411_10025672 3300032005 Bacteria 3535
175 Ga0307415_100012173 3300032126 Bacteria 4964
176 Ga0307415_100804597 3300032126 Bacteria 858
177 Ga0373932_0133483 3300035112 Bacteria 838
178 Ga0373939_0043517 3300035114 Bacteria 1363
179 Ga0373943_0535912 3300035170 Bacteria 686
180 Ga0373955_0007985 3300035172 Bacteria 4892
181 Ga0373937_0100829 3300036401 Bacteria 2679
182 Ga0373937_0597257 3300036401 Bacteria 1048
183 Ga0395899_0368516 3300037312 Bacteria 957
184 Ga0395899_0640359 3300037312 Bacteria 673
185 Ga0395898_0266074 3300037466 Bacteria 1635
186 Ga0395905_0202239 3300037471 Bacteria 1862
187 Ga0395905_1521028 3300037471 Bacteria 574
188 Ga0395905_1906021 3300037471 Bacteria 501
189 Ga0436364_0081572 3300037853 Bacteria 1872
190 Ga0436364_1465113 3300037853 Bacteria 1776
191 Ga0395901_0015351 3300038443 Bacteria 7794
192 Ga0395901_0313858 3300038443 Bacteria 1623
193 Ga0436361_0437541 3300039447 Bacteria 1014
194 Ga0439439_0021038 3300041406 Bacteria 1623
195 Ga0451835_0518516 3300041492 Bacteria 519
196 Ga0439431_0002698 3300041997 Bacteria 3901
197 Ga0439433_0005959 3300041999 Bacteria 2619
198 Ga0439442_001472 3300042002 Bacteria 4637
199 Ga0439445_0057863 3300042004 Bacteria 1056
200 Ga0439448_0030690 3300042005 Bacteria 1706
201 Ga0439455_0207083 3300042012 Bacteria 569
202 Ga0439462_0061498 3300042015 Bacteria 1017
203 Ga0439446_0006058 3300042156 Bacteria 3136
204 Ga0439434_0016063 3300042435 Bacteria 2235
205 Ga0439459_0018279 3300042438 Bacteria 1316
206 Ga0466968_0241973 3300044735 Bacteria 855
207 Ga0495617_211362 3300046452 Bacteria 604
208 Ga0495592_0018388 3300046454 Bacteria 5315
209 Ga0495603_0259647 3300046455 Bacteria 1000
210 Ga0495641_0289479 3300046461 Bacteria 738
211 Ga0495651_0003822 3300046462 Bacteria 11518
212 Ga0495653_0021332 3300046463 Bacteria 5247
213 Ga0495664_0105115 3300046477 Bacteria 1702
214 Ga0495584_0073647 3300046491 Bacteria 1716
215 Ga0495607_0151135 3300046501 Bacteria 1188
216 Ga0495608_0018079 3300046511 Bacteria 4870
217 Ga0495618_0013133 3300046514 Bacteria 5037
218 Ga0495628_0042686 3300046516 Bacteria 3616
219 Ga0495631_0150792 3300046518 Bacteria 998
220 Ga0495663_0064055 3300046525 Bacteria 1160
221 Ga0495642_0043394 3300046528 Bacteria 1834
222 Ga0495642_0086959 3300046528 Bacteria 1321
223 Ga0495652_0030306 3300046529 Bacteria 4745
224 Ga0495640_0402335 3300046533 Bacteria 840
225 Ga0495587_0281662 3300046536 Bacteria 931
226 Ga0495609_0066989 3300046538 Bacteria 1582
227 Ga0495645_0267778 3300046543 Bacteria 1128
228 Ga0495645_0318837 3300046543 Bacteria 1010
229 Ga0495667_0016006 3300046559 Bacteria 5068
230 Ga0495656_0110657 3300046615 Bacteria 1284
231 Ga0495634_0144446 3300046642 Bacteria 1508
232 Ga0495611_0419327 3300046648 Bacteria 611
233 Ga0495635_0014368 3300046663 Bacteria 5538
