F427248

General Info

Members Datasets Scaffolds Average Seq Length
376 194 752 51

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10197830|Ga0065707_101978302
Length 53
Sequence MSSRGGLTREVWAFMRARKKFWLAPVIVVMLLVGALLVFAQGSVLAPFIYTIF

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
150 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
180 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
181 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 99.2
Stem 0
Stem Tuber 0
Unclassified 22.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10197830 3300005295 Bacteria 1319
2 JGI25405J52794_10137466 3300003911 Unclassified 555
3 Ga0070676_10081399 3300005328 Bacteria 1965
4 Ga0070670_100021436 3300005331 Bacteria 5559
5 Ga0070677_10490074 3300005333 Bacteria 664
6 Ga0070677_10696057 3300005333 Unclassified 572
7 Ga0068869_101327885 3300005334 Unclassified 635
8 Ga0070666_11171101 3300005335 Bacteria 572
9 Ga0068868_100206934 3300005338 Bacteria 1638
10 Ga0068868_101134593 3300005338 Bacteria 720
11 Ga0070689_100207798 3300005340 Bacteria 1601
12 Ga0070668_100009569 3300005347 Bacteria 7191
13 Ga0070668_100077645 3300005347 Bacteria 2596
14 Ga0070668_100502037 3300005347 Bacteria 1050
15 Ga0070669_100001612 3300005353 Bacteria 16307
16 Ga0070669_100091429 3300005353 Bacteria 2282
17 Ga0070669_100139009 3300005353 Bacteria 1871
18 Ga0070669_100354454 3300005353 Bacteria 1192
19 Ga0070669_101087586 3300005353 Unclassified 688
20 Ga0070675_100051927 3300005354 Bacteria 3370
21 Ga0070675_100434651 3300005354 Bacteria 1175
22 Ga0070675_100729810 3300005354 Bacteria 903
23 Ga0070671_100030174 3300005355 Bacteria 4474
24 Ga0070674_102124873 3300005356 Unclassified 512
25 Ga0070673_100054524 3300005364 Bacteria 3145
26 Ga0070673_101008985 3300005364 Bacteria 775
27 Ga0070673_101826231 3300005364 Archaea 576
28 Ga0070688_100031111 3300005365 Bacteria 3208
29 Ga0070688_100567876 3300005365 Bacteria 864
30 Ga0070667_100071440 3300005367 Bacteria 2956
31 Ga0070703_10131204 3300005406 Bacteria 920
32 Ga0070709_10002564 3300005434 Bacteria 9827
33 Ga0070709_10643068 3300005434 Bacteria 820
34 Ga0070709_11511409 3300005434 Unclassified 545
35 Ga0070714_101471544 3300005435 Bacteria 665
36 Ga0070710_10288729 3300005437 Unclassified 1067
37 Ga0070710_10993385 3300005437 Bacteria 611
38 Ga0070711_100000042 3300005439 Bacteria 84000
39 Ga0070711_100871963 3300005439 Unclassified 767
40 Ga0070711_101311731 3300005439 Bacteria 628
41 Ga0070705_101062315 3300005440 Unclassified 660
42 Ga0070694_100004121 3300005444 Bacteria 8727
43 Ga0070694_100404615 3300005444 Bacteria 1069
44 Ga0070694_101849247 3300005444 Unclassified 515
45 Ga0070708_100007254 3300005445 Bacteria 8861
46 Ga0070678_100040735 3300005456 Bacteria 3288
47 Ga0068867_100090359 3300005459 Bacteria 2323
48 Ga0068867_100253381 3300005459 Bacteria 1432
49 Ga0068867_100555257 3300005459 Bacteria 995
50 Ga0068867_102282676 3300005459 Unclassified 514
51 Ga0070706_100522919 3300005467 Bacteria 1104
52 Ga0070706_100881927 3300005467 Unclassified 827
53 Ga0070707_100248628 3300005468 Bacteria 1730
54 Ga0070707_102020509 3300005468 Bacteria 544
55 Ga0070699_100445900 3300005518 Bacteria 1173
56 Ga0070699_100685216 3300005518 Bacteria 936
57 Ga0070697_100094055 3300005536 Bacteria 2483
58 Ga0070697_100341479 3300005536 Bacteria 1292
59 Ga0070697_100380507 3300005536 Bacteria 1222
60 Ga0070672_100058339 3300005543 Bacteria 3033
61 Ga0070672_100176445 3300005543 Bacteria 1779
