F427079

General Info

Members Datasets Scaffolds Average Seq Length
375 205 750 287

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000025|Ga0307513_1000002594
Length 328
Sequence VAAESGDGQAQPGQARLEIKKGFPRSAFGSSPSRGRHQRPGKAVELIASGLITGGIYALVALGLNLQYGLMRILNIAHGEFLMLGAYLTWMAHAVWGISPLLMVPVSFLVLMALGVLIHKLCFRRLTATSPNLDIFEARGLMVAFGLMFLVQNFASFMWGGDLRGYDYLTEPVKIGEAQFAGNKLLVFGLALLFSGALIALLRFTLLGKGVRALMQSPTGAQLVGIDTQRLHPLMFGIGLGLSGMAGCLLSMAYTITPSMGEPYTVTALIVITLGGFGSMSGALAGGLLLGVIEALGMHFTNPSLKALLSYSVFIAVLLLRPRGLFAK

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
100 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
117 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
123 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
140 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2547132374 Acidovorax radicis N35 Isolate Unclassified
189 2643221570 Acidovorax sp. Root568 Isolate Unclassified
190 2643221596 Acidovorax sp. Root70 Isolate Unclassified
191 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
192 2643221609 Acidovorax sp. Root217 Isolate Unclassified
193 2643221611 Acidovorax sp. Root219 Isolate Unclassified
194 2643221652 Acidovorax sp. Root402 Isolate Unclassified
195 2643221717 Acidovorax sp. Root267 Isolate Unclassified
196 2738541277 Variovorax sp. GV051 Isolate Unclassified
197 2738541337 Pelomonas sp. BT06 Isolate Unclassified
198 2738543012 Acidovorax sp. CF301 Isolate Unclassified
199 2738543013 Variovorax sp. BT01 Isolate Unclassified
200 2738543019 Variovorax sp. GV040 Isolate Unclassified
201 2816332133 Acidovorax radicis 2721A Isolate Unclassified
202 2842733646 Variovorax sp. R-72446 Isolate Unclassified
203 2842747753 Variovorax sp. R-72060 Isolate Unclassified
204 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
205 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 0
Isolates 4.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0.53
Rhizoplane 0.53
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10000025 3300031456 Bacteria 202918
2 JGI25158J39367_1005099 3300002739 Bacteria 1939
3 Ga0055524_1000164 3300003775 Bacteria 76259
4 Ga0055530_10010732 3300003791 Bacteria 3351
5 Ga0055540_1000015 3300003792 Bacteria 232986
6 Ga0055531_10009345 3300003794 Bacteria 5021
7 Ga0070676_10004078 3300005328 Bacteria 7682
8 Ga0070676_10063786 3300005328 Bacteria 2195
9 Ga0070690_100005303 3300005330 Bacteria 7231
10 Ga0070670_100476716 3300005331 Bacteria 1108
11 Ga0070677_10007636 3300005333 Bacteria 3618
12 Ga0070677_10013324 3300005333 Bacteria 2874
13 Ga0068869_100000911 3300005334 Bacteria 17011
14 Ga0070666_10014873 3300005335 Bacteria 4958
15 Ga0070692_10217031 3300005345 Bacteria 1128
16 Ga0070668_100322737 3300005347 Bacteria 1300
17 Ga0070675_100258136 3300005354 Bacteria 1526
18 Ga0070674_100018206 3300005356 Bacteria 4436
19 Ga0070674_100054898 3300005356 Bacteria 2757
20 Ga0070703_10026492 3300005406 Bacteria 1724
21 Ga0070705_100019068 3300005440 Bacteria 3606
22 Ga0070705_100094055 3300005440 Bacteria 1875
23 Ga0070700_100055234 3300005441 Bacteria 2485
24 Ga0070700_100299221 3300005441 Bacteria 1174
25 Ga0070694_100034400 3300005444 Bacteria 3341
26 Ga0070708_100022581 3300005445 Bacteria 5337
27 Ga0070708_100673289 3300005445 Bacteria 974
28 Ga0070662_100005569 3300005457 Bacteria 8048
29 Ga0070662_100077180 3300005457 Bacteria 2472
30 Ga0068867_100069329 3300005459 Bacteria 2633
31 Ga0070707_100032314 3300005468 Bacteria 4985
32 Ga0070707_100178439 3300005468 Bacteria 2070
33 Ga0070698_100024489 3300005471 Bacteria 6298
34 Ga0070698_100263005 3300005471 Bacteria 1657
35 Ga0070697_100015144 3300005536 Bacteria 6055
36 Ga0070697_100032063 3300005536 Bacteria 4226
