F427161

General Info

Members Datasets Scaffolds Average Seq Length
375 229 750 158

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0210055|Ga0495680_0210055_570_1112
Length 180
Sequence MPRARPPTDRRAAVPVRLNPPVERLWAPWRLEYIKSADEEPGCVFCRAAEASDEDGLVIHRGKLAFCLLNKYPYSSGHVMVAPFRHVGEFGGLSDDEALEIHRLATQALEALRRTAEPHGFNLGWNIGRAAGAGVIDHVHLHAVPRWGGDTNFMPVLADVKVLPEALEETRRKLAEAWPS

Samples

Sample ID Description Type Environment
1 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.47
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495680_0210055 3300047322 Unclassified 1394
2 JGI25407J50210_10027736 3300003373 Bacteria 1469
3 Ga0070658_10180955 3300005327 Bacteria 1774
4 Ga0070683_100782093 3300005329 Bacteria 915
5 Ga0068869_101003920 3300005334 Bacteria 727
6 Ga0070666_10162781 3300005335 Bacteria 1560
7 Ga0070680_100015726 3300005336 Bacteria 5940
8 Ga0070680_100686296 3300005336 Bacteria 881
9 Ga0070682_100061232 3300005337 Bacteria 2382
10 Ga0070682_100811879 3300005337 Unclassified 761
11 Ga0068868_100622229 3300005338 Bacteria 959
12 Ga0070660_100043294 3300005339 Bacteria 3440
13 Ga0070689_100418896 3300005340 Bacteria 1135
14 Ga0070689_100481741 3300005340 Bacteria 1060
15 Ga0070691_10069426 3300005341 Unclassified 1708
16 Ga0070691_10180610 3300005341 Bacteria 1098
17 Ga0070661_100054437 3300005344 Bacteria 2930
18 Ga0070661_100324708 3300005344 Bacteria 1203
19 Ga0070671_100561091 3300005355 Unclassified 985
20 Ga0070674_100164623 3300005356 Bacteria 1685
21 Ga0070688_100552040 3300005365 Unclassified 876
22 Ga0070688_100981617 3300005365 Unclassified 670
23 Ga0070659_100770036 3300005366 Bacteria 836
24 Ga0070667_100050207 3300005367 Bacteria 3515
25 Ga0070667_100327719 3300005367 Bacteria 1383
26 Ga0070701_10038953 3300005438 Bacteria 2409
27 Ga0070705_100299017 3300005440 Bacteria 1152
28 Ga0070700_100178545 3300005441 Bacteria 1476
29 Ga0070708_100043102 3300005445 Bacteria 3964
30 Ga0070708_100111952 3300005445 Bacteria 2510
31 Ga0070663_100159202 3300005455 Bacteria 1737
32 Ga0070678_100895055 3300005456 Bacteria 811
33 Ga0070662_100116083 3300005457 Bacteria 2045
34 Ga0070681_10302916 3300005458 Bacteria 1507
35 Ga0068867_100267318 3300005459 Bacteria 1397
36 Ga0070706_100012097 3300005467 Bacteria 8010
37 Ga0070707_100002659 3300005468 Bacteria 16979
38 Ga0070698_100083988 3300005471 Bacteria 3173
39 Ga0070698_101104017 3300005471 Archaea 742
40 Ga0070699_100005929 3300005518 Bacteria 10671
41 Ga0070699_100037806 3300005518 Bacteria 4178
42 Ga0070699_100255813 3300005518 Unclassified 1566
43 Ga0070679_100422921 3300005530 Bacteria 1278
44 Ga0070684_100363740 3300005535 Bacteria 1331
45 Ga0070697_100096497 3300005536 Bacteria 2452
46 Ga0070672_100240087 3300005543 Bacteria 1524
47 Ga0070672_101363352 3300005543 Bacteria 634
48 Ga0070686_100015252 3300005544 Bacteria 4444
49 Ga0070696_100105663 3300005546 Bacteria 2023
50 Ga0070696_100981955 3300005546 Bacteria 704
51 Ga0070693_100173051 3300005547 Bacteria 1384
52 Ga0070665_100546229 3300005548 Bacteria 1171
53 Ga0070704_101087620 3300005549 Bacteria 726
54 Ga0068855_100179621 3300005563 Unclassified 2393
55 Ga0070664_100035195 3300005564 Bacteria 4204
56 Ga0068857_100037006 3300005577 Bacteria 4322
57 Ga0068854_100016791 3300005578 Bacteria 4885
58 Ga0070702_100001691 3300005615 Bacteria 9156
59 Ga0068864_100172723 3300005618 Bacteria 1971
60 Ga0068866_10028921 3300005718 Bacteria 2644
61 Ga0068861_100035275 3300005719 Bacteria 3703
62 Ga0068861_100651114 3300005719 Bacteria 973
63 Ga0068870_10760627 3300005840 Bacteria 674
