F427088

General Info

Members Datasets Scaffolds Average Seq Length
375 228 750 260

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10125424|Ga0307411_101254242
Length 289
Sequence MSEESRARGRSLRVLIVDDEPLARQRVEDMLRREPDVEIVGEADSGGAAVAAIRELAPDLVFLDVQMPGKTGLDVVREIGAESMPATVFVTAYDQYALQAFDVAAVDYLVKPFDDERFEQAFRRARRLLALEGLGELREQLLAVLQGAAPGGGTAPAPTQADPGPASTAAPATLPGTGYLDRIAVEMRGKVRVVPVDQIDYIAASGPYAELYVGDRRYVIRAAMQTLEERLDPRRFMRVHRSAIVRLDLVETLHRGAGGDYEVQLKGGTRLRVSRSRREALERWLGVSS

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.6
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10125424 3300032005 Bacteria 1866
2 Ga0065707_10146456 3300005295 Bacteria 1708
3 Ga0065707_10236209 3300005295 Bacteria 1171
4 Ga0070676_10029059 3300005328 Bacteria 3142
5 Ga0070683_100008354 3300005329 Bacteria 8794
6 Ga0070683_100031500 3300005329 Bacteria 4822
7 Ga0070683_100039633 3300005329 Bacteria 4326
8 Ga0070683_100163579 3300005329 Bacteria 2111
9 Ga0070690_100030948 3300005330 Bacteria 3330
10 Ga0070670_100222081 3300005331 Bacteria 1644
11 Ga0070677_10113068 3300005333 Bacteria 1215
12 Ga0068869_100024983 3300005334 Bacteria 4143
13 Ga0068868_100011071 3300005338 Bacteria 6559
14 Ga0070689_100022401 3300005340 Bacteria 4716
15 Ga0070689_100239714 3300005340 Bacteria 1493
16 Ga0070687_100002123 3300005343 Bacteria 7331
17 Ga0070687_100036749 3300005343 Bacteria 2443
18 Ga0070661_100000658 3300005344 Bacteria 25365
19 Ga0070661_100484840 3300005344 Bacteria 988
20 Ga0070692_10207982 3300005345 Bacteria 1150
21 Ga0070668_100004916 3300005347 Bacteria 9902
22 Ga0070668_100154241 3300005347 Bacteria 1860
23 Ga0070669_100002917 3300005353 Bacteria 12317
24 Ga0070669_100004251 3300005353 Bacteria 10344
25 Ga0070669_100245904 3300005353 Bacteria 1423
26 Ga0070675_100301433 3300005354 Bacteria 1412
27 Ga0070671_100082286 3300005355 Bacteria 2692
28 Ga0070671_100363669 3300005355 Bacteria 1235
29 Ga0070674_100030088 3300005356 Bacteria 3585
30 Ga0070674_100055535 3300005356 Bacteria 2743
31 Ga0070673_100022112 3300005364 Bacteria 4625
32 Ga0070673_100061493 3300005364 Bacteria 2980
33 Ga0070688_100125354 3300005365 Bacteria 1725
34 Ga0070659_100015959 3300005366 Bacteria 5632
35 Ga0070659_100049068 3300005366 Bacteria 3319
36 Ga0070659_100158099 3300005366 Bacteria 1852
37 Ga0070709_10003689 3300005434 Bacteria 8226
38 Ga0070714_100003441 3300005435 Bacteria 11793
39 Ga0070714_100149462 3300005435 Bacteria 2104
40 Ga0070714_100171819 3300005435 Bacteria 1967
41 Ga0070713_100001082 3300005436 Bacteria 17438
42 Ga0070713_100593019 3300005436 Unclassified 1052
43 Ga0070701_10042882 3300005438 Bacteria 2311
44 Ga0070701_10081270 3300005438 Bacteria 1755
45 Ga0070711_100030533 3300005439 Bacteria 3569
46 Ga0070711_100349781 3300005439 Bacteria 1188
47 Ga0070700_100005114 3300005441 Bacteria 6921
48 Ga0070700_100101901 3300005441 Bacteria 1893
49 Ga0070694_100080058 3300005444 Bacteria 2269
50 Ga0070663_100218738 3300005455 Bacteria 1494
51 Ga0070678_100450268 3300005456 Bacteria 1127
52 Ga0070662_100004827 3300005457 Bacteria 8545
53 Ga0070662_100156704 3300005457 Bacteria 1778
54 Ga0070662_100335521 3300005457 Bacteria 1236
55 Ga0070681_10005624 3300005458 Bacteria 12108
56 Ga0070681_10021758 3300005458 Bacteria 6430
57 Ga0070681_10238807 3300005458 Bacteria 1731
58 Ga0068867_100006180 3300005459 Bacteria 8480
59 Ga0070685_10004381 3300005466 Bacteria 7129
60 Ga0070685_10075163 3300005466 Bacteria 2012
61 Ga0070679_100054050 3300005530 Bacteria 3998
62 Ga0070679_100106132 3300005530 Bacteria 2795
63 Ga0070684_100018883 3300005535 Bacteria 5691
64 Ga0070684_100073564 3300005535 Bacteria 3011