234 Ga0495659_0032229 3300046664 Bacteria 1833
235 Ga0495661_0171957 3300046665 Bacteria 1155
236 Ga0495588_0013583 3300046674 Bacteria 3883
237 Ga0495657_0019901 3300046675 Bacteria 4835
238 Ga0495599_0119800 3300046678 Bacteria 1636
239 Ga0495623_0693723 3300046679 Bacteria 522
240 Ga0495646_0217559 3300046680 Bacteria 1034
241 Ga0495624_0342127 3300046690 Bacteria 900
242 Ga0495589_0087819 3300046794 Bacteria 1510
243 Ga0495589_0088604 3300046794 Bacteria 1503
244 Ga0495600_0000265 3300046809 Bacteria 28729
245 Ga0495600_0128023 3300046809 Bacteria 1651
246 Ga0495604_0013385 3300047317 Bacteria 6533
247 Ga0495674_0014052 3300047319 Bacteria 7505
248 Ga0495680_0002832 3300047322 Bacteria 17448
249 Ga0495675_0014005 3300047444 Bacteria 5070
250 Ga0495684_0017030 3300047471 Bacteria 5598
251 Ga0495684_0660087 3300047471 Bacteria 698
252 Ga0495593_0463084 3300047673 Bacteria 635
253 Ga0495602_0032752 3300048088 Bacteria 4889
254 Ga0496101_0073747 3300048904 Bacteria 2508
255 Ga0496102_0148155 3300048905 Bacteria 2204
256 Ga0496102_1337140 3300048905 Bacteria 636
257 Ga0496104_0010415 3300048907 Bacteria 8305
258 Ga0496105_0437081 3300048908 Bacteria 1034
259 Ga0496108_0053848 3300048911 Bacteria 3376
260 Ga0496108_0068126 3300048911 Bacteria 3002
261 Ga0496109_0001659 3300048912 Bacteria 18560
262 Ga0496109_0059952 3300048912 Bacteria 3477
263 Ga0496109_0065517 3300048912 Bacteria 3326
264 Ga0496109_1240088 3300048912 Bacteria 682
265 Ga0496110_1388750 3300048913 Bacteria 612
266 Ga0496111_0051319 3300048914 Bacteria 2977
267 Ga0496112_0009961 3300048915 Bacteria 8598
268 Ga0496112_0539150 3300048915 Bacteria 1101
269 Ga0496114_0705067 3300048917 Bacteria 885
270 Ga0496125_0463332 3300048928 Bacteria 722
271 Ga0501031_0007918 3300049568 Bacteria 6916
272 Ga0501032_0008912 3300049569 Bacteria 7294
273 Ga0501033_0036348 3300049570 Bacteria 3691
274 Ga0501033_0098336 3300049570 Bacteria 2137
275 Ga0501036_0000816 3300049572 Bacteria 23155
276 Ga0501036_0136008 3300049572 Bacteria 2074
277 Ga0501037_0028965 3300049573 Bacteria 4090
278 Ga0501038_0001159 3300049574 Bacteria 23908
279 Ga0501039_0009410 3300049575 Bacteria 7448
280 Ga0501039_0036426 3300049575 Bacteria 3797
281 Ga0501040_0000873 3300049576 Bacteria 18913
282 Ga0501040_0004560 3300049576 Bacteria 8993
283 Ga0501040_0284186 3300049576 Bacteria 1182
284 Ga0501041_0010171 3300049577 Bacteria 5544
285 Ga0501041_0070628 3300049577 Bacteria 2143
286 Ga0501041_0255018 3300049577 Bacteria 1103
287 Ga0501042_0000554 3300049578 Bacteria 19709
288 Ga0501042_0051689 3300049578 Bacteria 2931
289 Ga0501042_0162210 3300049578 Bacteria 1613
290 Ga0501043_0129309 3300049579 Bacteria 1979
291 Ga0501046_0001284 3300049580 Bacteria 24310
292 Ga0501047_1244068 3300049581 Bacteria 558