37 Ga0068853_100119738 3300005539 Bacteria 2347
38 Ga0070672_100030037 3300005543 Bacteria 4079
39 Ga0070695_100004959 3300005545 Bacteria 7848
40 Ga0070665_100466603 3300005548 Bacteria 1273
41 Ga0068854_100265062 3300005578 Bacteria 1377
42 Ga0068852_100030704 3300005616 Bacteria 4427
43 Ga0068866_10008567 3300005718 Bacteria 4317
44 Ga0068861_100031001 3300005719 Bacteria 3923
45 Ga0068858_100012058 3300005842 Bacteria 8146
46 Ga0068862_100021578 3300005844 Bacteria 5383
47 Ga0068862_100367291 3300005844 Bacteria 1339
48 Ga0081455_10000492 3300005937 Bacteria 51262
49 Ga0081538_10050367 3300005981 Bacteria 2515
50 Ga0075365_10136034 3300006038 Bacteria 1703
51 Ga0070716_100113005 3300006173 Bacteria 1686
52 Ga0075367_10100801 3300006178 Bacteria 1765
53 Ga0075366_10023834 3300006195 Bacteria 3566
54 Ga0075366_10111668 3300006195 Bacteria 1644
55 Ga0075428_100020012 3300006844 Bacteria 7412
56 Ga0075428_100119399 3300006844 Bacteria 2871
57 Ga0075430_100011746 3300006846 Bacteria 7455
58 Ga0075430_100084003 3300006846 Bacteria 2667
59 Ga0075430_100145562 3300006846 Bacteria 1973
60 Ga0075431_100007367 3300006847 Bacteria 10957
61 Ga0075431_100007445 3300006847 Bacteria 10904
62 Ga0075431_100034771 3300006847 Bacteria 5191
63 Ga0075433_10000967 3300006852 Bacteria 20371
64 Ga0075434_100457243 3300006871 Bacteria 1298
65 Ga0075429_100004641 3300006880 Bacteria 11814
66 Ga0075429_100120227 3300006880 Bacteria 2296
67 Ga0075429_100141383 3300006880 Bacteria 2107
68 Ga0075429_100225266 3300006880 Bacteria 1642
69 Ga0068865_100020081 3300006881 Bacteria 4331
70 Ga0068865_100050162 3300006881 Bacteria 2881
71 Ga0068865_100194379 3300006881 Bacteria 1571
72 Ga0075436_100084351 3300006914 Bacteria 2205
73 Ga0079104_1000173 3300006946 Bacteria 91782
74 Ga0075435_100005345 3300007076 Bacteria 8950
75 Ga0075435_100047079 3300007076 Bacteria 3461
76 Ga0075435_100210763 3300007076 Bacteria 1648
77 Ga0099794_10074417 3300007265 Bacteria 1668
78 Ga0111539_10007217 3300009094 Bacteria 14244
79 Ga0111539_10429881 3300009094 Bacteria 1537
80 Ga0114129_10012893 3300009147 Bacteria 11895
81 Ga0114129_10031049 3300009147 Bacteria 7557
82 Ga0114129_10079245 3300009147 Bacteria 4568
83 Ga0114129_10271141 3300009147 Bacteria 2270
84 Ga0105242_10137636 3300009176 Bacteria 2115
85 Ga0105249_10059425 3300009553 Bacteria 3506
86 Ga0105249_10131192 3300009553 Bacteria 2392
87 Ga0157378_10182947 3300013297 Bacteria 1972
88 Ga0163162_10251117 3300013306 Bacteria 1901
89 Ga0163162_10412445 3300013306 Bacteria 1483
90 Ga0163163_10519272 3300014325 Bacteria 1253
91 Ga0157380_10032480 3300014326 Bacteria 4016
92 Ga0157380_10034547 3300014326 Bacteria 3900
93 Ga0157380_10260370 3300014326 Bacteria 1575
94 Ga0157379_10011269 3300014968 Bacteria 7791
95 Ga0183362_10007 3300015683 Bacteria 240101
96 Ga0163161_10022133 3300017792 Bacteria 4474
97 Ga0209675_1032397 3300025291 Bacteria 1223
98 Ga0209025_1046634 3300025294 Bacteria 1780
99 Ga0209050_1000170 3300025298 Bacteria 151162
100 Ga0209050_1011108 3300025298 Bacteria 4322
101 Ga0209256_1000120 3300025299 Bacteria 167691
102 Ga0209051_1000020 3300025303 Bacteria 508628
103 Ga0209257_1000260 3300025304 Bacteria 121653
104 Ga0209257_1006418 3300025304 Bacteria 7586
105 Ga0207653_10002028 3300025885 Bacteria 6463
106 Ga0207653_10027051 3300025885 Bacteria 1840
107 Ga0207682_10008018 3300025893 Bacteria 4195
108 Ga0207682_10033150 3300025893 Bacteria 2078
109 Ga0207688_10016315 3300025901 Bacteria 4028
110 Ga0207680_10017043 3300025903 Bacteria 3829
111 Ga0207645_10002899 3300025907 Bacteria 13251
112 Ga0207645_10079036 3300025907 Bacteria 2108
113 Ga0207684_10038428 3300025910 Bacteria 4061
114 Ga0207684_10103908 3300025910 Bacteria 2429