62 Ga0070672_100363032 3300005543 Bacteria 1236
63 Ga0070672_100459676 3300005543 Bacteria 1097
64 Ga0070695_100029320 3300005545 Bacteria 3418
65 Ga0070695_100228857 3300005545 Bacteria 1343
66 Ga0070695_100244467 3300005545 Bacteria 1303
67 Ga0070695_100270920 3300005545 Bacteria 1244
68 Ga0070695_100344274 3300005545 Bacteria 1115
69 Ga0070696_100036794 3300005546 Bacteria 3375
70 Ga0070693_101677118 3300005547 Unclassified 501
71 Ga0070665_101365664 3300005548 Bacteria 718
72 Ga0070704_100452943 3300005549 Bacteria 1105
73 Ga0070664_100954050 3300005564 Bacteria 805
74 Ga0070664_102365081 3300005564 Unclassified 504
75 Ga0068857_100003921 3300005577 Bacteria 12524
76 Ga0068852_101249231 3300005616 Bacteria 764
77 Ga0068859_100000034 3300005617 Bacteria 171376
78 Ga0068859_100046851 3300005617 Bacteria 4342
79 Ga0068859_100996090 3300005617 Bacteria 920
80 Ga0068859_101195886 3300005617 Bacteria 837
81 Ga0068859_102530815 3300005617 Unclassified 565
82 Ga0068859_102968446 3300005617 Unclassified 519
83 Ga0068864_100324557 3300005618 Bacteria 1446
84 Ga0068864_100390926 3300005618 Bacteria 1320
85 Ga0068864_100414137 3300005618 Bacteria 1283
86 Ga0068864_100652202 3300005618 Bacteria 1025
87 Ga0068866_10128162 3300005718 Bacteria 1439
88 Ga0068866_11149045 3300005718 Unclassified 558
89 Ga0068861_100131849 3300005719 Bacteria 2029
90 Ga0068861_101200237 3300005719 Bacteria 734
91 Ga0068861_101613705 3300005719 Unclassified 639
92 Ga0068870_10040895 3300005840 Bacteria 2406
93 Ga0068863_100073487 3300005841 Bacteria 3235
94 Ga0068858_100023593 3300005842 Bacteria 5732
95 Ga0068860_100184650 3300005843 Unclassified 2016
96 Ga0068860_100285667 3300005843 Bacteria 1613
97 Ga0068860_100349289 3300005843 Bacteria 1455
98 Ga0068860_101373874 3300005843 Unclassified 727
99 Ga0068862_100007489 3300005844 Bacteria 9050
100 Ga0068862_100010817 3300005844 Bacteria 7536
101 Ga0081455_10021617 3300005937 Bacteria 6029
102 Ga0081455_10125263 3300005937 Bacteria 2018
103 Ga0075432_10545469 3300006058 Bacteria 523
104 Ga0070716_100236996 3300006173 Bacteria 1235
105 Ga0070712_101586444 3300006175 Bacteria 572
106 Ga0097621_100863355 3300006237 Unclassified 841
107 Ga0068871_100414960 3300006358 Bacteria 1201
108 Ga0068871_102345930 3300006358 Unclassified 509
109 Ga0075428_100006947 3300006844 Bacteria 12565
110 Ga0075428_100040994 3300006844 Bacteria 5092
111 Ga0075428_100056936 3300006844 Bacteria 4280
112 Ga0075428_101125769 3300006844 Unclassified 829
113 Ga0075428_101376392 3300006844 Unclassified 741
114 Ga0075428_102003776 3300006844 Bacteria 600
115 Ga0075430_100067366 3300006846 Bacteria 3006
116 Ga0075430_100337091 3300006846 Bacteria 1246
117 Ga0075430_100341388 3300006846 Bacteria 1237
118 Ga0075430_100390534 3300006846 Unclassified 1148
119 Ga0075430_100537530 3300006846 Bacteria 964
120 Ga0075430_101562926 3300006846 Bacteria 542
121 Ga0075431_100011215 3300006847 Bacteria 9025
122 Ga0075431_100031800 3300006847 Bacteria 5436
123 Ga0075431_100382418 3300006847 Bacteria 1411
124 Ga0075431_100401790 3300006847 Bacteria 1371
125 Ga0075431_100528993 3300006847 Bacteria 1168
126 Ga0075433_10000392 3300006852 Bacteria 27791
127 Ga0075433_10070868 3300006852 Bacteria 3064
128 Ga0075433_10102947 3300006852 Bacteria 2529
129 Ga0075433_11016637 3300006852 Bacteria 722
130 Ga0075434_100001577 3300006871 Bacteria 19314
131 Ga0075434_100081526 3300006871 Bacteria 3233
132 Ga0075434_100202150 3300006871 Bacteria 2007
133 Ga0075434_100646020 3300006871 Bacteria 1076