65 Ga0070684_100095922 3300005535 Bacteria 2643
66 Ga0068853_100039833 3300005539 Bacteria 4008
67 Ga0070672_100008811 3300005543 Bacteria 6927
68 Ga0070672_100149020 3300005543 Bacteria 1934
69 Ga0070672_100191764 3300005543 Bacteria 1706
70 Ga0070686_100096287 3300005544 Bacteria 1990
71 Ga0070695_100003322 3300005545 Bacteria 9408
72 Ga0070665_100477218 3300005548 Unclassified 1258
73 Ga0068855_100024717 3300005563 Bacteria 7187
74 Ga0070664_100013040 3300005564 Bacteria 6762
75 Ga0070664_100073871 3300005564 Bacteria 2926
76 Ga0068857_100008949 3300005577 Bacteria 8674
77 Ga0068857_100010819 3300005577 Bacteria 7943
78 Ga0068854_100051164 3300005578 Bacteria 2959
79 Ga0068852_100039362 3300005616 Bacteria 3980
80 Ga0068859_100114286 3300005617 Bacteria 2763
81 Ga0068859_100145220 3300005617 Bacteria 2447
82 Ga0068859_100845367 3300005617 Bacteria 1001
83 Ga0068864_100075896 3300005618 Bacteria 2935
84 Ga0068864_100523756 3300005618 Bacteria 1143
85 Ga0068861_100017508 3300005719 Bacteria 5091
86 Ga0068861_100110452 3300005719 Bacteria 2202
87 Ga0068851_10015131 3300005834 Bacteria 3673
88 Ga0068870_10025080 3300005840 Bacteria 2957
89 Ga0068863_100021644 3300005841 Bacteria 6133
90 Ga0068860_100031499 3300005843 Bacteria 5098
91 Ga0068862_100008875 3300005844 Bacteria 8324
92 Ga0081540_1018739 3300005983 Bacteria 4233
93 Ga0070717_10005238 3300006028 Bacteria 9449
94 Ga0070717_10064892 3300006028 Unclassified 3034
95 Ga0070712_100020010 3300006175 Bacteria 4376
96 Ga0097621_100260228 3300006237 Bacteria 1522
97 Ga0075428_100144623 3300006844 Bacteria 2585
98 Ga0075428_100161001 3300006844 Bacteria 2436
99 Ga0075428_100177532 3300006844 Bacteria 2306
100 Ga0075428_100347558 3300006844 Bacteria 1592
101 Ga0075430_100010878 3300006846 Bacteria 7708
102 Ga0075430_100034847 3300006846 Bacteria 4273
103 Ga0075430_100042479 3300006846 Bacteria 3844
104 Ga0075430_100104475 3300006846 Bacteria 2365
105 Ga0075431_100004906 3300006847 Bacteria 13176
106 Ga0075431_100042407 3300006847 Bacteria 4693
107 Ga0075431_100366045 3300006847 Bacteria 1447
108 Ga0075431_100744596 3300006847 Unclassified 956
109 Ga0075433_10006693 3300006852 Bacteria 9127
110 Ga0075433_10127303 3300006852 Bacteria 2262
111 Ga0075434_100020452 3300006871 Bacteria 6422
112 Ga0075434_100036369 3300006871 Bacteria 4871
113 Ga0075429_100075299 3300006880 Bacteria 2940
114 Ga0075429_100117757 3300006880 Bacteria 2322
115 Ga0075429_100231333 3300006880 Bacteria 1619
116 Ga0068865_100004211 3300006881 Bacteria 8668
117 Ga0068865_100009757 3300006881 Bacteria 5957
118 Ga0097620_100114279 3300006931 Bacteria 2763
119 Ga0097620_100145229 3300006931 Bacteria 2447
120 Ga0097620_100845384 3300006931 Bacteria 1001
121 Ga0075435_100252263 3300007076 Bacteria 1502
122 Ga0111539_10018156 3300009094 Bacteria 8713
123 Ga0111539_10026578 3300009094 Bacteria 7077
124 Ga0111539_10533628 3300009094 Bacteria 1367
125 Ga0114129_10037545 3300009147 Bacteria 6838
126 Ga0114129_10058753 3300009147 Bacteria 5379
127 Ga0105241_10715890 3300009174 Bacteria 915
128 Ga0105242_10021590 3300009176 Bacteria 5056
129 Ga0105248_10016291 3300009177 Bacteria 8183
130 Ga0105248_10338457 3300009177 Bacteria 1694
131 Ga0105249_10005088 3300009553 Bacteria 11328
132 Ga0105249_10042477 3300009553 Bacteria 4135
133 Ga0099796_10035295 3300010159 Bacteria 1658
134 Ga0105239_10032587 3300010375 Bacteria 5726
135 Ga0157371_10010787 3300013102 Bacteria 7093
136 Ga0157369_10212926 3300013105 Bacteria 2025
137 Ga0157369_10555685 3300013105 Bacteria 1186
138 Ga0157374_10482544 3300013296 Bacteria 1243