115 Ga0207663_10029291 3300025916 Bacteria 3232
116 Ga0207662_10037587 3300025918 Bacteria 2834
117 Ga0207646_10011420 3300025922 Bacteria 8609
118 Ga0207646_10331335 3300025922 Bacteria 1375
119 Ga0207681_10005383 3300025923 Bacteria 7860
120 Ga0207681_10061739 3300025923 Bacteria 2577
121 Ga0207659_10082843 3300025926 Bacteria 2376
122 Ga0207687_10039364 3300025927 Bacteria 3236
123 Ga0207706_10020255 3300025933 Bacteria 5978
124 Ga0207686_10077617 3300025934 Bacteria 2157
125 Ga0207669_10022301 3300025937 Bacteria 3361
126 Ga0207669_10148916 3300025937 Bacteria 1636
127 Ga0207704_10005799 3300025938 Bacteria 5712
128 Ga0207704_10024130 3300025938 Bacteria 3291
129 Ga0207704_10235366 3300025938 Bacteria 1365
130 Ga0207665_10007963 3300025939 Bacteria 6997
131 Ga0207691_10051321 3300025940 Bacteria 3772
132 Ga0207711_10093296 3300025941 Bacteria 2651
133 Ga0207689_10006591 3300025942 Bacteria 10238
134 Ga0207689_10021883 3300025942 Bacteria 5377
135 Ga0207712_10013862 3300025961 Bacteria 5169
136 Ga0207668_10255111 3300025972 Bacteria 1426
137 Ga0207640_10175398 3300025981 Bacteria 1602
138 Ga0207658_10007767 3300025986 Bacteria 7308
139 Ga0207678_10137532 3300026067 Bacteria 2084
140 Ga0207708_10128881 3300026075 Bacteria 1976
141 Ga0207648_10046804 3300026089 Bacteria 3792
142 Ga0207675_100021279 3300026118 Bacteria 6040
143 Ga0207675_100084837 3300026118 Bacteria 2972
144 Ga0209281_1000292 3300027111 Bacteria 91706
145 Ga0209970_1000777 3300027614 Bacteria 5574
146 Ga0209588_1003676 3300027671 Bacteria 4264
147 Ga0209974_10005443 3300027876 Bacteria 4477
148 Ga0207428_10010100 3300027907 Bacteria 8445
149 Ga0268266_10335077 3300028379 Bacteria 1419
150 Ga0268265_10012847 3300028380 Bacteria 5685
151 Ga0268265_10162189 3300028380 Bacteria 1900
152 Ga0268264_10007115 3300028381 Bacteria 9378
153 Ga0307515_10000204 3300028794 Bacteria 145075
154 Ga0307515_10000861 3300028794 Bacteria 69808
155 Ga0307515_10036347 3300028794 Bacteria 7970
156 Ga0307515_10173895 3300028794 Bacteria 2133
157 Ga0307513_10005861 3300031456 Bacteria 16144
158 Ga0307513_10024947 3300031456 Bacteria 6943
159 Ga0307513_10122428 3300031456 Bacteria 2565
160 Ga0307516_10013448 3300031730 Bacteria 8720
161 Ga0307405_10120398 3300031731 Bacteria 1795
162 Ga0307405_10422922 3300031731 Bacteria 1049
163 Ga0307410_10073788 3300031852 Bacteria 2374
164 Ga0307406_10449826 3300031901 Bacteria 1033
165 Ga0307416_100041093 3300032002 Bacteria 3599
166 Ga0307416_100076518 3300032002 Bacteria 2805
167 Ga0307415_100119354 3300032126 Bacteria 1974
168 Ga0373939_0083172 3300035114 Bacteria 1067
169 Ga0373931_0153975 3300035691 Bacteria 1342
170 Ga0439439_0019556 3300041406 Bacteria 1682
171 Ga0439461_0039805 3300041410 Bacteria 1012
172 Ga0439431_0023401 3300041997 Bacteria 1495
173 Ga0439441_027244 3300042001 Bacteria 1089
174 Ga0439445_0005777 3300042004 Bacteria 2827
175 Ga0439449_0001760 3300042007 Bacteria 8513
176 Ga0439450_003447 3300042008 Bacteria 2613
177 Ga0439452_021818 3300042010 Bacteria 1664
178 Ga0439446_0042397 3300042156 Bacteria 1343
179 Ga0439434_0038436 3300042435 Bacteria 1467
180 Ga0439464_0004802 3300042439 Bacteria 3465
181 Ga0439464_0012338 3300042439 Bacteria 2275
182 Ga0439460_0000840 3300042461 Bacteria 6994
183 Ga0439460_0014550 3300042461 Bacteria 2069
184 Ga0451577_0001120 3300042876 Bacteria 38005
185 Ga0451577_0019443 3300042876 Bacteria 6246
186 Ga0451577_0027107 3300042876 Bacteria 5187
187 Ga0453684_0179801 3300044712 Bacteria 2484
188 Ga0453684_0253917 3300044712 Bacteria 2018
189 Ga0495580_0005119 3300046472 Bacteria 10910
190 Ga0495580_0012031 3300046472 Bacteria 6665
191 Ga0495621_0037960 3300046539 Bacteria 1678
192 Ga0495647_0113616 3300046681 Bacteria 1132
