F426935

General Info

Members Datasets Scaffolds Average Seq Length
375 228 372 117

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100048893|Ga0070683_1000488936
Length 132
Sequence MFALKRVYEPSTASDGRRILVDRLWPRGLTKRAADVDEWLKEVAPSTELRKWFGHDPARWPEFKRRYRRELHAHRAEVDRIARLAARRRVTLVYGAKDDEHNDAVVLASVLRRKMKRPATSRRKTKSGSRNA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
4 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
5 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.27
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.4
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2101747 2162886007 Unclassified 1795
2 MBSR1b_contig_8392255 2162886012 Bacteria 1085
3 ARSoilOldRDRAFT_c004258 3300000044 Bacteria 1219
4 JGI24745J21846_1047953 3300002073 Bacteria 538
5 JGI24738J21930_10031911 3300002075 Unclassified 1074
6 Ga0058861_10028610 3300004800 Bacteria 1497
7 Ga0065704_10071643 3300005289 Bacteria 10403
8 Ga0065715_10103903 3300005293 Bacteria 3000
9 Ga0065707_10225196 3300005295 Bacteria 1209
10 Ga0070676_10004753 3300005328 Bacteria 7183
11 Ga0070683_100002167 3300005329 Bacteria 15524
12 Ga0070683_100048893 3300005329 Bacteria 3910
13 Ga0070683_100384770 3300005329 Unclassified 1337
14 Ga0070683_100470576 3300005329 Bacteria 1200
15 Ga0070690_100519257 3300005330 Bacteria 894
16 Ga0070670_100007485 3300005331 Bacteria 9273
17 Ga0070670_101822282 3300005331 Unclassified 560
18 Ga0068869_100034073 3300005334 Bacteria 3600
19 Ga0068869_100044387 3300005334 Bacteria 3196
20 Ga0068869_100048796 3300005334 Bacteria 3063
21 Ga0070666_10568008 3300005335 Bacteria 826
22 Ga0070680_100009506 3300005336 Bacteria 7467
23 Ga0070680_100199508 3300005336 Bacteria 1687
24 Ga0070680_100779473 3300005336 Unclassified 824
25 Ga0070682_100000537 3300005337 Bacteria 23585
26 Ga0070682_100337148 3300005337 Bacteria 1119
27 Ga0070682_100422032 3300005337 Bacteria 1014
28 Ga0068868_100145905 3300005338 Bacteria 1946
29 Ga0070660_100042412 3300005339 Bacteria 3472
30 Ga0070660_101018075 3300005339 Bacteria 700
31 Ga0070689_100150927 3300005340 Bacteria 1874
32 Ga0070691_10031575 3300005341 Bacteria 2485
33 Ga0070691_10430796 3300005341 Bacteria 749
34 Ga0070687_100705856 3300005343 Bacteria 705
35 Ga0070661_100000034 3300005344 Bacteria 111603
36 Ga0070661_100010501 3300005344 Bacteria 6440
37 Ga0070661_100056570 3300005344 Bacteria 2874
38 Ga0070692_10006368 3300005345 Bacteria 5125
39 Ga0070692_10012804 3300005345 Bacteria 3896
40 Ga0070669_100370090 3300005353 Bacteria 1167
41 Ga0070669_100857510 3300005353 Bacteria 774
42 Ga0070673_100073556 3300005364 Bacteria 2751
43 Ga0070659_100023818 3300005366 Bacteria 4687
44 Ga0070659_100051849 3300005366 Bacteria 3226
45 Ga0070667_100126554 3300005367 Bacteria 2227
46 Ga0070714_100004989 3300005435 Bacteria 10088
47 Ga0070705_100000862 3300005440 Bacteria 16991
48 Ga0070700_100044041 3300005441 Bacteria 2747
49 Ga0070694_100000499 3300005444 Bacteria 21543
50 Ga0070694_100058161 3300005444 Bacteria 2630
51 Ga0070708_101056488 3300005445 Bacteria 761
52 Ga0070663_100006552 3300005455 Bacteria 7017