134 Ga0075434_100936023 3300006871 Bacteria 881
135 Ga0075429_100073367 3300006880 Bacteria 2981
136 Ga0075429_100144154 3300006880 Bacteria 2085
137 Ga0075429_100167968 3300006880 Bacteria 1922
138 Ga0075429_100788425 3300006880 Unclassified 832
139 Ga0068865_100982372 3300006881 Unclassified 738
140 Ga0068865_101153522 3300006881 Bacteria 684
141 Ga0075436_100030687 3300006914 Bacteria 3699
142 Ga0075436_100035097 3300006914 Bacteria 3459
143 Ga0097620_100000034 3300006931 Bacteria 171376
144 Ga0097620_100046852 3300006931 Bacteria 4342
145 Ga0097620_100996126 3300006931 Bacteria 920
146 Ga0097620_101064591 3300006931 Unclassified 889
147 Ga0097620_101195695 3300006931 Bacteria 837
148 Ga0097620_102530894 3300006931 Unclassified 565
149 Ga0097620_102967572 3300006931 Unclassified 519
150 Ga0075435_100253186 3300007076 Bacteria 1499
151 Ga0099794_10075152 3300007265 Unclassified 1660
152 Ga0111539_10715055 3300009094 Bacteria 1166
153 Ga0111539_10918749 3300009094 Unclassified 1018
154 Ga0111539_12448485 3300009094 Unclassified 605
155 Ga0111539_13417385 3300009094 Bacteria 510
156 Ga0105245_10065057 3300009098 Bacteria 3297
157 Ga0105245_10383882 3300009098 Bacteria 1399
158 Ga0105247_11397536 3300009101 Bacteria 566
159 Ga0114129_10000967 3300009147 Bacteria 37553
160 Ga0114129_10546234 3300009147 Bacteria 1507
161 Ga0114129_11310759 3300009147 Bacteria 897
162 Ga0114129_11408248 3300009147 Unclassified 860
163 Ga0105242_10055981 3300009176 Bacteria 3226
164 Ga0105242_10091369 3300009176 Bacteria 2563
165 Ga0105248_10106803 3300009177 Bacteria 3156
166 Ga0105248_10356663 3300009177 Unclassified 1646
167 Ga0105248_10835314 3300009177 Bacteria 1040
168 Ga0105248_10846384 3300009177 Bacteria 1032
169 Ga0105237_12414882 3300009545 Unclassified 536
170 Ga0105249_10543959 3300009553 Bacteria 1211
171 Ga0105249_12315934 3300009553 Bacteria 610
172 Ga0105249_12790854 3300009553 Bacteria 560
173 Ga0157378_10390793 3300013297 Bacteria 1368
174 Ga0163162_10049111 3300013306 Bacteria 4229
175 Ga0163162_10108898 3300013306 Bacteria 2867
176 Ga0163162_11511710 3300013306 Bacteria 765
177 Ga0157375_10007462 3300013308 Bacteria 9569
178 Ga0157375_10225842 3300013308 Bacteria 2031
179 Ga0157375_10686951 3300013308 Bacteria 1178
180 Ga0163163_11476759 3300014325 Bacteria 741
181 Ga0157377_10292523 3300014745 Bacteria 1072
182 Ga0157377_11146963 3300014745 Bacteria 598
183 Ga0157379_12019526 3300014968 Unclassified 570
184 Ga0157376_10009510 3300014969 Bacteria 7064
185 Ga0207653_10402873 3300025885 Bacteria 536
186 Ga0207682_10383132 3300025893 Bacteria 664
187 Ga0207682_10518381 3300025893 Bacteria 564
188 Ga0207692_10477870 3300025898 Unclassified 788
189 Ga0207642_10066253 3300025899 Bacteria 1700
190 Ga0207680_10009017 3300025903 Bacteria 4927
191 Ga0207685_10160532 3300025905 Bacteria 1026
192 Ga0207699_10006586 3300025906 Bacteria 5638
193 Ga0207643_10004471 3300025908 Bacteria 7516
194 Ga0207693_10042355 3300025915 Bacteria 3584
195 Ga0207663_10002984 3300025916 Bacteria 8186
196 Ga0207663_10443183 3300025916 Unclassified 1000
197 Ga0207660_10448145 3300025917 Bacteria 1044
198 Ga0207646_10176011 3300025922 Bacteria 1932
199 Ga0207646_10362704 3300025922 Bacteria 1309
200 Ga0207646_11679486 3300025922 Bacteria 546
201 Ga0207681_10002458 3300025923 Bacteria 11751
202 Ga0207681_10365674 3300025923 Bacteria 1158
203 Ga0207681_10524190 3300025923 Bacteria 973
204 Ga0207650_10084840 3300025925 Bacteria 2408