139 Ga0157378_10016456 3300013297 Bacteria 6476
140 Ga0157378_10043718 3300013297 Bacteria 3977
141 Ga0163162_10020491 3300013306 Bacteria 6499
142 Ga0163162_10084263 3300013306 Bacteria 3254
143 Ga0157372_10141383 3300013307 Bacteria 2773
144 Ga0157375_10075403 3300013308 Bacteria 3397
145 Ga0157375_10103879 3300013308 Bacteria 2929
146 Ga0157375_10448167 3300013308 Bacteria 1456
147 Ga0163163_10017250 3300014325 Bacteria 6730
148 Ga0157377_10006742 3300014745 Bacteria 5500
149 Ga0157377_10285218 3300014745 Bacteria 1084
150 Ga0157379_10014917 3300014968 Bacteria 6815
151 Ga0163161_10004622 3300017792 Bacteria 9584
152 Ga0163161_10388229 3300017792 Bacteria 1117
153 Ga0207697_10000898 3300025315 Bacteria 16842
154 Ga0207697_10049018 3300025315 Bacteria 1743
155 Ga0207642_10147482 3300025899 Bacteria 1248
156 Ga0207699_10006006 3300025906 Bacteria 5845
157 Ga0207645_10000447 3300025907 Bacteria 34363
158 Ga0207643_10004635 3300025908 Bacteria 7386
159 Ga0207643_10026156 3300025908 Bacteria 3229
160 Ga0207707_10010300 3300025912 Bacteria 8113
161 Ga0207707_10097608 3300025912 Bacteria 2568
162 Ga0207693_10035065 3300025915 Bacteria 3957
163 Ga0207663_10162122 3300025916 Bacteria 1580
164 Ga0207663_10283836 3300025916 Bacteria 1231
165 Ga0207662_10002824 3300025918 Bacteria 8781
166 Ga0207662_10010675 3300025918 Bacteria 5079
167 Ga0207657_10055370 3300025919 Bacteria 3426
168 Ga0207649_10025043 3300025920 Bacteria 3474
169 Ga0207649_10049965 3300025920 Bacteria 2585
170 Ga0207649_10402050 3300025920 Bacteria 1025
171 Ga0207652_10085300 3300025921 Bacteria 2768
172 Ga0207681_10013107 3300025923 Bacteria 5125
173 Ga0207681_10022118 3300025923 Bacteria 4050
174 Ga0207650_10156376 3300025925 Bacteria 1803
175 Ga0207700_10014095 3300025928 Bacteria 5227
176 Ga0207700_10259848 3300025928 Bacteria 1486
177 Ga0207664_10003450 3300025929 Bacteria 10538
178 Ga0207664_10158640 3300025929 Bacteria 1928
179 Ga0207664_10184495 3300025929 Bacteria 1793
180 Ga0207690_10022161 3300025932 Bacteria 3948
181 Ga0207690_10089033 3300025932 Bacteria 2176
182 Ga0207690_10131211 3300025932 Bacteria 1834
183 Ga0207706_10000440 3300025933 Bacteria 44385
184 Ga0207706_10253495 3300025933 Bacteria 1537
185 Ga0207686_10057303 3300025934 Bacteria 2452
186 Ga0207670_10034068 3300025936 Bacteria 3287
187 Ga0207670_10206348 3300025936 Bacteria 1496
188 Ga0207704_10025063 3300025938 Bacteria 3249
189 Ga0207704_10325378 3300025938 Bacteria 1187
190 Ga0207665_10093593 3300025939 Bacteria 2087
191 Ga0207691_10000391 3300025940 Bacteria 43895
192 Ga0207691_10005640 3300025940 Bacteria 12104
193 Ga0207691_10020003 3300025940 Bacteria 6333
194 Ga0207711_10105236 3300025941 Bacteria 2502
195 Ga0207711_10329910 3300025941 Bacteria 1411
196 Ga0207689_10001883 3300025942 Bacteria 19844
197 Ga0207661_10008510 3300025944 Bacteria 7334
198 Ga0207661_10047477 3300025944 Bacteria 3409
199 Ga0207661_10103415 3300025944 Bacteria 2397
200 Ga0207661_10286820 3300025944 Bacteria 1472
201 Ga0207679_10003534 3300025945 Bacteria 9676
202 Ga0207679_10006662 3300025945 Bacteria 7314
203 Ga0207667_10059539 3300025949 Bacteria 3999
204 Ga0207651_10047118 3300025960 Bacteria 2904
205 Ga0207651_10095293 3300025960 Bacteria 2191
206 Ga0207651_10263966 3300025960 Bacteria 1415
207 Ga0207712_10002148 3300025961 Bacteria 12877
208 Ga0207712_10025839 3300025961 Bacteria 3906
209 Ga0207668_10033323 3300025972 Bacteria 3411
210 Ga0207668_10063571 3300025972 Bacteria 2604
211 Ga0207658_10054117 3300025986 Bacteria 2968
212 Ga0207658_10236065 3300025986 Bacteria 1546
213 Ga0207658_10389355 3300025986 Bacteria 1223
214 Ga0207677_10017953 3300026023 Bacteria 4235