53 Ga0070663_100968069 3300005455 Bacteria 738
54 Ga0070662_100008470 3300005457 Bacteria 6708
55 Ga0070681_10041472 3300005458 Bacteria 4613
56 Ga0070681_10126137 3300005458 Bacteria 2492
57 Ga0070681_10135656 3300005458 Bacteria 2392
58 Ga0068867_100002925 3300005459 Bacteria 12034
59 Ga0068867_101549640 3300005459 Bacteria 618
60 Ga0070706_100579042 3300005467 Bacteria 1044
61 Ga0070706_100979389 3300005467 Bacteria 780
62 Ga0070679_100004161 3300005530 Bacteria 13336
63 Ga0070679_100089318 3300005530 Bacteria 3068
64 Ga0070679_100468035 3300005530 Bacteria 1205
65 Ga0070679_100522931 3300005530 Bacteria 1130
66 Ga0070684_100007046 3300005535 Bacteria 8739
67 Ga0070684_100009601 3300005535 Bacteria 7626
68 Ga0070684_100045335 3300005535 Bacteria 3808
69 Ga0070684_100088744 3300005535 Bacteria 2747
70 Ga0070684_100140406 3300005535 Bacteria 2184
71 Ga0070684_101269245 3300005535 Bacteria 693
72 Ga0068853_100001311 3300005539 Bacteria 17870
73 Ga0068853_100001435 3300005539 Bacteria 17229
74 Ga0068853_100024740 3300005539 Bacteria 5037
75 Ga0068853_101616290 3300005539 Bacteria 628
76 Ga0070672_100119005 3300005543 Bacteria 2160
77 Ga0070695_100020683 3300005545 Bacteria 4019
78 Ga0070696_100000680 3300005546 Bacteria 21793
79 Ga0070693_100001434 3300005547 Bacteria 10749
80 Ga0070693_100041479 3300005547 Bacteria 2590
81 Ga0070693_101019742 3300005547 Bacteria 627
82 Ga0070665_100064968 3300005548 Plasmid 3660
83 Ga0068855_100028902 3300005563 Bacteria 6633
84 Ga0068855_100038923 3300005563 Bacteria 5646
85 Ga0070664_100007070 3300005564 Bacteria 9057
86 Ga0070664_100048018 3300005564 Bacteria 3607
87 Ga0070664_100084895 3300005564 Bacteria 2734
88 Ga0070664_100372192 3300005564 Bacteria 1303
89 Ga0068857_100010423 3300005577 Bacteria 8078
90 Ga0068857_100082592 3300005577 Bacteria 2870
91 Ga0068857_100084198 3300005577 Bacteria 2841
92 Ga0068857_101839479 3300005577 Bacteria 593
93 Ga0068854_100016148 3300005578 Bacteria 4969
94 Ga0068854_100116023 3300005578 Unclassified 2026
95 Ga0068856_100000657 3300005614 Bacteria 37435
96 Ga0068859_100002307 3300005617 Bacteria 19385
97 Ga0068864_100016656 3300005618 Bacteria 6123
98 Ga0068864_100031859 3300005618 Bacteria 4475
99 Ga0068861_100027682 3300005719 Bacteria 4132
100 Ga0068851_10082072 3300005834 Unclassified 1685
101 Ga0068851_10161489 3300005834 Bacteria 1231
102 Ga0068870_10003115 3300005840 Bacteria 7001
103 Ga0068863_100056252 3300005841 Bacteria 3725
104 Ga0068858_100705122 3300005842 Bacteria 982
105 Ga0068860_100039919 3300005843 Bacteria 4488
106 Ga0068862_100006263 3300005844 Bacteria 9906
107 Ga0081455_10001810 3300005937 Bacteria 25776
108 Ga0081455_10054082 3300005937 Bacteria 3424
109 Ga0075432_10001182 3300006058 Bacteria 8363
110 Ga0068871_100039387 3300006358 Bacteria 3782
111 Ga0068871_100644858 3300006358 Unclassified 966
112 Ga0075428_100256266 3300006844 Bacteria 1885
113 Ga0075428_100592137 3300006844 Bacteria 1185
114 Ga0075431_100009051 3300006847 Bacteria 9985
115 Ga0075433_10076108 3300006852 Bacteria 2955
116 Ga0075433_11074727 3300006852 Unclassified 700
117 Ga0075434_100857708 3300006871 Bacteria 923