64 Ga0068863_100419974 3300005841 Unclassified 1310
65 Ga0068863_101283164 3300005841 Bacteria 739
66 Ga0068858_100487607 3300005842 Unclassified 1190
67 Ga0068860_100000652 3300005843 Bacteria 40455
68 Ga0068860_100024569 3300005843 Bacteria 5820
69 Ga0068862_100952505 3300005844 Bacteria 847
70 Ga0081455_10043386 3300005937 Bacteria 3934
71 Ga0081455_10084370 3300005937 Bacteria 2593
72 Ga0081455_10166858 3300005937 Bacteria 1681
73 Ga0081455_10234335 3300005937 Bacteria 1353
74 Ga0081455_10407727 3300005937 Bacteria 941
75 Ga0081538_10000939 3300005981 Bacteria 31446
76 Ga0081538_10003698 3300005981 Bacteria 14352
77 Ga0081538_10004376 3300005981 Bacteria 13044
78 Ga0081538_10029050 3300005981 Bacteria 3786
79 Ga0081538_10029382 3300005981 Bacteria 3756
80 Ga0081538_10050318 3300005981 Bacteria 2518
81 Ga0081539_10001254 3300005985 Bacteria 45041
82 Ga0075432_10119615 3300006058 Bacteria 988
83 Ga0070715_10075128 3300006163 Bacteria 1519
84 Ga0097621_100020830 3300006237 Bacteria 5060
85 Ga0068871_100036461 3300006358 Bacteria 3915
86 Ga0075428_100011200 3300006844 Bacteria 9979
87 Ga0075428_100075224 3300006844 Bacteria 3688
88 Ga0075428_100889127 3300006844 Bacteria 945
89 Ga0075430_100015078 3300006846 Bacteria 6577
90 Ga0075431_100036774 3300006847 Bacteria 5043
91 Ga0075429_100200890 3300006880 Archaea 1746
92 Ga0068865_100067058 3300006881 Bacteria 2534
93 Ga0068865_100212988 3300006881 Bacteria 1507
94 Ga0075436_100364347 3300006914 Bacteria 1043
95 Ga0105240_10050296 3300009093 Bacteria 5256
96 Ga0111539_10052056 3300009094 Bacteria 4875
97 Ga0105245_10085072 3300009098 Bacteria 2898
98 Ga0105245_10094075 3300009098 Bacteria 2762
99 Ga0105245_10560387 3300009098 Bacteria 1165
100 Ga0105245_11899052 3300009098 Unclassified 649
101 Ga0105247_10006866 3300009101 Bacteria 7014
102 Ga0114129_10240956 3300009147 Bacteria 2431
103 Ga0114129_10316195 3300009147 Bacteria 2077
104 Ga0114129_10386591 3300009147 Bacteria 1847
105 Ga0114129_11088163 3300009147 Bacteria 1001
106 Ga0105243_10051269 3300009148 Bacteria 3263
107 Ga0105243_10178100 3300009148 Bacteria 1847
108 Ga0105241_10007162 3300009174 Bacteria 8209
109 Ga0105242_10016495 3300009176 Bacteria 5743
110 Ga0105242_10519113 3300009176 Bacteria 1136
111 Ga0105248_10021352 3300009177 Bacteria 7175
112 Ga0105248_10266137 3300009177 Bacteria 1930
113 Ga0105248_11739543 3300009177 Bacteria 707
114 Ga0105248_12846908 3300009177 Bacteria 552
115 Ga0105237_10699364 3300009545 Bacteria 1020
116 Ga0105238_10883146 3300009551 Bacteria 912
117 Ga0105239_10409233 3300010375 Bacteria 1536
118 Ga0105246_10095080 3300011119 Unclassified 2157
119 Ga0105246_10147827 3300011119 Bacteria 1775
120 Ga0157370_10016233 3300013104 Bacteria 7545
121 Ga0157369_11305054 3300013105 Bacteria 740
122 Ga0157374_11464468 3300013296 Unclassified 706
123 Ga0157378_10014659 3300013297 Bacteria 6864
124 Ga0163162_10336477 3300013306 Bacteria 1642
125 Ga0163162_10720579 3300013306 Bacteria 1118
126 Ga0157375_10004567 3300013308 Bacteria 12025
127 Ga0157375_10251543 3300013308 Bacteria 1928
128 Ga0157375_10949826 3300013308 Bacteria 1001
129 Ga0163163_10717276 3300014325 Bacteria 1063
130 Ga0157380_10436004 3300014326 Unclassified 1254
131 Ga0182008_10576781 3300014497 Bacteria 628
132 Ga0157379_10048767 3300014968 Bacteria 3780
133 Ga0157379_10083973 3300014968 Bacteria 2854
134 Ga0157376_10046168 3300014969 Bacteria 3591
135 Ga0157376_10068485 3300014969 Bacteria 3006
136 Ga0157376_11213403 3300014969 Bacteria 783
137 Ga0163161_10297554 3300017792 Bacteria 1270