215 Ga0207703_10033286 3300026035 Bacteria 4084
216 Ga0207639_10544323 3300026041 Bacteria 1065
217 Ga0207678_10012784 3300026067 Bacteria 7371
218 Ga0207708_10047063 3300026075 Bacteria 3285
219 Ga0207708_10075364 3300026075 Bacteria 2587
220 Ga0207641_10033228 3300026088 Bacteria 4286
221 Ga0207641_10503299 3300026088 Bacteria 1177
222 Ga0207648_10006740 3300026089 Bacteria 11393
223 Ga0207648_10338226 3300026089 Bacteria 1355
224 Ga0207674_10000530 3300026116 Bacteria 50056
225 Ga0207674_10001224 3300026116 Bacteria 33464
226 Ga0207674_10011434 3300026116 Bacteria 9973
227 Ga0207674_10012937 3300026116 Bacteria 9306
228 Ga0207675_100000151 3300026118 Bacteria 60922
229 Ga0207675_100029253 3300026118 Bacteria 5133
230 Ga0207683_10195025 3300026121 Bacteria 1840
231 Ga0207698_10018906 3300026142 Bacteria 4705
232 Ga0207698_10125050 3300026142 Bacteria 2185
233 Ga0207428_10193769 3300027907 Bacteria 1531
234 Ga0268265_10002627 3300028380 Bacteria 13355
235 Ga0268265_10020821 3300028380 Bacteria 4583
236 Ga0268264_10040305 3300028381 Bacteria 3859
237 Ga0307408_100000668 3300031548 Bacteria 28582
238 Ga0307408_100196565 3300031548 Bacteria 1629
239 Ga0307408_100545413 3300031548 Bacteria 1022
240 Ga0316575_10025878 3300031665 Bacteria 2278
241 Ga0316576_10513469 3300031727 Bacteria 881
242 Ga0307413_10150142 3300031824 Bacteria 1622
243 Ga0307410_10030551 3300031852 Bacteria 3444
244 Ga0307410_10033412 3300031852 Bacteria 3321
245 Ga0307406_10001041 3300031901 Bacteria 15476
246 Ga0307407_10221210 3300031903 Bacteria 1280
247 Ga0307412_10005914 3300031911 Bacteria 6893
248 Ga0307412_10012290 3300031911 Bacteria 4986
249 Ga0307412_10213286 3300031911 Bacteria 1475
250 Ga0307409_100021007 3300031995 Bacteria 4465
251 Ga0307409_100335448 3300031995 Bacteria 1420
252 Ga0307409_100632013 3300031995 Bacteria 1062
253 Ga0307416_100018072 3300032002 Bacteria 4955
254 Ga0307416_100101684 3300032002 Bacteria 2504
255 Ga0307416_100161499 3300032002 Bacteria 2072
256 Ga0307414_10310321 3300032004 Bacteria 1338
257 Ga0307414_10540364 3300032004 Bacteria 1037
258 Ga0307415_100007102 3300032126 Bacteria 6098
259 Ga0307415_100012951 3300032126 Bacteria 4848
260 Ga0373926_0001136 3300035083 Bacteria 7914
261 Ga0373934_0007897 3300035086 Unclassified 3959
262 Ga0373944_0003926 3300035089 Bacteria 3851
263 Ga0373923_0030257 3300035111 Bacteria 2176
264 Ga0373953_0115061 3300035117 Bacteria 1139
265 Ga0373956_0003980 3300035119 Bacteria 5937
266 Ga0373943_0036456 3300035170 Bacteria 2355
267 Ga0373943_0051809 3300035170 Bacteria 2022
268 Ga0373946_0000198 3300035171 Bacteria 18492
269 Ga0373955_0040094 3300035172 Bacteria 2502
270 Ga0373955_0144243 3300035172 Bacteria 1398
271 Ga0373924_0071776 3300035410 Bacteria 1461
272 Ga0373935_0014869 3300035692 Bacteria 4700
273 Ga0373927_0009197 3300035695 Bacteria 6629
274 Ga0373933_0011208 3300035724 Bacteria 4933
275 Ga0373947_0014277 3300035725 Bacteria 4555
276 Ga0373937_0001382 3300036401 Bacteria 20286
277 Ga0373937_0107170 3300036401 Bacteria 2598
278 Ga0373925_0008597 3300037068 Bacteria 7439
279 Ga0395899_0015926 3300037312 Bacteria 5734
280 Ga0395905_0015017 3300037471 Bacteria 7381
281 Ga0395905_0088420 3300037471 Bacteria 2904
282 Ga0395905_0127271 3300037471 Bacteria 2395
283 Ga0395901_0055345 3300038443 Bacteria 4125
284 Ga0395901_0152860 3300038443 Bacteria 2424
285 Ga0436365_0101571 3300039437 Bacteria 1271
286 Ga0451577_0075286 3300042876 Bacteria 3010
287 Ga0466966_0258157 3300044684 Bacteria 1049
288 Ga0453684_0211622 3300044712 Bacteria 2253
289 Ga0466959_0195208 3300045049 Bacteria 1411