118 Ga0068865_100129432 3300006881 Bacteria 1889
119 Ga0075436_100483139 3300006914 Bacteria 905
120 Ga0097620_100002307 3300006931 Bacteria 19385
121 Ga0105251_10000071 3300009011 Bacteria 97636
122 Ga0105240_10039090 3300009093 Bacteria 6079
123 Ga0105240_10215596 3300009093 Bacteria 2240
124 Ga0105240_10451736 3300009093 Bacteria 1438
125 Ga0105245_10004844 3300009098 Bacteria 11859
126 Ga0105243_10860789 3300009148 Bacteria 898
127 Ga0105243_11087913 3300009148 Bacteria 807
128 Ga0105241_10000117 3300009174 Bacteria 57559
129 Ga0105241_10061392 3300009174 Bacteria 2894
130 Ga0105241_10137548 3300009174 Unclassified 1985
131 Ga0105248_10028435 3300009177 Bacteria 6228
132 Ga0105248_10219671 3300009177 Bacteria 2140
133 Ga0105237_11126638 3300009545 Bacteria 791
134 Ga0105238_10018476 3300009551 Bacteria 7095
135 Ga0105238_10382760 3300009551 Bacteria 1398
136 Ga0105249_10576810 3300009553 Bacteria 1178
137 Ga0105239_10003298 3300010375 Bacteria 19880
138 Ga0105239_10009809 3300010375 Bacteria 10759
139 Ga0105239_10112626 3300010375 Bacteria 3017
140 Ga0105239_11984611 3300010375 Bacteria 675
141 Ga0157373_10001301 3300013100 Bacteria 19055
142 Ga0157373_10190869 3300013100 Unclassified 1444
143 Ga0157373_10274605 3300013100 Bacteria 1194
144 Ga0157373_10326505 3300013100 Bacteria 1092
145 Ga0157371_10291560 3300013102 Bacteria 1180
146 Ga0157371_10406756 3300013102 Bacteria 996
147 Ga0157370_10262940 3300013104 Unclassified 1594
148 Ga0157369_10006649 3300013105 Bacteria 13361
149 Ga0157369_10022751 3300013105 Bacteria 6989
150 Ga0157369_11061932 3300013105 Unclassified 828
151 Ga0157372_10003910 3300013307 Bacteria 16013
152 Ga0157372_11064420 3300013307 Unclassified 936
153 Ga0157380_11427851 3300014326 Unclassified 743
154 Ga0182008_10210024 3300014497 Bacteria 993
155 Ga0157377_10005359 3300014745 Bacteria 6021
156 Ga0157376_11143361 3300014969 Bacteria 805
157 Ga0157376_12279570 3300014969 Archaea 581
158 Ga0182007_10055766 3300015262 Bacteria 1298
159 Ga0207656_10118390 3300025321 Bacteria 1231
160 Ga0207713_1001241 3300025735 Bacteria 21135
161 Ga0207653_10007291 3300025885 Bacteria 3449
162 Ga0207688_10000972 3300025901 Bacteria 14596
163 Ga0207680_10770566 3300025903 Bacteria 690
164 Ga0207647_10000037 3300025904 Bacteria 97521
165 Ga0207645_10008414 3300025907 Bacteria 7198
166 Ga0207643_10001082 3300025908 Bacteria 16109
167 Ga0207705_10697806 3300025909 Unclassified 789
168 Ga0207684_10419324 3300025910 Bacteria 1150
169 Ga0207654_10002106 3300025911 Bacteria 10178
170 Ga0207654_10315766 3300025911 Unclassified 1067
171 Ga0207707_10001157 3300025912 Bacteria 25042
172 Ga0207707_10071418 3300025912 Bacteria 3025
173 Ga0207695_10105291 3300025913 Bacteria 2809
174 Ga0207695_10369609 3300025913 Bacteria 1320
175 Ga0207660_10000638 3300025917 Bacteria 23576
176 Ga0207660_10071451 3300025917 Bacteria 2525
177 Ga0207660_10113379 3300025917 Bacteria 2043
178 Ga0207660_10331199 3300025917 Bacteria 1217
179 Ga0207660_11024364 3300025917 Bacteria 673
180 Ga0207657_10000385 3300025919 Bacteria 46501
181 Ga0207657_10811523 3300025919 Bacteria 723