138 Ga0163161_10698361 3300017792 Unclassified 844
139 Ga0197907_10943227 3300020069 Bacteria 1244
140 Ga0206354_10286793 3300020081 Bacteria 3136
141 Ga0206353_11481031 3300020082 Bacteria 9625
142 Ga0213876_10044356 3300021384 Bacteria 2350
143 Ga0207710_10228401 3300025900 Unclassified 926
144 Ga0207688_10054996 3300025901 Bacteria 2233
145 Ga0207685_10023898 3300025905 Bacteria 2087
146 Ga0207645_10237424 3300025907 Bacteria 1204
147 Ga0207643_10012424 3300025908 Bacteria 4602
148 Ga0207705_10009295 3300025909 Bacteria 7147
149 Ga0207684_10166493 3300025910 Bacteria 1899
150 Ga0207695_10140787 3300025913 Bacteria 2361
151 Ga0207662_10054373 3300025918 Bacteria 2387
152 Ga0207649_10162310 3300025920 Bacteria 1549
153 Ga0207652_10192752 3300025921 Bacteria 1833
154 Ga0207652_10714589 3300025921 Bacteria 893
155 Ga0207646_10009614 3300025922 Bacteria 9538
156 Ga0207646_10173677 3300025922 Unclassified 1946
157 Ga0207681_10609596 3300025923 Bacteria 903
158 Ga0207687_10479820 3300025927 Bacteria 1035
159 Ga0207687_10753774 3300025927 Unclassified 829
160 Ga0207687_11210463 3300025927 Unclassified 649
161 Ga0207700_11259428 3300025928 Unclassified 659
162 Ga0207644_10253962 3300025931 Bacteria 1404
163 Ga0207690_10564666 3300025932 Bacteria 926
164 Ga0207706_10093355 3300025933 Bacteria 2646
165 Ga0207706_10135377 3300025933 Bacteria 2167
166 Ga0207686_10434684 3300025934 Bacteria 1007
167 Ga0207709_10108110 3300025935 Unclassified 1854
168 Ga0207670_10224851 3300025936 Bacteria 1439
169 Ga0207669_10177267 3300025937 Bacteria 1524
170 Ga0207704_10034035 3300025938 Bacteria 2904
171 Ga0207704_10360277 3300025938 Bacteria 1135
172 Ga0207691_10559179 3300025940 Unclassified 970
173 Ga0207711_10057535 3300025941 Bacteria 3342
174 Ga0207711_10205698 3300025941 Bacteria 1797
175 Ga0207679_10081364 3300025945 Bacteria 2476
176 Ga0207667_10103891 3300025949 Unclassified 2930
177 Ga0207668_10215042 3300025972 Bacteria 1540
178 Ga0207640_10066391 3300025981 Bacteria 2410
179 Ga0207640_10737396 3300025981 Bacteria 848
180 Ga0207658_10006288 3300025986 Bacteria 8113
181 Ga0207677_10182323 3300026023 Bacteria 1653
182 Ga0207677_10865492 3300026023 Unclassified 813
183 Ga0207703_10327087 3300026035 Unclassified 1405
184 Ga0207678_10085386 3300026067 Bacteria 2698
185 Ga0207708_10205025 3300026075 Bacteria 1574
186 Ga0207708_10406970 3300026075 Bacteria 1126
187 Ga0207641_10402905 3300026088 Unclassified 1314
188 Ga0207676_10314877 3300026095 Unclassified 1434
189 Ga0207676_10980081 3300026095 Unclassified 832
190 Ga0207674_10777112 3300026116 Bacteria 924
191 Ga0207675_100137465 3300026118 Bacteria 2319
192 Ga0207683_10000049 3300026121 Bacteria 87948
193 Ga0207698_10513144 3300026142 Bacteria 1168
194 Ga0207698_11046066 3300026142 Bacteria 828
195 Ga0209974_10251333 3300027876 Archaea 665
196 Ga0268266_10337158 3300028379 Bacteria 1415
197 Ga0268264_10001623 3300028381 Bacteria 20781
198 Ga0268264_10080212 3300028381 Bacteria 2786
199 Ga0268264_11303295 3300028381 Bacteria 736
200 Ga0307405_10002059 3300031731 Bacteria 8744
201 Ga0307405_10020581 3300031731 Bacteria 3690
202 Ga0307413_10003436 3300031824 Bacteria 6663
203 Ga0307410_10003673 3300031852 Bacteria 7753
204 Ga0307406_10008651 3300031901 Bacteria 5688
205 Ga0307407_10001484 3300031903 Bacteria 8544
206 Ga0307407_10465589 3300031903 Bacteria 920
207 Ga0307409_100002384 3300031995 Bacteria 9789
208 Ga0307409_100096693 3300031995 Bacteria 2437
209 Ga0307416_100001696 3300032002 Bacteria 12201