193 Ga0495615_0018305 3300048090 Bacteria 1540
194 Ga0496101_0045637 3300048904 Bacteria 3140
195 Ga0496114_0004160 3300048917 Bacteria 11195
196 Ga0496121_0027397 3300048924 Bacteria 5333
197 Ga0496124_0167629 3300048927 Bacteria 1705
198 Ga0496125_0016422 3300048928 Bacteria 7110
199 Ga0501294_005511 3300049517 Bacteria 1198
200 Ga0501298_026006 3300049521 Bacteria 1124
201 Ga0501031_0117982 3300049568 Bacteria 1734
202 Ga0501031_0195234 3300049568 Bacteria 1321
203 Ga0501033_0149741 3300049570 Bacteria 1684
204 Ga0501036_0009592 3300049572 Bacteria 7961
205 Ga0501036_0046164 3300049572 Bacteria 3689
206 Ga0501036_0056179 3300049572 Bacteria 3335
207 Ga0501036_0072853 3300049572 Bacteria 2904
208 Ga0501036_0471760 3300049572 Bacteria 1045
209 Ga0501037_0048674 3300049573 Bacteria 3105
210 Ga0501037_0267004 3300049573 Bacteria 1195
211 Ga0501038_0051482 3300049574 Bacteria 3553
212 Ga0501038_0079248 3300049574 Bacteria 2770
213 Ga0501039_0006597 3300049575 Bacteria 8816
214 Ga0501039_0008694 3300049575 Bacteria 7733
215 Ga0501039_0010352 3300049575 Bacteria 7113
216 Ga0501040_0001106 3300049576 Bacteria 17071
217 Ga0501040_0012145 3300049576 Bacteria 5641
218 Ga0501040_0060830 3300049576 Bacteria 2596
219 Ga0501040_0137551 3300049576 Bacteria 1720
220 Ga0501041_0016459 3300049577 Bacteria 4396
221 Ga0501041_0024677 3300049577 Bacteria 3609
222 Ga0501041_0032294 3300049577 Bacteria 3164
223 Ga0501041_0066433 3300049577 Bacteria 2210
224 Ga0501041_0133090 3300049577 Bacteria 1549
225 Ga0501041_0153598 3300049577 Bacteria 1438
226 Ga0501042_0000861 3300049578 Bacteria 16935
227 Ga0501042_0026307 3300049578 Bacteria 4090
228 Ga0501042_0055668 3300049578 Bacteria 2823
229 Ga0501042_0214979 3300049578 Bacteria 1387
230 Ga0501042_0245992 3300049578 Bacteria 1291
231 Ga0501046_0000331 3300049580 Bacteria 47687
232 Ga0501046_0013095 3300049580 Bacteria 7041
233 Ga0501046_0013392 3300049580 Bacteria 6945
234 Ga0501047_0009811 3300049581 Bacteria 9046
235 Ga0501048_0013431 3300049582 Bacteria 6078
236 Ga0501048_0026399 3300049582 Bacteria 4229
237 Ga0501048_0155155 3300049582 Bacteria 1619
238 Ga0501048_0191037 3300049582 Bacteria 1451
239 Ga0501048_0281262 3300049582 Bacteria 1183
240 Ga0501068_0156164 3300049584 Bacteria 1436
241 Ga0501071_0005044 3300049587 Bacteria 8448
242 Ga0501071_0301815 3300049587 Bacteria 1214
243 Ga0501072_0003146 3300049588 Bacteria 12421
244 Ga0501072_0009052 3300049588 Bacteria 7569
245 Ga0501072_0013665 3300049588 Bacteria 6217
246 Ga0501072_0030498 3300049588 Bacteria 4218
247 Ga0501072_0095069 3300049588 Bacteria 2368
248 Ga0501072_0130929 3300049588 Bacteria 1999
249 Ga0501072_0293426 3300049588 Bacteria 1293
250 Ga0501072_0356920 3300049588 Bacteria 1160
251 Ga0501073_0199890 3300049589 Bacteria 1382
252 Ga0501074_0001722 3300049590 Bacteria 14935
253 Ga0501074_0125672 3300049590 Bacteria 1834
254 Ga0501075_0000322 3300049591 Bacteria 26904
255 Ga0501075_0011015 3300049591 Bacteria 6381
256 Ga0501075_0027255 3300049591 Bacteria 4210
257 Ga0501075_0035244 3300049591 Bacteria 3731
258 Ga0501075_0065869 3300049591 Bacteria 2733
259 Ga0501075_0070022 3300049591 Bacteria 2651
260 Ga0501075_0085166 3300049591 Bacteria 2394
261 Ga0501075_0145461 3300049591 Bacteria 1806
262 Ga0501076_0000704 3300049592 Bacteria 21555
263 Ga0501076_0013086 3300049592 Bacteria 6213
264 Ga0501076_0026930 3300049592 Bacteria 4457
265 Ga0501076_0030628 3300049592 Bacteria 4192
266 Ga0501076_0046446 3300049592 Bacteria 3432
267 Ga0501076_0092823 3300049592 Bacteria 2429
268 Ga0501076_0223492 3300049592 Bacteria 1539
269 Ga0501077_0006989 3300049593 Bacteria 6955
270 Ga0501077_0010129 3300049593 Bacteria 5870
271 Ga0501077_0019926 3300049593 Bacteria 4244