182 Ga0207649_10000045 3300025920 Bacteria 112787
183 Ga0207649_10006029 3300025920 Bacteria 6577
184 Ga0207649_10098359 3300025920 Bacteria 1931
185 Ga0207652_10002294 3300025921 Bacteria 16222
186 Ga0207652_10196782 3300025921 Bacteria 1813
187 Ga0207652_10471599 3300025921 Bacteria 1131
188 Ga0207652_10591287 3300025921 Bacteria 996
189 Ga0207652_11341488 3300025921 Bacteria 618
190 Ga0207681_10211160 3300025923 Bacteria 1496
191 Ga0207681_10376254 3300025923 Bacteria 1142
192 Ga0207694_10053786 3300025924 Unclassified 3123
193 Ga0207694_10289213 3300025924 Bacteria 1348
194 Ga0207650_10041151 3300025925 Bacteria 3384
195 Ga0207659_11410697 3300025926 Bacteria 597
196 Ga0207664_10000796 3300025929 Bacteria 21312
197 Ga0207690_10038832 3300025932 Bacteria 3101
198 Ga0207690_10749118 3300025932 Bacteria 805
199 Ga0207706_10007882 3300025933 Bacteria 9829
200 Ga0207709_10060050 3300025935 Bacteria 2369
201 Ga0207670_10050943 3300025936 Bacteria 2778
202 Ga0207704_10128145 3300025938 Bacteria 1752
203 Ga0207691_10418339 3300025940 Bacteria 1142
204 Ga0207691_11005664 3300025940 Bacteria 696
205 Ga0207711_10832997 3300025941 Bacteria 859
206 Ga0207689_10000204 3300025942 Bacteria 52389
207 Ga0207661_10002746 3300025944 Bacteria 12119
208 Ga0207661_10007223 3300025944 Bacteria 7896
209 Ga0207661_10372557 3300025944 Bacteria 1291
210 Ga0207679_10002954 3300025945 Bacteria 10538
211 Ga0207679_10027640 3300025945 Bacteria 3926
212 Ga0207679_10118573 3300025945 Bacteria 2102
213 Ga0207679_10295773 3300025945 Bacteria 1393
214 Ga0207679_10356719 3300025945 Bacteria 1276
215 Ga0207667_10009064 3300025949 Bacteria 11764
216 Ga0207667_10389071 3300025949 Unclassified 1420
217 Ga0207651_10095121 3300025960 Bacteria 2193
218 Ga0207640_10088591 3300025981 Bacteria 2137
219 Ga0207640_10249979 3300025981 Unclassified 1375
220 Ga0207677_11193813 3300026023 Bacteria 696
221 Ga0207703_10616102 3300026035 Bacteria 1027
222 Ga0207639_10002815 3300026041 Bacteria 11672
223 Ga0207639_10008111 3300026041 Bacteria 7180
224 Ga0207639_10156415 3300026041 Bacteria 1915
225 Ga0207639_11342001 3300026041 Unclassified 671
226 Ga0207678_10000861 3300026067 Bacteria 27863
227 Ga0207678_11641101 3300026067 Bacteria 565
228 Ga0207702_10004257 3300026078 Bacteria 12772
229 Ga0207641_10108868 3300026088 Bacteria 2453
230 Ga0207676_10003457 3300026095 Bacteria 11180
231 Ga0207676_10019496 3300026095 Bacteria 4950
232 Ga0207674_10003861 3300026116 Bacteria 18261
233 Ga0207674_10016989 3300026116 Bacteria 7945
234 Ga0207674_10032525 3300026116 Bacteria 5471
235 Ga0207674_10165362 3300026116 Bacteria 2166
236 Ga0207675_100023039 3300026118 Bacteria 5792
237 Ga0207698_10157493 3300026142 Unclassified 1981
238 Ga0207428_10009728 3300027907 Bacteria 8615
239 Ga0268266_10135117 3300028379 Unclassified 2208
240 Ga0268265_10003933 3300028380 Bacteria 10467
241 Ga0268264_10043183 3300028381 Bacteria 3735
242 Ga0265338_10379651 3300028800 Bacteria 1011
243 Ga0316575_10001733 3300031665 Bacteria 7137
244 Ga0316579_10625328 3300031691 Bacteria 521
245 Ga0316578_10114951 3300031728 Bacteria 1617