290 Ga0451576_0056950 3300045051 Bacteria 4086
291 Ga0451576_0291156 3300045051 Bacteria 1707
292 Ga0466967_0046906 3300045976 Bacteria 3765
293 Ga0466967_0059009 3300045976 Bacteria 3394
294 Ga0466967_0832528 3300045976 Bacteria 917
295 Ga0495592_0054219 3300046454 Bacteria 2971
296 Ga0495603_0014534 3300046455 Bacteria 4762
297 Ga0495629_0009130 3300046459 Bacteria 7263
298 Ga0495651_0056979 3300046462 Bacteria 3000
299 Ga0495653_0017562 3300046463 Bacteria 5817
300 Ga0495580_0031781 3300046472 Bacteria 3812
301 Ga0495582_0011933 3300046473 Bacteria 4785
302 Ga0495639_0009961 3300046475 Bacteria 4084
303 Ga0495594_0261183 3300046499 Bacteria 986
304 Ga0495608_0016525 3300046511 Bacteria 5106
305 Ga0495620_0000587 3300046515 Bacteria 22777
306 Ga0495628_0017610 3300046516 Bacteria 5942
307 Ga0495630_0010641 3300046517 Bacteria 6641
308 Ga0495665_0000482 3300046531 Bacteria 20066
309 Ga0495586_0028527 3300046535 Bacteria 2986
310 Ga0495586_0179301 3300046535 Bacteria 1198
311 Ga0495587_0011752 3300046536 Bacteria 5538
312 Ga0495667_0017547 3300046559 Bacteria 4834
313 Ga0495635_0001486 3300046663 Bacteria 15684
314 Ga0495588_0000941 3300046674 Bacteria 12699
315 Ga0495588_0006614 3300046674 Bacteria 5231
316 Ga0495657_0025648 3300046675 Bacteria 4183
317 Ga0495599_0013796 3300046678 Bacteria 4999
318 Ga0495623_0000171 3300046679 Bacteria 40554
319 Ga0495623_0042670 3300046679 Bacteria 2889
320 Ga0495658_0002658 3300046683 Bacteria 8990
321 Ga0495613_0026265 3300046689 Bacteria 4339
322 Ga0495613_0216335 3300046689 Bacteria 1346
323 Ga0495670_0228624 3300046691 Bacteria 989
324 Ga0495600_0000597 3300046809 Bacteria 18664
325 Ga0495581_0170112 3300047315 Bacteria 1274
326 Ga0495604_0010744 3300047317 Bacteria 7269
327 Ga0495604_0075196 3300047317 Bacteria 2544
328 Ga0495674_0018602 3300047319 Bacteria 6467
329 Ga0495672_0006853 3300047320 Bacteria 8700
330 Ga0495680_0014780 3300047322 Bacteria 6748
331 Ga0495675_0016273 3300047444 Bacteria 4704
332 Ga0495684_0000583 3300047471 Bacteria 29477
333 Ga0495684_0041991 3300047471 Bacteria 3504
334 Ga0495593_0012312 3300047673 Bacteria 4888
335 Ga0495593_0065867 3300047673 Bacteria 1889
336 Ga0495602_0021512 3300048088 Bacteria 6346
337 Ga0495614_0000289 3300048089 Bacteria 19831
338 Ga0496106_0140280 3300048909 Bacteria 1901
339 Ga0496108_0327463 3300048911 Bacteria 1336
340 Ga0496109_0537721 3300048912 Bacteria 1102
341 Ga0496112_0179823 3300048915 Bacteria 2079
342 Ga0496114_0049704 3300048917 Unclassified 3490
343 Ga0496115_0018315 3300048918 Bacteria 5374
344 Ga0501046_0068018 3300049580 Bacteria 2773
345 Ga0501047_0001398 3300049581 Bacteria 23652
346 Ga0501072_0130340 3300049588 Bacteria 2004
347 Ga0501035_0000350 3300049822 Bacteria 52924
348 Ga0501044_0002550 3300049823 Bacteria 20752
349 nmdc:mga05p37_787346_c1 3300050507 Bacteria 1042
350 nmdc:mga05p37_91572_c1 3300050507 Bacteria 3747
351 nmdc:mga05p37_92751_c1 3300050507 Bacteria 3721
352 nmdc:mga09592_103241_c1 3300050508 Bacteria 2442
353 nmdc:mga09592_142132_c1 3300050508 Bacteria 2069
354 nmdc:mga09592_144115_c1 3300050508 Bacteria 2054
355 nmdc:mga09592_38708_c1 3300050508 Bacteria 4003
356 nmdc:mga0qj67_12703_c1 3300050509 Bacteria 6351
357 nmdc:mga0qj67_164028_c1 3300050509 Bacteria 1804
358 nmdc:mga0qj67_346726_c1 3300050509 Bacteria 1201
359 nmdc:mga0qj67_54322_c1 3300050509 Bacteria 3172
360 nmdc:mga06r32_21603_c1 3300050510 Bacteria 5942
361 nmdc:mga06r32_331026_c1 3300050510 Bacteria 1508
362 nmdc:mga06r32_9102_c1 3300050510 Bacteria 8950
363 nmdc:mga06r32_9466_c1 3300050510 Bacteria 8793
364 nmdc:mga08y16_148006_c1 3300050511 Bacteria 2441