205 Ga0207659_10471657 3300025926 Bacteria 1059
206 Ga0207687_10452901 3300025927 Bacteria 1065
207 Ga0207644_10050283 3300025931 Bacteria 2987
208 Ga0207706_10156181 3300025933 Bacteria 2006
209 Ga0207686_10092323 3300025934 Bacteria 2001
210 Ga0207686_10136251 3300025934 Bacteria 1691
211 Ga0207709_10116669 3300025935 Bacteria 1795
212 Ga0207670_10603119 3300025936 Bacteria 902
213 Ga0207670_11310199 3300025936 Bacteria 614
214 Ga0207704_10292536 3300025938 Bacteria 1244
215 Ga0207704_10541075 3300025938 Bacteria 945
216 Ga0207704_11248514 3300025938 Unclassified 634
217 Ga0207665_10397218 3300025939 Bacteria 1049
218 Ga0207691_10058325 3300025940 Bacteria 3511
219 Ga0207691_10191128 3300025940 Bacteria 1785
220 Ga0207711_10081344 3300025941 Bacteria 2831
221 Ga0207679_11622864 3300025945 Archaea 592
222 Ga0207679_11889925 3300025945 Bacteria 545
223 Ga0207651_10930838 3300025960 Bacteria 775
224 Ga0207651_11382887 3300025960 Bacteria 633
225 Ga0207651_11429502 3300025960 Archaea 623
226 Ga0207712_10015890 3300025961 Bacteria 4864
227 Ga0207712_10521680 3300025961 Bacteria 1018
228 Ga0207712_11370283 3300025961 Bacteria 633
229 Ga0207668_10095302 3300025972 Bacteria 2196
230 Ga0207668_10109360 3300025972 Bacteria 2070
231 Ga0207668_11191325 3300025972 Unclassified 684
232 Ga0207658_10932571 3300025986 Unclassified 791
233 Ga0207677_10725950 3300026023 Bacteria 884
234 Ga0207703_10023600 3300026035 Bacteria 4835
235 Ga0207708_10129262 3300026075 Bacteria 1974
236 Ga0207708_10526386 3300026075 Bacteria 994
237 Ga0207702_11306735 3300026078 Bacteria 719
238 Ga0207641_10293105 3300026088 Bacteria 1534
239 Ga0207641_10610498 3300026088 Bacteria 1069
240 Ga0207641_11718835 3300026088 Bacteria 629
241 Ga0207648_10165730 3300026089 Bacteria 1952
242 Ga0207648_10635870 3300026089 Unclassified 985
243 Ga0207676_10670360 3300026095 Bacteria 1002
244 Ga0207676_10722940 3300026095 Bacteria 966
245 Ga0207674_10034125 3300026116 Bacteria 5321
246 Ga0207675_100369030 3300026118 Bacteria 1409
247 Ga0207675_100386714 3300026118 Bacteria 1377
248 Ga0207683_11782563 3300026121 Unclassified 565
249 Ga0209588_1268389 3300027671 Bacteria 518
250 Ga0209966_1085410 3300027695 Bacteria 703
251 Ga0207428_10203178 3300027907 Bacteria 1490
252 Ga0207428_10528143 3300027907 Bacteria 855
253 Ga0268266_11127387 3300028379 Bacteria 759
254 Ga0268266_12362527 3300028379 Unclassified 503
255 Ga0268265_10000377 3300028380 Bacteria 48094
256 Ga0268265_10036063 3300028380 Bacteria 3619
257 Ga0268264_10054989 3300028381 Bacteria 3325
258 Ga0268264_10317956 3300028381 Bacteria 1471
259 Ga0268264_11330775 3300028381 Unclassified 729
260 Ga0265325_10006622 3300031241 Bacteria 7013
261 Ga0316575_10426768 3300031665 Bacteria 570
262 Ga0316576_10347306 3300031727 Bacteria 1104
263 Ga0316576_11224446 3300031727 Unclassified 530
264 Ga0316578_10129292 3300031728 Bacteria 1519
265 Ga0307405_10204670 3300031731 Bacteria 1436
266 Ga0307405_10561873 3300031731 Bacteria 925
267 Ga0307405_11647612 3300031731 Bacteria 567
268 Ga0307413_10005437 3300031824 Bacteria 5689
269 Ga0307413_11976506 3300031824 Unclassified 525
270 Ga0307410_10017003 3300031852 Bacteria 4355
271 Ga0307410_10142458 3300031852 Unclassified 1775
272 Ga0307410_10231609 3300031852 Bacteria 1427
273 Ga0307410_10577921 3300031852 Unclassified 935
274 Ga0307406_10721754 3300031901 Bacteria 834
275 Ga0307407_10057655 3300031903 Bacteria 2254
276 Ga0307407_10269466 3300031903 Bacteria 1175
277 Ga0307407_10445030 3300031903 Bacteria 939