272 Ga0501077_0050030 3300049593 Bacteria 2656
273 Ga0501077_0057255 3300049593 Bacteria 2475
274 Ga0501077_0063987 3300049593 Bacteria 2333
275 Ga0501077_0233365 3300049593 Bacteria 1169
276 Ga0501206_006192 3300049653 Bacteria 1551
277 Ga0501079_0014156 3300049741 Bacteria 6079
278 Ga0501079_0026574 3300049741 Bacteria 4437
279 Ga0501079_0056298 3300049741 Bacteria 3034
280 Ga0501079_0071842 3300049741 Bacteria 2674
281 Ga0501079_0078324 3300049741 Bacteria 2556
282 Ga0501079_0100071 3300049741 Bacteria 2247
283 Ga0501079_0132810 3300049741 Bacteria 1937
284 Ga0501079_0202668 3300049741 Bacteria 1550
285 Ga0501080_0007709 3300049742 Bacteria 9729
286 Ga0501080_0023266 3300049742 Bacteria 5745
287 Ga0501080_0038884 3300049742 Bacteria 4440
288 Ga0501080_0061362 3300049742 Bacteria 3500
289 Ga0501080_0137046 3300049742 Bacteria 2265
290 Ga0501080_0343956 3300049742 Bacteria 1348
291 Ga0501081_0006539 3300049743 Bacteria 7572
292 Ga0501081_0022346 3300049743 Bacteria 4231
293 Ga0501081_0037094 3300049743 Bacteria 3325
294 Ga0501081_0218184 3300049743 Bacteria 1387
295 Ga0501083_0027172 3300049744 Bacteria 3950
296 Ga0501083_0046630 3300049744 Bacteria 2930
297 Ga0501083_0054180 3300049744 Bacteria 2692
298 Ga0501083_0099017 3300049744 Bacteria 1923
299 Ga0501083_0182805 3300049744 Bacteria 1369
300 Ga0501265_000342 3300049762 Bacteria 4872
301 Ga0501035_0040965 3300049822 Bacteria 4183
302 Ga0501035_0244937 3300049822 Bacteria 1524
303 Ga0501044_0299692 3300049823 Bacteria 1537
304 Ga0501045_0003015 3300049824 Bacteria 11531
305 Ga0501045_0017430 3300049824 Bacteria 5099
306 Ga0501045_0023094 3300049824 Bacteria 4456
307 Ga0501045_0073436 3300049824 Bacteria 2519
308 Ga0501045_0192175 3300049824 Bacteria 1521
309 Ga0501045_0377261 3300049824 Bacteria 1056
310 nmdc:mga0yw44_11352_c1 3300050492 Bacteria 4592
311 nmdc:mga0k408_211384_c1 3300050493 Bacteria 1158
312 nmdc:mga0k408_46702_c1 3300050493 Bacteria 2501
313 nmdc:mga0k408_59116_c1 3300050493 Bacteria 2227
314 nmdc:mga0k408_96413_c1 3300050493 Bacteria 1741
315 nmdc:mga05p37_1554_c1 3300050507 Bacteria 26686
316 nmdc:mga05p37_240583_c1 3300050507 Bacteria 2177
317 nmdc:mga05p37_48815_c1 3300050507 Bacteria 5205
318 nmdc:mga05p37_5488_c1 3300050507 Bacteria 14895
319 nmdc:mga05p37_97319_c1 3300050507 Bacteria 3625
320 nmdc:mga09592_306869_c1 3300050508 Bacteria 1375
321 nmdc:mga09592_357_c1 3300050508 Bacteria 33391
322 nmdc:mga09592_45030_c1 3300050508 Bacteria 3716
323 nmdc:mga09592_45209_c1 3300050508 Bacteria 3709
324 nmdc:mga0qj67_200_c1 3300050509 Bacteria 40464
325 nmdc:mga0qj67_53758_c1 3300050509 Bacteria 3189
326 nmdc:mga0qj67_76267_c1 3300050509 Bacteria 2681
327 nmdc:mga06r32_4049_c1 3300050510 Bacteria 13142
328 nmdc:mga06r32_4452_c1 3300050510 Bacteria 12542
329 nmdc:mga06r32_693_c1 3300050510 Bacteria 29366
330 nmdc:mga08y16_26949_c1 3300050511 Bacteria 6057
331 nmdc:mga0n895_36091_c1 3300050512 Bacteria 4772
332 nmdc:mga0rr50_16571_c1 3300050513 Bacteria 4900
333 nmdc:mga0rr50_220143_c1 3300050513 Unclassified 1567
334 nmdc:mga08x19_1627_c1 3300050514 Bacteria 13903
335 nmdc:mga0a205_96594_c1 3300050515 Bacteria 2854
336 nmdc:mga0a205_99235_c1 3300050515 Bacteria 2810
337 Ga0500651_0018310 3300053093 Bacteria 4334
338 Ga0500586_073296 3300053145 Bacteria 1199
339 Ga0500616_0049362 3300053153 Bacteria 2227
340 Ga0500636_0168475 3300053177 Bacteria 1187
341 Ga0501084_0003119 3300054114 Bacteria 13429
342 Ga0501084_0007684 3300054114 Bacteria 8883
343 Ga0501084_0063036 3300054114 Bacteria 3103
344 Ga0501084_0064037 3300054114 Bacteria 3077
345 Ga0501082_0000575 3300060353 Bacteria 32632
346 Ga0501082_0001165 3300060353 Bacteria 23171