210 Ga0307416_100003011 3300032002 Bacteria 9840
211 Ga0307416_101110828 3300032002 Unclassified 895
212 Ga0307414_10022652 3300032004 Bacteria 3968
213 Ga0307411_10015092 3300032005 Bacteria 4325
214 Ga0307415_100000290 3300032126 Bacteria 21692
215 Ga0307415_100000373 3300032126 Bacteria 19125
216 Ga0395899_0000857 3300037312 Bacteria 29102
217 Ga0395899_0078933 3300037312 Bacteria 2398
218 Ga0395899_0182880 3300037312 Unclassified 1470
219 Ga0395900_0042071 3300037418 Bacteria 4706
220 Ga0395900_0101855 3300037418 Bacteria 2949
221 Ga0395900_0132727 3300037418 Bacteria 2551
222 Ga0395898_0009878 3300037466 Bacteria 10004
223 Ga0395898_0181486 3300037466 Unclassified 2011
224 Ga0395898_0489786 3300037466 Bacteria 1170
225 Ga0395898_0618328 3300037466 Bacteria 1026
226 Ga0395905_0012399 3300037471 Bacteria 8204
227 Ga0395905_0053730 3300037471 Unclassified 3769
228 Ga0395905_0284465 3300037471 Bacteria 1540
229 Ga0395905_0575455 3300037471 Bacteria 1028
230 Ga0395901_0048608 3300038443 Bacteria 4405
231 Ga0395901_0112737 3300038443 Bacteria 2856
232 Ga0395901_0114432 3300038443 Bacteria 2834
233 Ga0395901_0541607 3300038443 Unclassified 1180
234 Ga0395901_0768463 3300038443 Bacteria 955
235 Ga0395901_0772220 3300038443 Bacteria 952
236 Ga0395901_1147878 3300038443 Bacteria 745
237 Ga0395901_1258674 3300038443 Bacteria 703
238 Ga0395901_1557148 3300038443 Bacteria 615
239 Ga0436365_1633409 3300039437 Unclassified 3534
240 Ga0451797_0076379 3300041453 Bacteria 636
241 Ga0439448_0012594 3300042005 Bacteria 2534
242 Ga0439460_0244438 3300042461 Bacteria 619
243 Ga0466964_0024490 3300044706 Bacteria 2353
244 Ga0451576_0108536 3300045051 Bacteria 2888
245 Ga0466967_0007161 3300045976 Bacteria 8011
246 Ga0466967_0947672 3300045976 Bacteria 856
247 Ga0495605_0153139 3300046474 Archaea 1028
248 Ga0495605_0202152 3300046474 Bacteria 865
249 Ga0495664_0125973 3300046477 Bacteria 1550
250 Ga0495584_0038578 3300046491 Bacteria 2414
251 Ga0495584_0098447 3300046491 Archaea 1478
252 Ga0495585_0232161 3300046492 Bacteria 927
253 Ga0495607_0319204 3300046501 Unclassified 725
254 Ga0495583_0086500 3300046506 Bacteria 1356
255 Ga0495583_0345110 3300046506 Archaea 588
256 Ga0495631_0176649 3300046518 Unclassified 915
257 Ga0495632_0099701 3300046519 Bacteria 1370
258 Ga0495637_0034060 3300046520 Bacteria 2232
259 Ga0495637_0302908 3300046520 Archaea 567
260 Ga0495663_0059802 3300046525 Archaea 1196
261 Ga0495642_0086760 3300046528 Bacteria 1322
262 Ga0495642_0135947 3300046528 Bacteria 1060
263 Ga0495609_0148962 3300046538 Archaea 996
264 Ga0495667_0782969 3300046559 Bacteria 589
265 Ga0495667_0833425 3300046559 Archaea 568
266 Ga0495656_0157179 3300046615 Archaea 1102
267 Ga0495661_0121919 3300046665 Bacteria 1439
268 Ga0495671_0098466 3300046692 Bacteria 1430
269 Ga0495589_0081872 3300046794 Archaea 1570
270 Ga0495660_0213906 3300046810 Unclassified 913
271 Ga0495636_0104612 3300047318 Bacteria 1241
272 Ga0495683_0271551 3300047323 Bacteria 737
273 Ga0495677_0070674 3300047445 Bacteria 1301
274 Ga0495685_075608 3300047447 Archaea 1125
275 Ga0495681_0148612 3300047470 Unclassified 985
276 Ga0495615_0194628 3300048090 Bacteria 623
277 Ga0496100_0030562 3300048903 Bacteria 3342
278 Ga0496100_0038385 3300048903 Bacteria 3035
279 Ga0496100_0499850 3300048903 Bacteria 937
280 Ga0496101_0011323 3300048904 Bacteria 5915
281 Ga0496102_0059158 3300048905 Bacteria 3503
282 Ga0496102_0115553 3300048905 Bacteria 2504
283 Ga0496102_0716595 3300048905 Bacteria 923
284 Ga0496102_0954019 3300048905 Bacteria 779