246 Ga0307405_10509065 3300031731 Unclassified 966
247 Ga0316577_10096618 3300031733 Bacteria 1655
248 Ga0307409_100295986 3300031995 Bacteria 1503
249 Ga0307415_100074625 3300032126 Bacteria 2398
250 Ga0373948_0108534 3300034817 Bacteria 660
251 Ga0373959_0008965 3300034820 Bacteria 1715
252 Ga0373949_0098128 3300035090 Bacteria 800
253 Ga0373951_0072687 3300035091 Bacteria 878
254 Ga0373961_0122662 3300035241 Bacteria 863
255 Ga0373962_0042195 3300035242 Bacteria 1289
256 Ga0316574_0000138 3300035398 Bacteria 23158
257 Ga0316582_0011632 3300036647 Bacteria 4873
258 Ga0316581_0005873 3300037588 Bacteria 3227
259 Ga0395901_0820321 3300038443 Bacteria 918
260 Ga0237819_04688 3300038705 Bacteria 2221
261 Ga0436360_0096272 3300039438 Bacteria 2288
262 Ga0436360_0921674 3300039438 Bacteria 1643
263 Ga0436361_1126998 3300039447 Bacteria 3405
264 Ga0436363_0083552 3300039450 Bacteria 765
265 Ga0436362_0628888 3300039453 Bacteria 871
266 Ga0439448_0000271 3300042005 Bacteria 11351
267 Ga0439458_0010794 3300042157 Bacteria 2039
268 Ga0439459_0000788 3300042438 Bacteria 4379
269 Ga0451577_0133145 3300042876 Bacteria 2231
270 Ga0466964_0041297 3300044706 Bacteria 1865
271 Ga0466968_0303017 3300044735 Bacteria 769
272 Ga0451576_0464995 3300045051 Bacteria 1328
273 Ga0466967_0124319 3300045976 Unclassified 2388
274 Ga0466967_0292171 3300045976 Bacteria 1566
275 Ga0466967_0587841 3300045976 Bacteria 1098
276 Ga0466967_1780451 3300045976 Bacteria 613
277 Ga0495623_0008152 3300046679 Bacteria 6812
278 Ga0495604_0019628 3300047317 Bacteria 5409
279 Ga0495675_0073092 3300047444 Bacteria 2163
280 Ga0496100_0000293 3300048903 Bacteria 25054
281 Ga0496101_0017412 3300048904 Bacteria 4873
282 Ga0496102_1566113 3300048905 Bacteria 577
283 Ga0496105_0531873 3300048908 Unclassified 920
284 Ga0496106_0000047 3300048909 Bacteria 100449
285 Ga0496107_0000035 3300048910 Bacteria 86628
286 Ga0496111_1276058 3300048914 Bacteria 518
287 Ga0496112_1768176 3300048915 Bacteria 530
288 Ga0496115_0002056 3300048918 Bacteria 14406
289 Ga0496116_0000193 3300048919 Bacteria 122203
290 Ga0496117_0001656 3300048920 Bacteria 31249
291 Ga0496118_0000156 3300048921 Bacteria 121630
292 Ga0496121_0048856 3300048924 Bacteria 3595
293 Ga0496124_0277220 3300048927 Bacteria 1224
294 Ga0496126_1420071 3300048929 Unclassified 500
295 Ga0501033_0458070 3300049570 Bacteria 885
296 Ga0501036_0110798 3300049572 Bacteria 2319
297 Ga0501036_0335339 3300049572 Unclassified 1263
298 Ga0501038_0053153 3300049574 Bacteria 3489
299 Ga0501039_0016451 3300049575 Bacteria 5666
300 Ga0501039_0274973 3300049575 Bacteria 1324
301 Ga0501039_0389194 3300049575 Bacteria 1095
302 Ga0501039_0589291 3300049575 Bacteria 872
303 Ga0501039_0707981 3300049575 Unclassified 787
304 Ga0501040_0116707 3300049576 Bacteria 1870
305 Ga0501040_0501128 3300049576 Bacteria 875
306 Ga0501040_0955070 3300049576 Bacteria 621
307 Ga0501041_0013683 3300049577 Bacteria 4814
308 Ga0501041_0148214 3300049577 Bacteria 1464
309 Ga0501042_0305896 3300049578 Bacteria 1148
310 Ga0501042_0522231 3300049578 Unclassified 862