365 nmdc:mga08y16_32615_c1 3300050511 Bacteria 5474
366 nmdc:mga08y16_764857_c1 3300050511 Bacteria 961
367 nmdc:mga0n895_1875_c1 3300050512 Bacteria 16066
368 nmdc:mga0n895_205615_c1 3300050512 Bacteria 1999
369 nmdc:mga0a205_55548_c1 3300050515 Bacteria 3824
370 nmdc:mga0a205_7262_c1 3300050515 Bacteria 10018
371 nmdc:mga0a205_80725_c1 3300050515 Bacteria 3142
372 Ga0495601_0217315 3300053077 Bacteria 1248
373 Ga0495612_0150547 3300053078 Bacteria 1012
374 Ga0495595_0028140 3300053084 Bacteria 2509
375 Ga0590075_028305 3300059424 Unclassified 1415
376 Ga0307411_10125424
377 Ga0065707_10146456
378 Ga0065707_10236209
379 Ga0070676_10029059
380 Ga0070683_100008354
381 Ga0070683_100031500
382 Ga0070683_100039633
383 Ga0070683_100163579
384 Ga0070690_100030948
385 Ga0070670_100222081
386 Ga0070677_10113068
387 Ga0068869_100024983
388 Ga0068868_100011071
389 Ga0070689_100022401
390 Ga0070689_100239714
391 Ga0070687_100002123
392 Ga0070687_100036749
393 Ga0070661_100000658
394 Ga0070661_100484840
395 Ga0070692_10207982
396 Ga0070668_100004916
397 Ga0070668_100154241
398 Ga0070669_100002917
399 Ga0070669_100004251
400 Ga0070669_100245904
401 Ga0070675_100301433
402 Ga0070671_100082286
403 Ga0070671_100363669
404 Ga0070674_100030088
405 Ga0070674_100055535
406 Ga0070673_100022112
407 Ga0070673_100061493
408 Ga0070688_100125354
409 Ga0070659_100015959
410 Ga0070659_100049068
411 Ga0070659_100158099
412 Ga0070709_10003689
413 Ga0070714_100003441
414 Ga0070714_100149462
415 Ga0070714_100171819
416 Ga0070713_100001082
417 Ga0070713_100593019
418 Ga0070701_10042882
419 Ga0070701_10081270
420 Ga0070711_100030533
421 Ga0070711_100349781
422 Ga0070700_100005114
423 Ga0070700_100101901
424 Ga0070694_100080058
425 Ga0070663_100218738
426 Ga0070678_100450268
427 Ga0070662_100004827
428 Ga0070662_100156704
429 Ga0070662_100335521
430 Ga0070681_10005624
431 Ga0070681_10021758
432 Ga0070681_10238807
433 Ga0068867_100006180
434 Ga0070685_10004381
435 Ga0070685_10075163
436 Ga0070679_100054050
437 Ga0070679_100106132
438 Ga0070684_100018883
439 Ga0070684_100073564
440 Ga0070684_100095922
441 Ga0068853_100039833
442 Ga0070672_100008811
443 Ga0070672_100149020
444 Ga0070672_100191764
445 Ga0070686_100096287
446 Ga0070695_100003322
447 Ga0070665_100477218
448 Ga0068855_100024717
449 Ga0070664_100013040
450 Ga0070664_100073871
451 Ga0068857_100008949
452 Ga0068857_100010819
453 Ga0068854_100051164
454 Ga0068852_100039362
455 Ga0068859_100114286
456 Ga0068859_100145220
457 Ga0068859_100845367
458 Ga0068864_100075896
459 Ga0068864_100523756
460 Ga0068861_100017508
461 Ga0068861_100110452
462 Ga0068851_10015131
463 Ga0068870_10025080
464 Ga0068863_100021644
465 Ga0068860_100031499
466 Ga0068862_100008875
467 Ga0081540_1018739
468 Ga0070717_10005238
469 Ga0070717_10064892
470 Ga0070712_100020010
471 Ga0097621_100260228
472 Ga0075428_100144623
473 Ga0075428_100161001
474 Ga0075428_100177532
475 Ga0075428_100347558
476 Ga0075430_100010878
477 Ga0075430_100034847
478 Ga0075430_100042479
479 Ga0075430_100104475
480 Ga0075431_100004906
481 Ga0075431_100042407
482 Ga0075431_100366045
483 Ga0075431_100744596
484 Ga0075433_10006693
485 Ga0075433_10127303
486 Ga0075434_100020452
487 Ga0075434_100036369
488 Ga0075429_100075299
489 Ga0075429_100117757
490 Ga0075429_100231333
491 Ga0068865_100004211
492 Ga0068865_100009757
493 Ga0097620_100114279
494 Ga0097620_100145229
495 Ga0097620_100845384
496 Ga0075435_100252263
497 Ga0111539_10018156
498 Ga0111539_10026578
499 Ga0111539_10533628
500 Ga0114129_10037545
501 Ga0114129_10058753
502 Ga0105241_10715890
503 Ga0105242_10021590