285 Ga0496103_0126116 3300048906 Bacteria 1633
286 Ga0496103_0132658 3300048906 Bacteria 1591
287 Ga0496103_0267997 3300048906 Bacteria 1099
288 Ga0496104_0003798 3300048907 Bacteria 13065
289 Ga0496104_0041551 3300048907 Bacteria 4312
290 Ga0496104_0476433 3300048907 Bacteria 1160
291 Ga0496105_0006428 3300048908 Bacteria 9034
292 Ga0496106_0010115 3300048909 Bacteria 6966
293 Ga0496107_0068741 3300048910 Bacteria 2570
294 Ga0496107_0662815 3300048910 Unclassified 769
295 Ga0496108_0006525 3300048911 Bacteria 9460
296 Ga0496108_0041798 3300048911 Bacteria 3828
297 Ga0496108_0216318 3300048911 Bacteria 1664
298 Ga0496108_0515875 3300048911 Bacteria 1044
299 Ga0496109_0003468 3300048912 Bacteria 13166
300 Ga0496109_0119856 3300048912 Bacteria 2450
301 Ga0496109_0403175 3300048912 Bacteria 1292
302 Ga0496110_0000695 3300048913 Bacteria 23245
303 Ga0496110_0005823 3300048913 Bacteria 9685
304 Ga0496110_0046718 3300048913 Bacteria 3788
305 Ga0496110_0373537 3300048913 Bacteria 1299
306 Ga0496111_0010098 3300048914 Bacteria 6321
307 Ga0496111_0145800 3300048914 Bacteria 1755
308 Ga0496111_0204250 3300048914 Unclassified 1468
309 Ga0496111_0615217 3300048914 Bacteria 794
310 Ga0496112_0006933 3300048915 Bacteria 10000
311 Ga0496112_1441881 3300048915 Bacteria 603
312 Ga0496113_0057695 3300048916 Bacteria 2919
313 Ga0496113_0263737 3300048916 Bacteria 1376
314 Ga0496114_0066224 3300048917 Bacteria 3028
315 Ga0496114_0089077 3300048917 Bacteria 2618
316 Ga0496114_0235249 3300048917 Unclassified 1610
317 Ga0496115_0064691 3300048918 Bacteria 2953
318 Ga0496115_1059851 3300048918 Unclassified 616
319 Ga0501299_019578 3300049522 Bacteria 1226
320 Ga0501031_0049176 3300049568 Bacteria 2748
321 Ga0501036_0411864 3300049572 Bacteria 1127
322 Ga0501038_0016773 3300049574 Bacteria 6633
323 Ga0501038_0581780 3300049574 Bacteria 849
324 Ga0501039_0004158 3300049575 Bacteria 10896
325 Ga0501040_0151179 3300049576 Bacteria 1638
326 Ga0501040_0515231 3300049576 Bacteria 862
327 Ga0501042_0325952 3300049578 Bacteria 1110
328 Ga0501042_0595514 3300049578 Bacteria 804
329 Ga0501042_0743300 3300049578 Bacteria 713
330 Ga0501042_1232992 3300049578 Bacteria 545
331 Ga0501043_0455276 3300049579 Bacteria 961
332 Ga0501067_0009197 3300049583 Bacteria 5471
333 Ga0501068_0040302 3300049584 Bacteria 2803
334 Ga0501069_0024465 3300049585 Bacteria 3294
335 Ga0501069_0098674 3300049585 Bacteria 1657
336 Ga0501070_0142781 3300049586 Bacteria 1977
337 Ga0501071_0054995 3300049587 Bacteria 2873
338 Ga0501071_0080453 3300049587 Bacteria 2382
339 Ga0501072_0000911 3300049588 Bacteria 21699
340 Ga0501072_0199470 3300049588 Bacteria 1595
341 Ga0501072_0387855 3300049588 Bacteria 1108
342 Ga0501072_0402891 3300049588 Bacteria 1085
343 Ga0501074_0209124 3300049590 Bacteria 1390
344 Ga0501076_0020562 3300049592 Bacteria 5053
345 Ga0501076_0080838 3300049592 Bacteria 2609
346 Ga0501076_0132858 3300049592 Bacteria 2019
347 Ga0501076_0512930 3300049592 Bacteria 988
348 Ga0501076_0561412 3300049592 Bacteria 941
349 Ga0501077_0067383 3300049593 Bacteria 2270
350 Ga0501077_0444890 3300049593 Bacteria 830
351 Ga0501079_0006391 3300049741 Bacteria 8846
352 Ga0501079_0247758 3300049741 Bacteria 1392
353 Ga0501081_0145821 3300049743 Bacteria 1699
354 Ga0501081_0274509 3300049743 Bacteria 1233
355 Ga0501083_0031111 3300049744 Bacteria 3663
356 Ga0501045_0004462 3300049824 Bacteria 9661
357 Ga0501045_0721458 3300049824 Bacteria 735
358 nmdc:mga05p37_1326_c1 3300050507 Bacteria 28804
359 nmdc:mga05p37_674872_c1 3300050507 Bacteria 1153