293 Ga0501048_0006773 3300049582 Bacteria 8704
294 Ga0501048_0095229 3300049582 Bacteria 2099
295 Ga0501048_0444692 3300049582 Bacteria 928
296 Ga0501067_0131917 3300049583 Bacteria 1390
297 Ga0501067_0230099 3300049583 Bacteria 1032
298 Ga0501067_0612852 3300049583 Bacteria 611
299 Ga0501068_0064656 3300049584 Bacteria 2227
300 Ga0501068_0131115 3300049584 Bacteria 1567
301 Ga0501069_0005797 3300049585 Bacteria 6433
302 Ga0501069_0144801 3300049585 Bacteria 1364
303 Ga0501070_0001921 3300049586 Bacteria 18339
304 Ga0501070_0485676 3300049586 Bacteria 993
305 Ga0501071_0000370 3300049587 Bacteria 22025
306 Ga0501071_0025912 3300049587 Bacteria 4111
307 Ga0501071_0088794 3300049587 Bacteria 2268
308 Ga0501071_0630949 3300049587 Bacteria 824
309 Ga0501072_0006735 3300049588 Bacteria 8734
310 Ga0501072_0016025 3300049588 Bacteria 5747
311 Ga0501073_0024897 3300049589 Bacteria 4295
312 Ga0501074_0015689 3300049590 Bacteria 5507
313 Ga0501074_0931482 3300049590 Bacteria 611
314 Ga0501075_0001375 3300049591 Bacteria 15825
315 Ga0501075_0011861 3300049591 Bacteria 6182
316 Ga0501076_0000297 3300049592 Bacteria 30966
317 Ga0501076_0057389 3300049592 Bacteria 3091
318 Ga0501076_0867570 3300049592 Bacteria 744
319 Ga0501077_0000844 3300049593 Bacteria 18565
320 Ga0501077_0019315 3300049593 Bacteria 4310
321 Ga0501079_0006614 3300049741 Bacteria 8725
322 Ga0501079_0027767 3300049741 Bacteria 4341
323 Ga0501079_0043610 3300049741 Bacteria 3462
324 Ga0501080_0000410 3300049742 Bacteria 32872
325 Ga0501080_0037792 3300049742 Bacteria 4508
326 Ga0501080_0582562 3300049742 Bacteria 994
327 Ga0501081_0002720 3300049743 Bacteria 11189
328 Ga0501081_0021613 3300049743 Bacteria 4294
329 Ga0501035_0006528 3300049822 Bacteria 10949
330 Ga0501035_0283268 3300049822 Bacteria 1400
331 Ga0501035_0657026 3300049822 Bacteria 849
332 Ga0501044_0098765 3300049823 Bacteria 2939
333 Ga0501044_0240095 3300049823 Bacteria 1756
334 Ga0501044_0376048 3300049823 Bacteria 1336
335 Ga0501044_1250859 3300049823 Bacteria 609
336 Ga0501045_0000894 3300049824 Bacteria 19389
337 Ga0501045_0082664 3300049824 Bacteria 2368
338 nmdc:mga03n38_479887_c1 3300050490 Bacteria 695
339 nmdc:mga03n38_63547_c1 3300050490 Bacteria 1687
340 nmdc:mga00v17_421754_c1 3300050491 Bacteria 867
341 nmdc:mga00v17_599797_c1 3300050491 Bacteria 710
342 nmdc:mga0yw44_31337_c1 3300050492 Bacteria 3091
343 nmdc:mga0yw44_96403_c1 3300050492 Bacteria 1878
344 nmdc:mga06z11_130021_c1 3300050494 Bacteria 1413
345 nmdc:mga06z11_511183_c1 3300050494 Bacteria 728
346 nmdc:mga05p37_2105834_c1 3300050507 Bacteria 528
347 nmdc:mga05p37_244438_c1 3300050507 Bacteria 2156
348 nmdc:mga09592_1160785_c1 3300050508 Bacteria 640
349 nmdc:mga06r32_1020444_c1 3300050510 Bacteria 779
350 nmdc:mga08y16_163784_c1 3300050511 Bacteria 2310