504 Ga0105248_10016291
505 Ga0105248_10338457
506 Ga0105249_10005088
507 Ga0105249_10042477
508 Ga0099796_10035295
509 Ga0105239_10032587
510 Ga0157371_10010787
511 Ga0157369_10212926
512 Ga0157369_10555685
513 Ga0157374_10482544
514 Ga0157378_10016456
515 Ga0157378_10043718
516 Ga0163162_10020491
517 Ga0163162_10084263
518 Ga0157372_10141383
519 Ga0157375_10075403
520 Ga0157375_10103879
521 Ga0157375_10448167
522 Ga0163163_10017250
523 Ga0157377_10006742
524 Ga0157377_10285218
525 Ga0157379_10014917
526 Ga0163161_10004622
527 Ga0163161_10388229
528 Ga0207697_10000898
529 Ga0207697_10049018
530 Ga0207642_10147482
531 Ga0207699_10006006
532 Ga0207645_10000447
533 Ga0207643_10004635
534 Ga0207643_10026156
535 Ga0207707_10010300
536 Ga0207707_10097608
537 Ga0207693_10035065
538 Ga0207663_10162122
539 Ga0207663_10283836
540 Ga0207662_10002824
541 Ga0207662_10010675
542 Ga0207657_10055370
543 Ga0207649_10025043
544 Ga0207649_10049965
545 Ga0207649_10402050
546 Ga0207652_10085300
547 Ga0207681_10013107
548 Ga0207681_10022118
549 Ga0207650_10156376
550 Ga0207700_10014095
551 Ga0207700_10259848
552 Ga0207664_10003450
553 Ga0207664_10158640
554 Ga0207664_10184495
555 Ga0207690_10022161
556 Ga0207690_10089033
557 Ga0207690_10131211
558 Ga0207706_10000440
559 Ga0207706_10253495
560 Ga0207686_10057303
561 Ga0207670_10034068
562 Ga0207670_10206348
563 Ga0207704_10025063
564 Ga0207704_10325378
565 Ga0207665_10093593
566 Ga0207691_10000391
567 Ga0207691_10005640
568 Ga0207691_10020003
569 Ga0207711_10105236
570 Ga0207711_10329910
571 Ga0207689_10001883
572 Ga0207661_10008510
573 Ga0207661_10047477
574 Ga0207661_10103415
575 Ga0207661_10286820
576 Ga0207679_10003534
577 Ga0207679_10006662
578 Ga0207667_10059539
579 Ga0207651_10047118
580 Ga0207651_10095293
581 Ga0207651_10263966
582 Ga0207712_10002148
583 Ga0207712_10025839
584 Ga0207668_10033323
585 Ga0207668_10063571
586 Ga0207658_10054117
587 Ga0207658_10236065
588 Ga0207658_10389355
589 Ga0207677_10017953
590 Ga0207703_10033286
591 Ga0207639_10544323
592 Ga0207678_10012784
593 Ga0207708_10047063
594 Ga0207708_10075364
595 Ga0207641_10033228
596 Ga0207641_10503299
597 Ga0207648_10006740
598 Ga0207648_10338226
599 Ga0207674_10000530
600 Ga0207674_10001224
601 Ga0207674_10011434
602 Ga0207674_10012937
603 Ga0207675_100000151
604 Ga0207675_100029253
605 Ga0207683_10195025
606 Ga0207698_10018906
607 Ga0207698_10125050
608 Ga0207428_10193769
609 Ga0268265_10002627
610 Ga0268265_10020821
611 Ga0268264_10040305
612 Ga0307408_100000668
613 Ga0307408_100196565
614 Ga0307408_100545413
615 Ga0316575_10025878
616 Ga0316576_10513469
617 Ga0307413_10150142
618 Ga0307410_10030551
619 Ga0307410_10033412
620 Ga0307406_10001041
621 Ga0307407_10221210
622 Ga0307412_10005914
623 Ga0307412_10012290
624 Ga0307412_10213286
625 Ga0307409_100021007
626 Ga0307409_100335448
627 Ga0307409_100632013
628 Ga0307416_100018072
629 Ga0307416_100101684
630 Ga0307416_100161499
631 Ga0307414_10310321
632 Ga0307414_10540364
633 Ga0307415_100007102
634 Ga0307415_100012951
635 Ga0373926_0001136
636 Ga0373934_0007897
637 Ga0373944_0003926
638 Ga0373923_0030257
639 Ga0373953_0115061
640 Ga0373956_0003980
641 Ga0373943_0036456
642 Ga0373943_0051809
643 Ga0373946_0000198
644 Ga0373955_0040094
645 Ga0373955_0144243
646 Ga0373924_0071776
647 Ga0373935_0014869
648 Ga0373927_0009197
649 Ga0373933_0011208
650 Ga0373947_0014277
651 Ga0373937_0001382
652 Ga0373937_0107170
653 Ga0373925_0008597
654 Ga0395899_0015926
655 Ga0395905_0015017
656 Ga0395905_0088420
657 Ga0395905_0127271
658 Ga0395901_0055345
659 Ga0395901_0152860
660 Ga0436365_0101571
661 Ga0451577_0075286