311 Ga0501043_0024004 3300049579 Bacteria 4785
312 Ga0501046_0027422 3300049580 Bacteria 4646
313 Ga0501046_0030951 3300049580 Bacteria 4343
314 Ga0501046_0333590 3300049580 Unclassified 1103
315 Ga0501048_0091568 3300049582 Bacteria 2145
316 Ga0501048_0306526 3300049582 Bacteria 1130
317 Ga0501068_0015269 3300049584 Bacteria 4407
318 Ga0501068_0962050 3300049584 Unclassified 563
319 Ga0501069_0061079 3300049585 Bacteria 2104
320 Ga0501069_0606842 3300049585 Unclassified 657
321 Ga0501070_0032682 3300049586 Bacteria 4355
322 Ga0501071_0014613 3300049587 Bacteria 5372
323 Ga0501071_0083991 3300049587 Bacteria 2333
324 Ga0501072_0005506 3300049588 Bacteria 9636
325 Ga0501072_0132819 3300049588 Bacteria 1985
326 Ga0501072_0535767 3300049588 Bacteria 925
327 Ga0501074_0033114 3300049590 Bacteria 3745
328 Ga0501075_0011674 3300049591 Bacteria 6223
329 Ga0501075_0198575 3300049591 Bacteria 1530
330 Ga0501076_0023575 3300049592 Bacteria 4746
331 Ga0501076_0219343 3300049592 Bacteria 1554
332 Ga0501076_0221117 3300049592 Bacteria 1548
333 Ga0501076_0851284 3300049592 Bacteria 752
334 Ga0501077_0005159 3300049593 Bacteria 7934
335 Ga0501077_0016179 3300049593 Bacteria 4699
336 Ga0501077_0108480 3300049593 Bacteria 1759
337 Ga0501077_0473052 3300049593 Unclassified 803
338 Ga0501216_028939 3300049660 Bacteria 1013
339 Ga0501224_068775 3300049664 Bacteria 558
340 Ga0501079_0013687 3300049741 Bacteria 6186
341 Ga0501079_0075307 3300049741 Bacteria 2610
342 Ga0501079_0080916 3300049741 Bacteria 2511
343 Ga0501079_1619473 3300049741 Bacteria 509
344 Ga0501080_0063187 3300049742 Bacteria 3446
345 Ga0501080_0883503 3300049742 Bacteria 780
346 Ga0501081_0021771 3300049743 Bacteria 4281
347 Ga0501081_0184157 3300049743 Bacteria 1511
348 Ga0501083_0310581 3300049744 Bacteria 1025
349 Ga0501035_0026763 3300049822 Bacteria 5275
350 Ga0501035_0346689 3300049822 Bacteria 1243
351 Ga0501035_1253745 3300049822 Bacteria 573
352 Ga0501044_0167738 3300049823 Bacteria 2169
353 Ga0501045_0005683 3300049824 Bacteria 8629
354 nmdc:mga05p37_90577_c1 3300050507 Bacteria 3769
355 nmdc:mga08y16_42420_c1 3300050511 Bacteria 4766
356 nmdc:mga0n895_95052_c1 3300050512 Bacteria 2985
357 nmdc:mga0rr50_183150_c1 3300050513 Bacteria 1713
358 nmdc:mga08x19_864901_c1 3300050514 Bacteria 642
359 nmdc:mga0a205_520346_c1 3300050515 Bacteria 1046
360 nmdc:mga0a205_94369_c1 3300050515 Bacteria 2890
361 Ga0501084_0007618 3300054114 Bacteria 8926
362 Ga0501084_0075436 3300054114 Bacteria 2825
363 Ga0501084_0122341 3300054114 Bacteria 2188
364 Ga0501084_0135784 3300054114 Bacteria 2071
365 Ga0501084_0948200 3300054114 Bacteria 723
366 Ga0501082_0037276 3300060353 Bacteria 4190
367 Ga0501082_0190990 3300060353 Bacteria 1782
368 Ga0501082_0988333 3300060353 Unclassified 736
369 Ga0501082_1195561 3300060353 Bacteria 664
370 Ga0501082_1525264 3300060353 Bacteria 583
371 Ga0530510_0113945 3300061734 Bacteria 1981
372 Ga0530510_0477391 3300061734 Unclassified 944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100002167 Ga0070683_1000021673 104
2 3300005535 Ga0070684_100045335 Ga0070684_1000453353 104