351 nmdc:mga08y16_38651_c1 3300050511 Bacteria 5009
352 nmdc:mga0n895_3880_c1 3300050512 Bacteria 12144
353 nmdc:mga0rr50_1720048_c1 3300050513 Bacteria 528
354 nmdc:mga0rr50_184362_c1 3300050513 Bacteria 1707
355 nmdc:mga0rr50_669945_c1 3300050513 Bacteria 885
356 nmdc:mga0a205_412511_c1 3300050515 Bacteria 1213
357 nmdc:mga0a205_4706_c1 3300050515 Bacteria 12257
358 nmdc:mga0sz30_396695_c1 3300050516 Bacteria 618
359 Ga0495595_0109515 3300053084 Bacteria 1338
360 Ga0495619_0367796 3300053085 Bacteria 994
361 Ga0495619_0744580 3300053085 Unclassified 665
362 Ga0500568_0155568 3300053139 Bacteria 845
363 Ga0501084_0000696 3300054114 Bacteria 25782
364 Ga0501084_0016597 3300054114 Bacteria 6114
365 Ga0501084_0638192 3300054114 Bacteria 899
366 Ga0501082_0001961 3300060353 Bacteria 18119
367 Ga0501082_0024223 3300060353 Bacteria 5233
368 Ga0501082_0904210 3300060353 Bacteria 772
369 Ga0530510_0000568 3300061734 Bacteria 23790
370 Ga0530510_0031588 3300061734 Bacteria 3808
371 2644513338 2643221692 Bacteria 7282860
372 2795781953 2795385470 Bacteria 8317180
373 2866556176 2866552031 Bacteria 5824618
374 2891330653 2891326441 Bacteria 6439512
375 2891399064 2891395885 Bacteria 9251614
376 8055070714 8055066027 Bacteria 9479577
377 Ga0111539_10089648
378 JGI25406J46586_10003005
379 JGI25407J50210_10000106
380 JGI25407J50210_10034763
381 Ga0070683_100370642
382 Ga0070682_100172108
383 Ga0068868_100894190
384 Ga0070692_10496462
385 Ga0070675_100081432
386 Ga0070675_100144652
387 Ga0070671_100167224
388 Ga0070674_100014165
389 Ga0070674_100209307
390 Ga0070688_100125340
391 Ga0070709_11088577
392 Ga0070714_101185251
393 Ga0070713_100158489
394 Ga0070711_101548601
395 Ga0070700_101572428
396 Ga0070694_100335664
397 Ga0070708_100026386
398 Ga0070708_101418617
399 Ga0070678_100047838
400 Ga0070662_100397619
401 Ga0068867_100290510
402 Ga0070685_10190698
403 Ga0070685_10220389
404 Ga0070707_100243487
405 Ga0070707_100272843
406 Ga0070698_100156245
407 Ga0070698_100268193
408 Ga0070698_100579087
409 Ga0070698_100611545
410 Ga0070698_100664512
411 Ga0070699_100000073
412 Ga0070684_100222808
413 Ga0070697_100000002
414 Ga0070697_100001656
415 Ga0070672_100152947
416 Ga0070686_100720937
417 Ga0070696_100559630
418 Ga0070665_100231255
419 Ga0070664_100251129
420 Ga0070702_100050014
421 Ga0070702_100081511
422 Ga0068852_100659961
423 Ga0068859_100245524
424 Ga0068864_100388304
425 Ga0068866_10615368
426 Ga0068861_100474659
427 Ga0068870_10134506
428 Ga0081455_10009934
429 Ga0081455_10014550
430 Ga0081455_10070495
431 Ga0081538_10004088
432 Ga0081538_10008171
433 Ga0081538_10221246
434 Ga0081539_10002830
435 Ga0081539_10029700
436 Ga0070717_10000677
437 Ga0070717_10049866
438 Ga0075363_100366285
439 Ga0075364_10407401
440 Ga0070712_100392208
441 Ga0070712_101369171