347 Ga0501082_0004392 3300060353 Bacteria 12313
348 Ga0501082_0005185 3300060353 Bacteria 11336
349 Ga0501082_0142878 3300060353 Bacteria 2077
350 Ga0501082_0253376 3300060353 Bacteria 1531
351 Ga0530510_0000219 3300061734 Bacteria 35590
352 Ga0530510_0000546 3300061734 Bacteria 24218
353 Ga0530510_0003312 3300061734 Bacteria 11091
354 Ga0530510_0050562 3300061734 Bacteria 3002
355 Ga0530510_0051376 3300061734 Bacteria 2978
356 Ga0530510_0095607 3300061734 Bacteria 2171
357 Ga0530510_0480613 3300061734 Bacteria 941
358 2548498024 2547132374 Bacteria 5530232
359 2643865253 2643221570 Bacteria 5103772
360 2643991445 2643221596 Bacteria 5006805
361 2644030926 2643221603 Bacteria 6147767
362 2644057202 2643221609 Bacteria 6756331
363 2644071976 2643221611 Bacteria 6820941
364 2644292528 2643221652 Bacteria 5140275
365 2644646023 2643221717 Bacteria 5676132
366 2738720401 2738541277 Bacteria 7458140
367 2739056871 2738541337 Bacteria 6183410
368 2739246014 2738543012 Bacteria 7115078
369 2739247606 2738543013 Bacteria 5618633
370 2739279600 2738543019 Bacteria 7459457
371 2816471730 2816332133 Bacteria 7249298
372 2842735642 2842733646 Bacteria 5716726
373 2842751613 2842747753 Bacteria 5578255
374 2895518244 2895511927 Bacteria 6802080
375 2919705799 2919704043 Bacteria 5560311
376 Ga0307513_10000025
377 JGI25158J39367_1005099
378 Ga0055524_1000164
379 Ga0055530_10010732
380 Ga0055540_1000015
381 Ga0055531_10009345
382 Ga0070676_10004078
383 Ga0070676_10063786
384 Ga0070690_100005303
385 Ga0070670_100476716
386 Ga0070677_10007636
387 Ga0070677_10013324
388 Ga0068869_100000911
389 Ga0070666_10014873
390 Ga0070692_10217031
391 Ga0070668_100322737
392 Ga0070675_100258136
393 Ga0070674_100018206
394 Ga0070674_100054898
395 Ga0070703_10026492
396 Ga0070705_100019068
397 Ga0070705_100094055
398 Ga0070700_100055234
399 Ga0070700_100299221
400 Ga0070694_100034400
401 Ga0070708_100022581
402 Ga0070708_100673289
403 Ga0070662_100005569
404 Ga0070662_100077180
405 Ga0068867_100069329
406 Ga0070707_100032314
407 Ga0070707_100178439
408 Ga0070698_100024489
409 Ga0070698_100263005
410 Ga0070697_100015144
411 Ga0070697_100032063
412 Ga0068853_100119738
413 Ga0070672_100030037
414 Ga0070695_100004959
415 Ga0070665_100466603
416 Ga0068854_100265062
417 Ga0068852_100030704
418 Ga0068866_10008567
419 Ga0068861_100031001
420 Ga0068858_100012058
421 Ga0068862_100021578
422 Ga0068862_100367291
423 Ga0081455_10000492
424 Ga0081538_10050367
425 Ga0075365_10136034
426 Ga0070716_100113005
427 Ga0075367_10100801
428 Ga0075366_10023834
429 Ga0075366_10111668
430 Ga0075428_100020012
431 Ga0075428_100119399
432 Ga0075430_100011746
433 Ga0075430_100084003
434 Ga0075430_100145562
435 Ga0075431_100007367
436 Ga0075431_100007445
437 Ga0075431_100034771
438 Ga0075433_10000967
439 Ga0075434_100457243
440 Ga0075429_100004641
441 Ga0075429_100120227
442 Ga0075429_100141383
443 Ga0075429_100225266
444 Ga0068865_100020081
445 Ga0068865_100050162
446 Ga0068865_100194379
447 Ga0075436_100084351
448 Ga0079104_1000173
449 Ga0075435_100005345
450 Ga0075435_100047079
451 Ga0075435_100210763
452 Ga0099794_10074417
453 Ga0111539_10007217
454 Ga0111539_10429881
455 Ga0114129_10012893
456 Ga0114129_10031049
457 Ga0114129_10079245
458 Ga0114129_10271141
459 Ga0105242_10137636
460 Ga0105249_10059425
461 Ga0105249_10131192
462 Ga0157378_10182947
463 Ga0163162_10251117
464 Ga0163162_10412445
465 Ga0163163_10519272
466 Ga0157380_10032480
467 Ga0157380_10034547
468 Ga0157380_10260370
469 Ga0157379_10011269
470 Ga0183362_10007
471 Ga0163161_10022133
472 Ga0209675_1032397
473 Ga0209025_1046634
474 Ga0209050_1000170
475 Ga0209050_1011108
476 Ga0209256_1000120
477 Ga0209051_1000020
478 Ga0209257_1000260
479 Ga0209257_1006418