278 Ga0307407_10552497 3300031903 Bacteria 851
279 Ga0307412_11291067 3300031911 Unclassified 657
280 Ga0307409_100044828 3300031995 Bacteria 3334
281 Ga0307409_100096967 3300031995 Bacteria 2434
282 Ga0307409_100746374 3300031995 Unclassified 982
283 Ga0307416_100116879 3300032002 Bacteria 2366
284 Ga0307416_100957539 3300032002 Bacteria 958
285 Ga0307414_10024221 3300032004 Bacteria 3867
286 Ga0307414_10051614 3300032004 Bacteria 2856
287 Ga0307414_10224656 3300032004 Bacteria 1544
288 Ga0307414_10309051 3300032004 Unclassified 1341
289 Ga0307414_10791456 3300032004 Bacteria 864
290 Ga0307414_11616037 3300032004 Bacteria 604
291 Ga0307411_10697229 3300032005 Unclassified 884
292 Ga0307411_10816199 3300032005 Bacteria 822
293 Ga0307415_100208292 3300032126 Bacteria 1558
294 Ga0307415_100309239 3300032126 Bacteria 1313
295 Ga0307415_100665524 3300032126 Unclassified 935
296 Ga0307415_101588545 3300032126 Unclassified 628
297 Ga0316593_10422777 3300032168 Bacteria 517
298 Ga0316574_0238279 3300035398 Unclassified 1163
299 Ga0373927_0002375 3300035695 Bacteria 13713
300 Ga0373933_0196542 3300035724 Bacteria 1290
301 Ga0316582_0144201 3300036647 Bacteria 1607
302 Ga0316584_0075650 3300036712 Unclassified 2523
303 Ga0400490_03784 3300038726 Unclassified 1913
304 Ga0439453_0129868 3300041408 Bacteria 584
305 Ga0439431_0210810 3300041997 Bacteria 568
306 Ga0451577_1465436 3300042876 Unclassified 604
307 Ga0453683_0372427 3300044673 Bacteria 919
308 Ga0466963_0525644 3300044694 Bacteria 835
309 Ga0466963_0902636 3300044694 Unclassified 623
310 Ga0453684_0060095 3300044712 Bacteria 4893
311 Ga0453684_0371342 3300044712 Bacteria 1608
312 Ga0453684_0744959 3300044712 Bacteria 1061
313 Ga0466957_0761467 3300044842 Unclassified 686
314 Ga0451576_0128167 3300045051 Bacteria 2644
315 Ga0451576_0907073 3300045051 Bacteria 924
316 Ga0466967_0220719 3300045976 Bacteria 1801
317 Ga0466967_1041435 3300045976 Bacteria 815
318 Ga0495580_0538363 3300046472 Bacteria 776
319 Ga0495586_0128790 3300046535 Bacteria 1417
320 Ga0495599_0580714 3300046678 Unclassified 654
321 Ga0495669_0009069 3300046684 Unclassified 4194
322 Ga0495672_0518046 3300047320 Bacteria 527
323 Ga0495684_0680777 3300047471 Unclassified 684
324 Ga0496102_0252105 3300048905 Bacteria 1664
325 Ga0496104_0896703 3300048907 Unclassified 792
326 Ga0501033_0521392 3300049570 Unclassified 821
327 Ga0501036_0463917 3300049572 Bacteria 1055
328 Ga0501040_0139372 3300049576 Unclassified 1708
329 Ga0501040_1154019 3300049576 Unclassified 562
330 Ga0501041_1053242 3300049577 Unclassified 524
331 Ga0501046_0939609 3300049580 Unclassified 602
332 Ga0501048_0079756 3300049582 Bacteria 2310
333 Ga0501067_0594620 3300049583 Unclassified 620
334 Ga0501071_1516736 3300049587 Bacteria 517
335 Ga0501072_0446719 3300049588 Unclassified 1024
336 Ga0501074_0602402 3300049590 Bacteria 777
337 Ga0501075_0385070 3300049591 Unclassified 1069
338 Ga0501076_0596601 3300049592 Unclassified 911
339 Ga0501216_065299 3300049660 Unclassified 742
340 Ga0501252_095382 3300049682 Bacteria 509
341 Ga0501221_169746 3300049704 Unclassified 590
342 Ga0501081_0309870 3300049743 Unclassified 1159
343 Ga0501276_040401 3300049773 Bacteria 518
344 Ga0501044_0002192 3300049823 Bacteria 22408
345 Ga0501045_0512422 3300049824 Bacteria 891
346 nmdc:mga05p37_1439992_c1 3300050507 Bacteria 691
347 nmdc:mga05p37_4098_c1 3300050507 Bacteria 17028
348 nmdc:mga05p37_541112_c1 3300050507 Bacteria 1328