360 nmdc:mga05p37_841512_c1 3300050507 Bacteria 998
361 nmdc:mga09592_1361_c1 3300050508 Bacteria 19552
362 nmdc:mga08y16_18021_c1 3300050511 Bacteria 7438
363 nmdc:mga08y16_550885_c1 3300050511 Bacteria 1167
364 Ga0495601_0171824 3300053077 Bacteria 1417
365 Ga0501084_0050989 3300054114 Bacteria 3463
366 Ga0501084_0846746 3300054114 Bacteria 770
367 Ga0590075_026741 3300059424 Bacteria 1453
368 Ga0501082_0031161 3300060353 Bacteria 4596
369 Ga0530510_0005556 3300061734 Bacteria 8738
370 Ga0530510_0085466 3300061734 Bacteria 2298
371 Ga0530510_0145119 3300061734 Archaea 1751
372 Ga0530510_0266630 3300061734 Bacteria 1278
373 Ga0530510_0662926 3300061734 Bacteria 794
374 Ga0530510_1080565 3300061734 Bacteria 615
375 Ga0530510_1141490 3300061734 Bacteria 597
376 Ga0495680_0210055
377 JGI25407J50210_10027736
378 Ga0070658_10180955
379 Ga0070683_100782093
380 Ga0068869_101003920
381 Ga0070666_10162781
382 Ga0070680_100015726
383 Ga0070680_100686296
384 Ga0070682_100061232
385 Ga0070682_100811879
386 Ga0068868_100622229
387 Ga0070660_100043294
388 Ga0070689_100418896
389 Ga0070689_100481741
390 Ga0070691_10069426
391 Ga0070691_10180610
392 Ga0070661_100054437
393 Ga0070661_100324708
394 Ga0070671_100561091
395 Ga0070674_100164623
396 Ga0070688_100552040
397 Ga0070688_100981617
398 Ga0070659_100770036
399 Ga0070667_100050207
400 Ga0070667_100327719
401 Ga0070701_10038953
402 Ga0070705_100299017
403 Ga0070700_100178545
404 Ga0070708_100043102
405 Ga0070708_100111952
406 Ga0070663_100159202
407 Ga0070678_100895055
408 Ga0070662_100116083
409 Ga0070681_10302916
410 Ga0068867_100267318
411 Ga0070706_100012097
412 Ga0070707_100002659
413 Ga0070698_100083988
414 Ga0070698_101104017
415 Ga0070699_100005929
416 Ga0070699_100037806
417 Ga0070699_100255813
418 Ga0070679_100422921
419 Ga0070684_100363740
420 Ga0070697_100096497
421 Ga0070672_100240087
422 Ga0070672_101363352
423 Ga0070686_100015252
424 Ga0070696_100105663
425 Ga0070696_100981955
426 Ga0070693_100173051
427 Ga0070665_100546229
428 Ga0070704_101087620
429 Ga0068855_100179621
430 Ga0070664_100035195
431 Ga0068857_100037006
432 Ga0068854_100016791
433 Ga0070702_100001691
434 Ga0068864_100172723
435 Ga0068866_10028921
436 Ga0068861_100035275
437 Ga0068861_100651114
438 Ga0068870_10760627
439 Ga0068863_100419974
440 Ga0068863_101283164
441 Ga0068858_100487607
442 Ga0068860_100000652
443 Ga0068860_100024569
444 Ga0068862_100952505
445 Ga0081455_10043386
446 Ga0081455_10084370
447 Ga0081455_10166858
448 Ga0081455_10234335
449 Ga0081455_10407727
450 Ga0081538_10000939
451 Ga0081538_10003698
452 Ga0081538_10004376
453 Ga0081538_10029050
454 Ga0081538_10029382
455 Ga0081538_10050318
456 Ga0081539_10001254
457 Ga0075432_10119615
458 Ga0070715_10075128
459 Ga0097621_100020830
460 Ga0068871_100036461
461 Ga0075428_100011200
462 Ga0075428_100075224
463 Ga0075428_100889127
464 Ga0075430_100015078
465 Ga0075431_100036774
466 Ga0075429_100200890
467 Ga0068865_100067058
468 Ga0068865_100212988
469 Ga0075436_100364347
470 Ga0105240_10050296
471 Ga0111539_10052056
472 Ga0105245_10085072
473 Ga0105245_10094075
474 Ga0105245_10560387
475 Ga0105245_11899052
476 Ga0105247_10006866
477 Ga0114129_10240956
478 Ga0114129_10316195
479 Ga0114129_10386591
480 Ga0114129_11088163
481 Ga0105243_10051269
482 Ga0105243_10178100
483 Ga0105241_10007162
484 Ga0105242_10016495
485 Ga0105242_10519113
486 Ga0105248_10021352
487 Ga0105248_10266137
488 Ga0105248_11739543
489 Ga0105248_12846908
490 Ga0105237_10699364
491 Ga0105238_10883146
492 Ga0105239_10409233
493 Ga0105246_10095080