480 Ga0207653_10002028
481 Ga0207653_10027051
482 Ga0207682_10008018
483 Ga0207682_10033150
484 Ga0207688_10016315
485 Ga0207680_10017043
486 Ga0207645_10002899
487 Ga0207645_10079036
488 Ga0207684_10038428
489 Ga0207684_10103908
490 Ga0207663_10029291
491 Ga0207662_10037587
492 Ga0207646_10011420
493 Ga0207646_10331335
494 Ga0207681_10005383
495 Ga0207681_10061739
496 Ga0207659_10082843
497 Ga0207687_10039364
498 Ga0207706_10020255
499 Ga0207686_10077617
500 Ga0207669_10022301
501 Ga0207669_10148916
502 Ga0207704_10005799
503 Ga0207704_10024130
504 Ga0207704_10235366
505 Ga0207665_10007963
506 Ga0207691_10051321
507 Ga0207711_10093296
508 Ga0207689_10006591
509 Ga0207689_10021883
510 Ga0207712_10013862
511 Ga0207668_10255111
512 Ga0207640_10175398
513 Ga0207658_10007767
514 Ga0207678_10137532
515 Ga0207708_10128881
516 Ga0207648_10046804
517 Ga0207675_100021279
518 Ga0207675_100084837
519 Ga0209281_1000292
520 Ga0209970_1000777
521 Ga0209588_1003676
522 Ga0209974_10005443
523 Ga0207428_10010100
524 Ga0268266_10335077
525 Ga0268265_10012847
526 Ga0268265_10162189
527 Ga0268264_10007115
528 Ga0307515_10000204
529 Ga0307515_10000861
530 Ga0307515_10036347
531 Ga0307515_10173895
532 Ga0307513_10005861
533 Ga0307513_10024947
534 Ga0307513_10122428
535 Ga0307516_10013448
536 Ga0307405_10120398
537 Ga0307405_10422922
538 Ga0307410_10073788
539 Ga0307406_10449826
540 Ga0307416_100041093
541 Ga0307416_100076518
542 Ga0307415_100119354
543 Ga0373939_0083172
544 Ga0373931_0153975
545 Ga0439439_0019556
546 Ga0439461_0039805
547 Ga0439431_0023401
548 Ga0439441_027244
549 Ga0439445_0005777
550 Ga0439449_0001760
551 Ga0439450_003447
552 Ga0439452_021818
553 Ga0439446_0042397
554 Ga0439434_0038436
555 Ga0439464_0004802
556 Ga0439464_0012338
557 Ga0439460_0000840
558 Ga0439460_0014550
559 Ga0451577_0001120
560 Ga0451577_0019443
561 Ga0451577_0027107
562 Ga0453684_0179801
563 Ga0453684_0253917
564 Ga0495580_0005119
565 Ga0495580_0012031
566 Ga0495621_0037960
567 Ga0495647_0113616
568 Ga0495615_0018305
569 Ga0496101_0045637
570 Ga0496114_0004160
571 Ga0496121_0027397
572 Ga0496124_0167629
573 Ga0496125_0016422
574 Ga0501294_005511
575 Ga0501298_026006
576 Ga0501031_0117982
577 Ga0501031_0195234
578 Ga0501033_0149741
579 Ga0501036_0009592
580 Ga0501036_0046164
581 Ga0501036_0056179
582 Ga0501036_0072853
583 Ga0501036_0471760
584 Ga0501037_0048674
585 Ga0501037_0267004
586 Ga0501038_0051482
587 Ga0501038_0079248
588 Ga0501039_0006597
589 Ga0501039_0008694
590 Ga0501039_0010352
591 Ga0501040_0001106
592 Ga0501040_0012145
593 Ga0501040_0060830
594 Ga0501040_0137551
595 Ga0501041_0016459
596 Ga0501041_0024677
597 Ga0501041_0032294
598 Ga0501041_0066433
599 Ga0501041_0133090
600 Ga0501041_0153598
601 Ga0501042_0000861
602 Ga0501042_0026307
603 Ga0501042_0055668
604 Ga0501042_0214979
605 Ga0501042_0245992
606 Ga0501046_0000331
607 Ga0501046_0013095
608 Ga0501046_0013392
609 Ga0501047_0009811
610 Ga0501048_0013431
611 Ga0501048_0026399
612 Ga0501048_0155155
613 Ga0501048_0191037
614 Ga0501048_0281262
615 Ga0501068_0156164
616 Ga0501071_0005044
617 Ga0501071_0301815
618 Ga0501072_0003146
619 Ga0501072_0009052
620 Ga0501072_0013665
621 Ga0501072_0030498
622 Ga0501072_0095069
623 Ga0501072_0130929
624 Ga0501072_0293426
625 Ga0501072_0356920
626 Ga0501073_0199890
627 Ga0501074_0001722
628 Ga0501074_0125672
629 Ga0501075_0000322
630 Ga0501075_0011015
631 Ga0501075_0027255
632 Ga0501075_0035244
633 Ga0501075_0065869
634 Ga0501075_0070022
635 Ga0501075_0085166
636 Ga0501075_0145461
637 Ga0501076_0000704
638 Ga0501076_0013086
639 Ga0501076_0026930
640 Ga0501076_0030628
641 Ga0501076_0046446
642 Ga0501076_0092823
643 Ga0501076_0223492
644 Ga0501077_0006989
645 Ga0501077_0010129