662 Ga0466966_0258157
663 Ga0453684_0211622
664 Ga0466959_0195208
665 Ga0451576_0056950
666 Ga0451576_0291156
667 Ga0466967_0046906
668 Ga0466967_0059009
669 Ga0466967_0832528
670 Ga0495592_0054219
671 Ga0495603_0014534
672 Ga0495629_0009130
673 Ga0495651_0056979
674 Ga0495653_0017562
675 Ga0495580_0031781
676 Ga0495582_0011933
677 Ga0495639_0009961
678 Ga0495594_0261183
679 Ga0495608_0016525
680 Ga0495620_0000587
681 Ga0495628_0017610
682 Ga0495630_0010641
683 Ga0495665_0000482
684 Ga0495586_0028527
685 Ga0495586_0179301
686 Ga0495587_0011752
687 Ga0495667_0017547
688 Ga0495635_0001486
689 Ga0495588_0000941
690 Ga0495588_0006614
691 Ga0495657_0025648
692 Ga0495599_0013796
693 Ga0495623_0000171
694 Ga0495623_0042670
695 Ga0495658_0002658
696 Ga0495613_0026265
697 Ga0495613_0216335
698 Ga0495670_0228624
699 Ga0495600_0000597
700 Ga0495581_0170112
701 Ga0495604_0010744
702 Ga0495604_0075196
703 Ga0495674_0018602
704 Ga0495672_0006853
705 Ga0495680_0014780
706 Ga0495675_0016273
707 Ga0495684_0000583
708 Ga0495684_0041991
709 Ga0495593_0012312
710 Ga0495593_0065867
711 Ga0495602_0021512
712 Ga0495614_0000289
713 Ga0496106_0140280
714 Ga0496108_0327463
715 Ga0496109_0537721
716 Ga0496112_0179823
717 Ga0496114_0049704
718 Ga0496115_0018315
719 Ga0501046_0068018
720 Ga0501047_0001398
721 Ga0501072_0130340
722 Ga0501035_0000350
723 Ga0501044_0002550
724 nmdc:mga05p37_787346_c1
725 nmdc:mga05p37_91572_c1
726 nmdc:mga05p37_92751_c1
727 nmdc:mga09592_103241_c1
728 nmdc:mga09592_142132_c1
729 nmdc:mga09592_144115_c1
730 nmdc:mga09592_38708_c1
731 nmdc:mga0qj67_12703_c1
732 nmdc:mga0qj67_164028_c1
733 nmdc:mga0qj67_346726_c1
734 nmdc:mga0qj67_54322_c1
735 nmdc:mga06r32_21603_c1
736 nmdc:mga06r32_331026_c1
737 nmdc:mga06r32_9102_c1
738 nmdc:mga06r32_9466_c1
739 nmdc:mga08y16_148006_c1
740 nmdc:mga08y16_32615_c1
741 nmdc:mga08y16_764857_c1
742 nmdc:mga0n895_1875_c1
743 nmdc:mga0n895_205615_c1
744 nmdc:mga0a205_55548_c1
745 nmdc:mga0a205_7262_c1
746 nmdc:mga0a205_80725_c1
747 Ga0495601_0217315
748 Ga0495612_0150547
749 Ga0495595_0028140
750 Ga0590075_028305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

189

286

0.97

PF00072

Response_reg

Response regulator receiver domain

14

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swf-assembly1.cif.gz_A selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus 0.8995 7 127
5f64-assembly2.cif.gz_C putative positive transcription regulator (sensor evgs) from shigella flexneri 0.8901 6 105
4qyw-assembly1.cif.gz_A structure of phosphono-chey from t.maritima 0.8857 6 119
3d6w-assembly1.cif.gz_A lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. 0.8824 155 262
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.8816 8 125
ID Description Score Start End Superfamily
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9316 7 120 3.40.50.2300
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9191 155 223 2.40.50.40
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.916 6 87 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9065 6 87 3.40.50.2300
af_Q2FVQ7_36_146_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9026 153 260 2.40.50.1020
ID Description Score Start End GO Terms
AF-A0A4Q3FDX0-F1-model_v4 Response regulator 0.9644 8 86 GO:0000160
AF-A0A6B3CWD3-F1-model_v4 LytTR family transcriptional regulator 0.9465 158 258 GO:0000156
GO:0003677
AF-A0A7C7U9T4-F1-model_v4 Response regulator 0.9441 1 81 GO:0000160
AF-A0A7C7WMN0-F1-model_v4 LytTR family transcriptional regulator 0.9424 169 262 GO:0000156
GO:0003677
AF-A0A3C0FRB1-F1-model_v4 DNA-binding response regulator 0.9405 1 71 GO:0000160
GO:0003677

Map