442 Ga0075367_10076754
443 Ga0068871_100546408
444 Ga0075428_100003635
445 Ga0075434_100066173
446 Ga0068865_100666684
447 Ga0097620_100245533
448 Ga0097620_100768016
449 Ga0075435_100504548
450 Ga0075435_100848526
451 Ga0111539_10054987
452 Ga0105245_11636231
453 Ga0114129_10002806
454 Ga0114129_10905226
455 Ga0105242_10100634
456 Ga0105242_10192117
457 Ga0105242_10927307
458 Ga0105249_10055057
459 Ga0105239_10162700
460 Ga0157378_10111965
461 Ga0163162_10456825
462 Ga0163162_10624750
463 Ga0157375_10274976
464 Ga0157375_10276868
465 Ga0163163_10927253
466 Ga0157380_10625219
467 Ga0157377_10007906
468 Ga0157377_10069019
469 Ga0157379_10237551
470 Ga0206356_11854678
471 Ga0207653_10147664
472 Ga0207692_10349939
473 Ga0207688_10004008
474 Ga0207688_10172228
475 Ga0207645_10230221
476 Ga0207643_10034181
477 Ga0207643_10139303
478 Ga0207684_10000003
479 Ga0207693_10367798
480 Ga0207662_10220395
481 Ga0207646_10000552
482 Ga0207646_11221377
483 Ga0207650_10119058
484 Ga0207650_11109632
485 Ga0207659_10173405
486 Ga0207659_10258575
487 Ga0207659_10281299
488 Ga0207687_11414004
489 Ga0207700_10238261
490 Ga0207664_10228757
491 Ga0207664_11616620
492 Ga0207706_10815411
493 Ga0207706_11077376
494 Ga0207686_10072966
495 Ga0207686_10168429
496 Ga0207686_10320401
497 Ga0207709_10890170
498 Ga0207669_10503638
499 Ga0207704_10096347
500 Ga0207665_11664066
501 Ga0207691_10323992
502 Ga0207661_10174945
503 Ga0207679_10162482
504 Ga0207712_10020449
505 Ga0207668_10075381
506 Ga0207668_10425552
507 Ga0207640_10134936
508 Ga0207677_10321091
509 Ga0207708_10004461
510 Ga0207708_11352763
511 Ga0207648_10487746
512 Ga0207648_10829535
513 Ga0207676_10052508
514 Ga0207676_10632867
515 Ga0207674_10704432
516 Ga0207675_100569978
517 Ga0207683_10317640
518 Ga0207698_10387560
519 Ga0207698_10650688
520 Ga0207428_10180081
521 Ga0207428_10482044
522 Ga0268266_10316396
523 Ga0268266_10382003
524 Ga0268265_11561044
525 Ga0268264_12590521
526 Ga0265320_10002754
527 Ga0307509_10069994
528 Ga0307408_100003406
529 Ga0307408_101680334
530 Ga0307408_101955561
531 Ga0265313_10140274
532 Ga0307405_10002371
533 Ga0307405_10035400
534 Ga0307413_10016593
535 Ga0307413_10016811
536 Ga0307413_10172277
537 Ga0307410_10012550
538 Ga0307410_10621486
539 Ga0307406_10002576
540 Ga0307406_10526399
541 Ga0307407_10001712
542 Ga0307412_10037245
543 Ga0307412_10164470
544 Ga0307409_100115460
545 Ga0307416_100010010
546 Ga0307416_100043337
547 Ga0307416_100099055
548 Ga0307414_10038991
549 Ga0307411_10008001
550 Ga0307411_10025672
551 Ga0307415_100012173
552 Ga0307415_100804597
553 Ga0373932_0133483
554 Ga0373939_0043517
555 Ga0373943_0535912
556 Ga0373955_0007985
557 Ga0373937_0100829
558 Ga0373937_0597257
559 Ga0395899_0368516
560 Ga0395899_0640359
561 Ga0395898_0266074
562 Ga0395905_0202239
563 Ga0395905_1521028