494 Ga0105246_10147827
495 Ga0157370_10016233
496 Ga0157369_11305054
497 Ga0157374_11464468
498 Ga0157378_10014659
499 Ga0163162_10336477
500 Ga0163162_10720579
501 Ga0157375_10004567
502 Ga0157375_10251543
503 Ga0157375_10949826
504 Ga0163163_10717276
505 Ga0157380_10436004
506 Ga0182008_10576781
507 Ga0157379_10048767
508 Ga0157379_10083973
509 Ga0157376_10046168
510 Ga0157376_10068485
511 Ga0157376_11213403
512 Ga0163161_10297554
513 Ga0163161_10698361
514 Ga0197907_10943227
515 Ga0206354_10286793
516 Ga0206353_11481031
517 Ga0213876_10044356
518 Ga0207710_10228401
519 Ga0207688_10054996
520 Ga0207685_10023898
521 Ga0207645_10237424
522 Ga0207643_10012424
523 Ga0207705_10009295
524 Ga0207684_10166493
525 Ga0207695_10140787
526 Ga0207662_10054373
527 Ga0207649_10162310
528 Ga0207652_10192752
529 Ga0207652_10714589
530 Ga0207646_10009614
531 Ga0207646_10173677
532 Ga0207681_10609596
533 Ga0207687_10479820
534 Ga0207687_10753774
535 Ga0207687_11210463
536 Ga0207700_11259428
537 Ga0207644_10253962
538 Ga0207690_10564666
539 Ga0207706_10093355
540 Ga0207706_10135377
541 Ga0207686_10434684
542 Ga0207709_10108110
543 Ga0207670_10224851
544 Ga0207669_10177267
545 Ga0207704_10034035
546 Ga0207704_10360277
547 Ga0207691_10559179
548 Ga0207711_10057535
549 Ga0207711_10205698
550 Ga0207679_10081364
551 Ga0207667_10103891
552 Ga0207668_10215042
553 Ga0207640_10066391
554 Ga0207640_10737396
555 Ga0207658_10006288
556 Ga0207677_10182323
557 Ga0207677_10865492
558 Ga0207703_10327087
559 Ga0207678_10085386
560 Ga0207708_10205025
561 Ga0207708_10406970
562 Ga0207641_10402905
563 Ga0207676_10314877
564 Ga0207676_10980081
565 Ga0207674_10777112
566 Ga0207675_100137465
567 Ga0207683_10000049
568 Ga0207698_10513144
569 Ga0207698_11046066
570 Ga0209974_10251333
571 Ga0268266_10337158
572 Ga0268264_10001623
573 Ga0268264_10080212
574 Ga0268264_11303295
575 Ga0307405_10002059
576 Ga0307405_10020581
577 Ga0307413_10003436
578 Ga0307410_10003673
579 Ga0307406_10008651
580 Ga0307407_10001484
581 Ga0307407_10465589
582 Ga0307409_100002384
583 Ga0307409_100096693
584 Ga0307416_100001696
585 Ga0307416_100003011
586 Ga0307416_101110828
587 Ga0307414_10022652
588 Ga0307411_10015092
589 Ga0307415_100000290
590 Ga0307415_100000373
591 Ga0395899_0000857
592 Ga0395899_0078933
593 Ga0395899_0182880
594 Ga0395900_0042071
595 Ga0395900_0101855
596 Ga0395900_0132727
597 Ga0395898_0009878
598 Ga0395898_0181486
599 Ga0395898_0489786
600 Ga0395898_0618328
601 Ga0395905_0012399
602 Ga0395905_0053730
603 Ga0395905_0284465
604 Ga0395905_0575455
605 Ga0395901_0048608
606 Ga0395901_0112737
607 Ga0395901_0114432
608 Ga0395901_0541607
609 Ga0395901_0768463
610 Ga0395901_0772220
611 Ga0395901_1147878
612 Ga0395901_1258674
613 Ga0395901_1557148
614 Ga0436365_1633409
615 Ga0451797_0076379
616 Ga0439448_0012594
617 Ga0439460_0244438
618 Ga0466964_0024490
619 Ga0451576_0108536
620 Ga0466967_0007161
621 Ga0466967_0947672
622 Ga0495605_0153139
623 Ga0495605_0202152
624 Ga0495664_0125973
625 Ga0495584_0038578
626 Ga0495584_0098447
627 Ga0495585_0232161
628 Ga0495607_0319204
629 Ga0495583_0086500
630 Ga0495583_0345110
631 Ga0495631_0176649
632 Ga0495632_0099701
633 Ga0495637_0034060
634 Ga0495637_0302908
635 Ga0495663_0059802
636 Ga0495642_0086760
637 Ga0495642_0135947
638 Ga0495609_0148962
639 Ga0495667_0782969
640 Ga0495667_0833425
641 Ga0495656_0157179
642 Ga0495661_0121919
643 Ga0495671_0098466
644 Ga0495589_0081872
645 Ga0495660_0213906
646 Ga0495636_0104612
647 Ga0495683_0271551
648 Ga0495677_0070674
649 Ga0495685_075608
650 Ga0495681_0148612