349 nmdc:mga05p37_725554_c1 3300050507 Bacteria 1100
350 nmdc:mga05p37_7256_c1 3300050507 Bacteria 13073
351 nmdc:mga09592_1087252_c1 3300050508 Unclassified 665
352 nmdc:mga09592_154622_c1 3300050508 Bacteria 1980
353 nmdc:mga09592_445190_c1 3300050508 Bacteria 1118
354 nmdc:mga09592_81085_c1 3300050508 Bacteria 2764
355 nmdc:mga0qj67_185637_c1 3300050509 Bacteria 1689
356 nmdc:mga0qj67_6077_c1 3300050509 Bacteria 8847
357 nmdc:mga06r32_53639_c1 3300050510 Bacteria 3863
358 nmdc:mga06r32_56790_c1 3300050510 Bacteria 3758
359 nmdc:mga06r32_903586_c1 3300050510 Bacteria 839
360 nmdc:mga08y16_1524680_c1 3300050511 Unclassified 628
361 nmdc:mga08y16_202752_c1 3300050511 Unclassified 2055
362 nmdc:mga0n895_101433_c1 3300050512 Bacteria 2888
363 nmdc:mga0n895_2044595_c1 3300050512 Bacteria 530
364 nmdc:mga0n895_206035_c1 3300050512 Unclassified 1997
365 nmdc:mga0n895_527_c1 3300050512 Bacteria 26121
366 nmdc:mga0n895_598515_c1 3300050512 Bacteria 1105
367 nmdc:mga0rr50_340481_c1 3300050513 Unclassified 1260
368 nmdc:mga08x19_103221_c1 3300050514 Bacteria 1894
369 nmdc:mga08x19_21920_c1 3300050514 Bacteria 3950
370 nmdc:mga08x19_58981_c1 3300050514 Bacteria 2484
371 nmdc:mga08x19_96693_c1 3300050514 Bacteria 1955
372 nmdc:mga0a205_1431341_c1 3300050515 Bacteria 539
373 nmdc:mga0a205_274704_c1 3300050515 Bacteria 1561
374 nmdc:mga0a205_45666_c1 3300050515 Bacteria 4224
375 nmdc:mga0a205_70_c1 3300050515 Bacteria 55862
376 nmdc:mga0a205_785879_c1 3300050515 Bacteria 800
377 Ga0065707_10197830
378 JGI25405J52794_10137466
379 Ga0070676_10081399
380 Ga0070670_100021436
381 Ga0070677_10490074
382 Ga0070677_10696057
383 Ga0068869_101327885
384 Ga0070666_11171101
385 Ga0068868_100206934
386 Ga0068868_101134593
387 Ga0070689_100207798
388 Ga0070668_100009569
389 Ga0070668_100077645
390 Ga0070668_100502037
391 Ga0070669_100001612
392 Ga0070669_100091429
393 Ga0070669_100139009
394 Ga0070669_100354454
395 Ga0070669_101087586
396 Ga0070675_100051927
397 Ga0070675_100434651
398 Ga0070675_100729810
399 Ga0070671_100030174
400 Ga0070674_102124873
401 Ga0070673_100054524
402 Ga0070673_101008985
403 Ga0070673_101826231
404 Ga0070688_100031111
405 Ga0070688_100567876
406 Ga0070667_100071440
407 Ga0070703_10131204
408 Ga0070709_10002564
409 Ga0070709_10643068
410 Ga0070709_11511409
411 Ga0070714_101471544
412 Ga0070710_10288729
413 Ga0070710_10993385
414 Ga0070711_100000042
415 Ga0070711_100871963
416 Ga0070711_101311731
417 Ga0070705_101062315
418 Ga0070694_100004121
419 Ga0070694_100404615
420 Ga0070694_101849247
421 Ga0070708_100007254
422 Ga0070678_100040735
423 Ga0068867_100090359
424 Ga0068867_100253381
425 Ga0068867_100555257
426 Ga0068867_102282676
427 Ga0070706_100522919
428 Ga0070706_100881927
429 Ga0070707_100248628
430 Ga0070707_102020509
431 Ga0070699_100445900
432 Ga0070699_100685216
433 Ga0070697_100094055
434 Ga0070697_100341479
435 Ga0070697_100380507
436 Ga0070672_100058339
437 Ga0070672_100176445
438 Ga0070672_100363032
439 Ga0070672_100459676
440 Ga0070695_100029320
441 Ga0070695_100228857
442 Ga0070695_100244467
443 Ga0070695_100270920
444 Ga0070695_100344274
445 Ga0070696_100036794
446 Ga0070693_101677118
447 Ga0070665_101365664
448 Ga0070704_100452943
449 Ga0070664_100954050
450 Ga0070664_102365081
451 Ga0068857_100003921
452 Ga0068852_101249231
453 Ga0068859_100000034
454 Ga0068859_100046851
455 Ga0068859_100996090
456 Ga0068859_101195886
457 Ga0068859_102530815
458 Ga0068859_102968446
459 Ga0068864_100324557
460 Ga0068864_100390926