646 Ga0501077_0019926
647 Ga0501077_0050030
648 Ga0501077_0057255
649 Ga0501077_0063987
650 Ga0501077_0233365
651 Ga0501206_006192
652 Ga0501079_0014156
653 Ga0501079_0026574
654 Ga0501079_0056298
655 Ga0501079_0071842
656 Ga0501079_0078324
657 Ga0501079_0100071
658 Ga0501079_0132810
659 Ga0501079_0202668
660 Ga0501080_0007709
661 Ga0501080_0023266
662 Ga0501080_0038884
663 Ga0501080_0061362
664 Ga0501080_0137046
665 Ga0501080_0343956
666 Ga0501081_0006539
667 Ga0501081_0022346
668 Ga0501081_0037094
669 Ga0501081_0218184
670 Ga0501083_0027172
671 Ga0501083_0046630
672 Ga0501083_0054180
673 Ga0501083_0099017
674 Ga0501083_0182805
675 Ga0501265_000342
676 Ga0501035_0040965
677 Ga0501035_0244937
678 Ga0501044_0299692
679 Ga0501045_0003015
680 Ga0501045_0017430
681 Ga0501045_0023094
682 Ga0501045_0073436
683 Ga0501045_0192175
684 Ga0501045_0377261
685 nmdc:mga0yw44_11352_c1
686 nmdc:mga0k408_211384_c1
687 nmdc:mga0k408_46702_c1
688 nmdc:mga0k408_59116_c1
689 nmdc:mga0k408_96413_c1
690 nmdc:mga05p37_1554_c1
691 nmdc:mga05p37_240583_c1
692 nmdc:mga05p37_48815_c1
693 nmdc:mga05p37_5488_c1
694 nmdc:mga05p37_97319_c1
695 nmdc:mga09592_306869_c1
696 nmdc:mga09592_357_c1
697 nmdc:mga09592_45030_c1
698 nmdc:mga09592_45209_c1
699 nmdc:mga0qj67_200_c1
700 nmdc:mga0qj67_53758_c1
701 nmdc:mga0qj67_76267_c1
702 nmdc:mga06r32_4049_c1
703 nmdc:mga06r32_4452_c1
704 nmdc:mga06r32_693_c1
705 nmdc:mga08y16_26949_c1
706 nmdc:mga0n895_36091_c1
707 nmdc:mga0rr50_16571_c1
708 nmdc:mga0rr50_220143_c1
709 nmdc:mga08x19_1627_c1
710 nmdc:mga0a205_96594_c1
711 nmdc:mga0a205_99235_c1
712 Ga0500651_0018310
713 Ga0500586_073296
714 Ga0500616_0049362
715 Ga0500636_0168475
716 Ga0501084_0003119
717 Ga0501084_0007684
718 Ga0501084_0063036
719 Ga0501084_0064037
720 Ga0501082_0000575
721 Ga0501082_0001165
722 Ga0501082_0004392
723 Ga0501082_0005185
724 Ga0501082_0142878
725 Ga0501082_0253376
726 Ga0530510_0000219
727 Ga0530510_0000546
728 Ga0530510_0003312
729 Ga0530510_0050562
730 Ga0530510_0051376
731 Ga0530510_0095607
732 Ga0530510_0480613
733 2548498024
734 2643865253
735 2643991445
736 2644030926
737 2644057202
738 2644071976
739 2644292528
740 2644646023
741 2738720401
742 2739056871
743 2739246014
744 2739247606
745 2739279600
746 2816471730
747 2842735642
748 2842751613
749 2895518244
750 2919705799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

46

318

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.556 7 281
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5369 7 284
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5289 7 284
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.523 7 284
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5188 7 281
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8741 10 279 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8371 10 279 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8294 10 280 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8013 11 276 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7972 10 280 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A383AXC8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9604 37 283 GO:0005886
GO:0006865
GO:0022857
AF-A0A536CK90-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9569 1 290 GO:0005886
GO:0006865
GO:0022857
AF-A0A536CK90-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9537 1 290 GO:0005886
GO:0006865
GO:0022857
AF-A0A383AXC8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9529 37 283 GO:0005886
GO:0006865
GO:0022857
AF-B0PAW3-F1-model_v4 Branched-chain amino acid ABC transporter, permease protein 0.9527 3 290 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015192
GO:0015808
GO:0042941
GO:1903806

Map