651 Ga0495615_0194628
652 Ga0496100_0030562
653 Ga0496100_0038385
654 Ga0496100_0499850
655 Ga0496101_0011323
656 Ga0496102_0059158
657 Ga0496102_0115553
658 Ga0496102_0716595
659 Ga0496102_0954019
660 Ga0496103_0126116
661 Ga0496103_0132658
662 Ga0496103_0267997
663 Ga0496104_0003798
664 Ga0496104_0041551
665 Ga0496104_0476433
666 Ga0496105_0006428
667 Ga0496106_0010115
668 Ga0496107_0068741
669 Ga0496107_0662815
670 Ga0496108_0006525
671 Ga0496108_0041798
672 Ga0496108_0216318
673 Ga0496108_0515875
674 Ga0496109_0003468
675 Ga0496109_0119856
676 Ga0496109_0403175
677 Ga0496110_0000695
678 Ga0496110_0005823
679 Ga0496110_0046718
680 Ga0496110_0373537
681 Ga0496111_0010098
682 Ga0496111_0145800
683 Ga0496111_0204250
684 Ga0496111_0615217
685 Ga0496112_0006933
686 Ga0496112_1441881
687 Ga0496113_0057695
688 Ga0496113_0263737
689 Ga0496114_0066224
690 Ga0496114_0089077
691 Ga0496114_0235249
692 Ga0496115_0064691
693 Ga0496115_1059851
694 Ga0501299_019578
695 Ga0501031_0049176
696 Ga0501036_0411864
697 Ga0501038_0016773
698 Ga0501038_0581780
699 Ga0501039_0004158
700 Ga0501040_0151179
701 Ga0501040_0515231
702 Ga0501042_0325952
703 Ga0501042_0595514
704 Ga0501042_0743300
705 Ga0501042_1232992
706 Ga0501043_0455276
707 Ga0501067_0009197
708 Ga0501068_0040302
709 Ga0501069_0024465
710 Ga0501069_0098674
711 Ga0501070_0142781
712 Ga0501071_0054995
713 Ga0501071_0080453
714 Ga0501072_0000911
715 Ga0501072_0199470
716 Ga0501072_0387855
717 Ga0501072_0402891
718 Ga0501074_0209124
719 Ga0501076_0020562
720 Ga0501076_0080838
721 Ga0501076_0132858
722 Ga0501076_0512930
723 Ga0501076_0561412
724 Ga0501077_0067383
725 Ga0501077_0444890
726 Ga0501079_0006391
727 Ga0501079_0247758
728 Ga0501081_0145821
729 Ga0501081_0274509
730 Ga0501083_0031111
731 Ga0501045_0004462
732 Ga0501045_0721458
733 nmdc:mga05p37_1326_c1
734 nmdc:mga05p37_674872_c1
735 nmdc:mga05p37_841512_c1
736 nmdc:mga09592_1361_c1
737 nmdc:mga08y16_18021_c1
738 nmdc:mga08y16_550885_c1
739 Ga0495601_0171824
740 Ga0501084_0050989
741 Ga0501084_0846746
742 Ga0590075_026741
743 Ga0501082_0031161
744 Ga0530510_0005556
745 Ga0530510_0085466
746 Ga0530510_0145119
747 Ga0530510_0266630
748 Ga0530510_0662926
749 Ga0530510_1080565
750 Ga0530510_1141490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

51

149

0.93

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

32

115

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.921 28 157
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.9172 37 156
1fit-assembly1.cif.gz_A fhit (fragile histidine triad protein) 0.9027 30 158
7p8p-assembly2.cif.gz_C crystal structure of fhit covalently bound to a nucleotide 0.897 30 158
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8963 36 156
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9295 34 125 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9094 36 129 3.30.428.10
3wo5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.879 1 157 3.30.428.10
af_Q9JIX3_1_149_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8524 36 158 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.851 19 156 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A371BC24-F1-model_v4 HIT family protein 0.9444 22 130 GO:0003824
AF-A0A0N7JHQ9-F1-model_v4 Restriction endonuclease subunit R 0.9362 19 130 GO:0003677
GO:0005524
GO:0016887
AF-A0A7Y8JDG5-F1-model_v4 HIT family protein 0.9312 20 131 GO:0003824
AF-A0A1F4DBC7-F1-model_v4 HIT family hydrolase 0.928 19 131 GO:0016787
AF-A0A496Y2F7-F1-model_v4 HIT family protein 0.9279 19 131 GO:0003824

Map