461 Ga0068864_100414137
462 Ga0068864_100652202
463 Ga0068866_10128162
464 Ga0068866_11149045
465 Ga0068861_100131849
466 Ga0068861_101200237
467 Ga0068861_101613705
468 Ga0068870_10040895
469 Ga0068863_100073487
470 Ga0068858_100023593
471 Ga0068860_100184650
472 Ga0068860_100285667
473 Ga0068860_100349289
474 Ga0068860_101373874
475 Ga0068862_100007489
476 Ga0068862_100010817
477 Ga0081455_10021617
478 Ga0081455_10125263
479 Ga0075432_10545469
480 Ga0070716_100236996
481 Ga0070712_101586444
482 Ga0097621_100863355
483 Ga0068871_100414960
484 Ga0068871_102345930
485 Ga0075428_100006947
486 Ga0075428_100040994
487 Ga0075428_100056936
488 Ga0075428_101125769
489 Ga0075428_101376392
490 Ga0075428_102003776
491 Ga0075430_100067366
492 Ga0075430_100337091
493 Ga0075430_100341388
494 Ga0075430_100390534
495 Ga0075430_100537530
496 Ga0075430_101562926
497 Ga0075431_100011215
498 Ga0075431_100031800
499 Ga0075431_100382418
500 Ga0075431_100401790
501 Ga0075431_100528993
502 Ga0075433_10000392
503 Ga0075433_10070868
504 Ga0075433_10102947
505 Ga0075433_11016637
506 Ga0075434_100001577
507 Ga0075434_100081526
508 Ga0075434_100202150
509 Ga0075434_100646020
510 Ga0075434_100936023
511 Ga0075429_100073367
512 Ga0075429_100144154
513 Ga0075429_100167968
514 Ga0075429_100788425
515 Ga0068865_100982372
516 Ga0068865_101153522
517 Ga0075436_100030687
518 Ga0075436_100035097
519 Ga0097620_100000034
520 Ga0097620_100046852
521 Ga0097620_100996126
522 Ga0097620_101064591
523 Ga0097620_101195695
524 Ga0097620_102530894
525 Ga0097620_102967572
526 Ga0075435_100253186
527 Ga0099794_10075152
528 Ga0111539_10715055
529 Ga0111539_10918749
530 Ga0111539_12448485
531 Ga0111539_13417385
532 Ga0105245_10065057
533 Ga0105245_10383882
534 Ga0105247_11397536
535 Ga0114129_10000967
536 Ga0114129_10546234
537 Ga0114129_11310759
538 Ga0114129_11408248
539 Ga0105242_10055981
540 Ga0105242_10091369
541 Ga0105248_10106803
542 Ga0105248_10356663
543 Ga0105248_10835314
544 Ga0105248_10846384
545 Ga0105237_12414882
546 Ga0105249_10543959
547 Ga0105249_12315934
548 Ga0105249_12790854
549 Ga0157378_10390793
550 Ga0163162_10049111
551 Ga0163162_10108898
552 Ga0163162_11511710
553 Ga0157375_10007462
554 Ga0157375_10225842
555 Ga0157375_10686951
556 Ga0163163_11476759
557 Ga0157377_10292523
558 Ga0157377_11146963
559 Ga0157379_12019526
560 Ga0157376_10009510
561 Ga0207653_10402873
562 Ga0207682_10383132
563 Ga0207682_10518381
564 Ga0207692_10477870
565 Ga0207642_10066253
566 Ga0207680_10009017
567 Ga0207685_10160532
568 Ga0207699_10006586
569 Ga0207643_10004471
570 Ga0207693_10042355
571 Ga0207663_10002984
572 Ga0207663_10443183
573 Ga0207660_10448145
574 Ga0207646_10176011
575 Ga0207646_10362704
576 Ga0207646_11679486
577 Ga0207681_10002458
578 Ga0207681_10365674
579 Ga0207681_10524190
580 Ga0207650_10084840
581 Ga0207659_10471657
582 Ga0207687_10452901
583 Ga0207644_10050283
584 Ga0207706_10156181
585 Ga0207686_10092323
586 Ga0207686_10136251
587 Ga0207709_10116669
588 Ga0207670_10603119
589 Ga0207670_11310199
590 Ga0207704_10292536
591 Ga0207704_10541075
592 Ga0207704_11248514
593 Ga0207665_10397218
594 Ga0207691_10058325
595 Ga0207691_10191128
596 Ga0207711_10081344
597 Ga0207679_11622864
598 Ga0207679_11889925
599 Ga0207651_10930838
600 Ga0207651_11382887
601 Ga0207651_11429502
602 Ga0207712_10015890
603 Ga0207712_10521680
604 Ga0207712_11370283
605 Ga0207668_10095302
606 Ga0207668_10109360
607 Ga0207668_11191325
608 Ga0207658_10932571
609 Ga0207677_10725950
610 Ga0207703_10023600