564 Ga0395905_1906021
565 Ga0436364_0081572
566 Ga0436364_1465113
567 Ga0395901_0015351
568 Ga0395901_0313858
569 Ga0436361_0437541
570 Ga0439439_0021038
571 Ga0451835_0518516
572 Ga0439431_0002698
573 Ga0439433_0005959
574 Ga0439442_001472
575 Ga0439445_0057863
576 Ga0439448_0030690
577 Ga0439455_0207083
578 Ga0439462_0061498
579 Ga0439446_0006058
580 Ga0439434_0016063
581 Ga0439459_0018279
582 Ga0466968_0241973
583 Ga0495617_211362
584 Ga0495592_0018388
585 Ga0495603_0259647
586 Ga0495641_0289479
587 Ga0495651_0003822
588 Ga0495653_0021332
589 Ga0495664_0105115
590 Ga0495584_0073647
591 Ga0495607_0151135
592 Ga0495608_0018079
593 Ga0495618_0013133
594 Ga0495628_0042686
595 Ga0495631_0150792
596 Ga0495663_0064055
597 Ga0495642_0043394
598 Ga0495642_0086959
599 Ga0495652_0030306
600 Ga0495640_0402335
601 Ga0495587_0281662
602 Ga0495609_0066989
603 Ga0495645_0267778
604 Ga0495645_0318837
605 Ga0495667_0016006
606 Ga0495656_0110657
607 Ga0495634_0144446
608 Ga0495611_0419327
609 Ga0495635_0014368
610 Ga0495659_0032229
611 Ga0495661_0171957
612 Ga0495588_0013583
613 Ga0495657_0019901
614 Ga0495599_0119800
615 Ga0495623_0693723
616 Ga0495646_0217559
617 Ga0495624_0342127
618 Ga0495589_0087819
619 Ga0495589_0088604
620 Ga0495600_0000265
621 Ga0495600_0128023
622 Ga0495604_0013385
623 Ga0495674_0014052
624 Ga0495680_0002832
625 Ga0495675_0014005
626 Ga0495684_0017030
627 Ga0495684_0660087
628 Ga0495593_0463084
629 Ga0495602_0032752
630 Ga0496101_0073747
631 Ga0496102_0148155
632 Ga0496102_1337140
633 Ga0496104_0010415
634 Ga0496105_0437081
635 Ga0496108_0053848
636 Ga0496108_0068126
637 Ga0496109_0001659
638 Ga0496109_0059952
639 Ga0496109_0065517
640 Ga0496109_1240088
641 Ga0496110_1388750
642 Ga0496111_0051319
643 Ga0496112_0009961
644 Ga0496112_0539150
645 Ga0496114_0705067
646 Ga0496125_0463332
647 Ga0501031_0007918
648 Ga0501032_0008912
649 Ga0501033_0036348
650 Ga0501033_0098336
651 Ga0501036_0000816
652 Ga0501036_0136008
653 Ga0501037_0028965
654 Ga0501038_0001159
655 Ga0501039_0009410
656 Ga0501039_0036426
657 Ga0501040_0000873
658 Ga0501040_0004560
659 Ga0501040_0284186
660 Ga0501041_0010171
661 Ga0501041_0070628
662 Ga0501041_0255018
663 Ga0501042_0000554
664 Ga0501042_0051689
665 Ga0501042_0162210
666 Ga0501043_0129309
667 Ga0501046_0001284
668 Ga0501047_1244068
669 Ga0501048_0006773
670 Ga0501048_0095229
671 Ga0501048_0444692
672 Ga0501067_0131917
673 Ga0501067_0230099
674 Ga0501067_0612852
675 Ga0501068_0064656
676 Ga0501068_0131115
677 Ga0501069_0005797
678 Ga0501069_0144801
679 Ga0501070_0001921
680 Ga0501070_0485676
681 Ga0501071_0000370
682 Ga0501071_0025912
683 Ga0501071_0088794
684 Ga0501071_0630949
685 Ga0501072_0006735
686 Ga0501072_0016025
687 Ga0501073_0024897
688 Ga0501074_0015689
689 Ga0501074_0931482
690 Ga0501075_0001375