611 Ga0207708_10129262
612 Ga0207708_10526386
613 Ga0207702_11306735
614 Ga0207641_10293105
615 Ga0207641_10610498
616 Ga0207641_11718835
617 Ga0207648_10165730
618 Ga0207648_10635870
619 Ga0207676_10670360
620 Ga0207676_10722940
621 Ga0207674_10034125
622 Ga0207675_100369030
623 Ga0207675_100386714
624 Ga0207683_11782563
625 Ga0209588_1268389
626 Ga0209966_1085410
627 Ga0207428_10203178
628 Ga0207428_10528143
629 Ga0268266_11127387
630 Ga0268266_12362527
631 Ga0268265_10000377
632 Ga0268265_10036063
633 Ga0268264_10054989
634 Ga0268264_10317956
635 Ga0268264_11330775
636 Ga0265325_10006622
637 Ga0316575_10426768
638 Ga0316576_10347306
639 Ga0316576_11224446
640 Ga0316578_10129292
641 Ga0307405_10204670
642 Ga0307405_10561873
643 Ga0307405_11647612
644 Ga0307413_10005437
645 Ga0307413_11976506
646 Ga0307410_10017003
647 Ga0307410_10142458
648 Ga0307410_10231609
649 Ga0307410_10577921
650 Ga0307406_10721754
651 Ga0307407_10057655
652 Ga0307407_10269466
653 Ga0307407_10445030
654 Ga0307407_10552497
655 Ga0307412_11291067
656 Ga0307409_100044828
657 Ga0307409_100096967
658 Ga0307409_100746374
659 Ga0307416_100116879
660 Ga0307416_100957539
661 Ga0307414_10024221
662 Ga0307414_10051614
663 Ga0307414_10224656
664 Ga0307414_10309051
665 Ga0307414_10791456
666 Ga0307414_11616037
667 Ga0307411_10697229
668 Ga0307411_10816199
669 Ga0307415_100208292
670 Ga0307415_100309239
671 Ga0307415_100665524
672 Ga0307415_101588545
673 Ga0316593_10422777
674 Ga0316574_0238279
675 Ga0373927_0002375
676 Ga0373933_0196542
677 Ga0316582_0144201
678 Ga0316584_0075650
679 Ga0400490_03784
680 Ga0439453_0129868
681 Ga0439431_0210810
682 Ga0451577_1465436
683 Ga0453683_0372427
684 Ga0466963_0525644
685 Ga0466963_0902636
686 Ga0453684_0060095
687 Ga0453684_0371342
688 Ga0453684_0744959
689 Ga0466957_0761467
690 Ga0451576_0128167
691 Ga0451576_0907073
692 Ga0466967_0220719
693 Ga0466967_1041435
694 Ga0495580_0538363
695 Ga0495586_0128790
696 Ga0495599_0580714
697 Ga0495669_0009069
698 Ga0495672_0518046
699 Ga0495684_0680777
700 Ga0496102_0252105
701 Ga0496104_0896703
702 Ga0501033_0521392
703 Ga0501036_0463917
704 Ga0501040_0139372
705 Ga0501040_1154019
706 Ga0501041_1053242
707 Ga0501046_0939609
708 Ga0501048_0079756
709 Ga0501067_0594620
710 Ga0501071_1516736
711 Ga0501072_0446719
712 Ga0501074_0602402
713 Ga0501075_0385070
714 Ga0501076_0596601
715 Ga0501216_065299
716 Ga0501252_095382
717 Ga0501221_169746
718 Ga0501081_0309870
719 Ga0501276_040401
720 Ga0501044_0002192
721 Ga0501045_0512422
722 nmdc:mga05p37_1439992_c1
723 nmdc:mga05p37_4098_c1
724 nmdc:mga05p37_541112_c1
725 nmdc:mga05p37_725554_c1
726 nmdc:mga05p37_7256_c1
727 nmdc:mga09592_1087252_c1
728 nmdc:mga09592_154622_c1
729 nmdc:mga09592_445190_c1
730 nmdc:mga09592_81085_c1
731 nmdc:mga0qj67_185637_c1
732 nmdc:mga0qj67_6077_c1
733 nmdc:mga06r32_53639_c1
734 nmdc:mga06r32_56790_c1
735 nmdc:mga06r32_903586_c1
736 nmdc:mga08y16_1524680_c1
737 nmdc:mga08y16_202752_c1
738 nmdc:mga0n895_101433_c1
739 nmdc:mga0n895_2044595_c1
740 nmdc:mga0n895_206035_c1
741 nmdc:mga0n895_527_c1
742 nmdc:mga0n895_598515_c1
743 nmdc:mga0rr50_340481_c1
744 nmdc:mga08x19_103221_c1
745 nmdc:mga08x19_21920_c1
746 nmdc:mga08x19_58981_c1
747 nmdc:mga08x19_96693_c1
748 nmdc:mga0a205_1431341_c1
749 nmdc:mga0a205_274704_c1
750 nmdc:mga0a205_45666_c1
751 nmdc:mga0a205_70_c1
752 nmdc:mga0a205_785879_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19451

DUF5989

Family of unknown function (DUF5989)

5

53

0.97

Map