691 Ga0501075_0011861
692 Ga0501076_0000297
693 Ga0501076_0057389
694 Ga0501076_0867570
695 Ga0501077_0000844
696 Ga0501077_0019315
697 Ga0501079_0006614
698 Ga0501079_0027767
699 Ga0501079_0043610
700 Ga0501080_0000410
701 Ga0501080_0037792
702 Ga0501080_0582562
703 Ga0501081_0002720
704 Ga0501081_0021613
705 Ga0501035_0006528
706 Ga0501035_0283268
707 Ga0501035_0657026
708 Ga0501044_0098765
709 Ga0501044_0240095
710 Ga0501044_0376048
711 Ga0501044_1250859
712 Ga0501045_0000894
713 Ga0501045_0082664
714 nmdc:mga03n38_479887_c1
715 nmdc:mga03n38_63547_c1
716 nmdc:mga00v17_421754_c1
717 nmdc:mga00v17_599797_c1
718 nmdc:mga0yw44_31337_c1
719 nmdc:mga0yw44_96403_c1
720 nmdc:mga06z11_130021_c1
721 nmdc:mga06z11_511183_c1
722 nmdc:mga05p37_2105834_c1
723 nmdc:mga05p37_244438_c1
724 nmdc:mga09592_1160785_c1
725 nmdc:mga06r32_1020444_c1
726 nmdc:mga08y16_163784_c1
727 nmdc:mga08y16_38651_c1
728 nmdc:mga0n895_3880_c1
729 nmdc:mga0rr50_1720048_c1
730 nmdc:mga0rr50_184362_c1
731 nmdc:mga0rr50_669945_c1
732 nmdc:mga0a205_412511_c1
733 nmdc:mga0a205_4706_c1
734 nmdc:mga0sz30_396695_c1
735 Ga0495595_0109515
736 Ga0495619_0367796
737 Ga0495619_0744580
738 Ga0500568_0155568
739 Ga0501084_0000696
740 Ga0501084_0016597
741 Ga0501084_0638192
742 Ga0501082_0001961
743 Ga0501082_0024223
744 Ga0501082_0904210
745 Ga0530510_0000568
746 Ga0530510_0031588
747 2644513338
748 2795781953
749 2866556176
750 2891330653
751 2891399064
752 8055070714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

18

139

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t38-assembly1.cif.gz_B corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1' 0.9517 2 131
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.9289 2 127
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.9251 2 127
1ljl-assembly1.cif.gz_A wild type pi258 s. aureus arsenate reductase 0.9226 3 127
2cd7-assembly1.cif.gz_A staphylococcus aureus pi258 arsenate reductase (arsc) h62q mutant 0.9224 2 127
ID Description Score Start End Superfamily
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9974 4 131 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9599 4 131 3.40.50.2300
3t38B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9583 4 131 3.40.50.2300
3t38B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9117 4 131 3.40.50.2300
4egsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.898 4 131 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7W3W4I0-F1-model_v4 Arsenate reductase ArsC 1.003 4 131 GO:0046685
AF-A0A538H6P5-F1-model_v4 Phosphatase 1.002 1 132 GO:0015267
GO:0016020
GO:0046685
AF-A0A2T7W0W1-F1-model_v4 Heat-shock protein HtpX 1.001 4 132 GO:0046685
AF-A0A249KCE1-F1-model_v4 deleted 0.9996 4 131
AF-A0A6J7P3I6-F1-model_v4 Unannotated protein 0.9996 21 131 GO:0046685

Map