3 3300005547 Ga0070693_101019742 Ga0070693_1010197421 104
4 3300005564 Ga0070664_100372192 Ga0070664_1003721922 104
5 3300005577 Ga0068857_100082592 Ga0068857_1000825922 104
6 3300025944 Ga0207661_10002746 Ga0207661_100027464 104
7 3300025945 Ga0207679_10295773 Ga0207679_102957732 104
8 3300026116 Ga0207674_10165362 Ga0207674_101653623 104
9 3300039438 Ga0436360_0096272 Ga0436360_0096272_73_450 106
10 3300049575 Ga0501039_0274973 Ga0501039_0274973_709_1068 106
11 3300049576 Ga0501040_0955070 Ga0501040_0955070_200_559 106
12 3300049593 Ga0501077_0473052 Ga0501077_0473052_259_618 106
13 3300049741 Ga0501079_0075307 Ga0501079_0075307_606_965 106
14 3300054114 Ga0501084_0948200 Ga0501084_0948200_175_534 106
15 3300060353 Ga0501082_0988333 Ga0501082_0988333_355_714 106
16 3300038443 Ga0395901_0820321 Ga0395901_0820321_140_478 109
17 3300005539 Ga0068853_100001311 Ga0068853_10000131113 112
18 3300006358 Ga0068871_100644858 Ga0068871_1006448582 112
19 3300009174 Ga0105241_10061392 Ga0105241_100613924 112
20 3300013105 Ga0157369_11061932 Ga0157369_110619322 112
21 3300026041 Ga0207639_10002815 Ga0207639_100028158 112
22 3300039438 Ga0436360_0921674 Ga0436360_0921674_423_770 112
23 3300039447 Ga0436361_1126998 Ga0436361_1126998_466_813 112
24 3300039450 Ga0436363_0083552 Ga0436363_0083552_326_673 112
25 3300039453 Ga0436362_0628888 Ga0436362_0628888_510_857 112
26 3300048918 Ga0496115_0002056 Ga0496115_0002056_1732_2097 112
27 3300049586 Ga0501070_0032682 Ga0501070_0032682_3440_3787 112
28 3300005329 Ga0070683_100384770 Ga0070683_1003847701 113
29 3300005530 Ga0070679_100468035 Ga0070679_1004680352 113
30 3300005535 Ga0070684_101269245 Ga0070684_1012692452 113
31 3300005539 Ga0068853_101616290 Ga0068853_1016162901 113
32 3300009093 Ga0105240_10215596 Ga0105240_102155962 113
33 3300009174 Ga0105241_10137548 Ga0105241_101375482 113
34 3300010375 Ga0105239_10003298 Ga0105239_1000329821 113
35 3300025921 Ga0207652_10591287 Ga0207652_105912872 113
36 3300005336 Ga0070680_100199508 Ga0070680_1001995081 114
37 3300005530 Ga0070679_100089318 Ga0070679_1000893182 114
38 3300006844 Ga0075428_100592137 Ga0075428_1005921372 114
39 3300025917 Ga0207660_10071451 Ga0207660_100714512 114
40 3300025921 Ga0207652_10196782 Ga0207652_101967822 114
41 3300046679 Ga0495623_0008152 Ga0495623_0008152_2187_2537 114
42 3300047317 Ga0495604_0019628 Ga0495604_0019628_4291_4641 114
43 3300047444 Ga0495675_0073092 Ga0495675_0073092_1376_1726 114
44 3300049822 Ga0501035_0346689 Ga0501035_0346689_21_365 114
45 3300054114 Ga0501084_0075436 Ga0501084_0075436_683_1027 114
46 2162886012 MBSR1b_contig_8392255 MBSR1b_0967.00000020 115
47 3300000044 ARSoilOldRDRAFT_c004258 ARSoilOldRDRAFT_0042581 115
48 3300002073 JGI24745J21846_1047953 JGI24745J21846_10479531 115
49 3300004800 Ga0058861_10028610 Ga0058861_100286101 115
50 3300005293 Ga0065715_10103903 Ga0065715_101039033 115
51 3300005295 Ga0065707_10225196 Ga0065707_102251962 115
52 3300005328 Ga0070676_10004753 Ga0070676_100047534 115
53 3300005329 Ga0070683_100048893 Ga0070683_1000488936 115
54 3300005329 Ga0070683_100470576 Ga0070683_1004705761 115
55 3300005330 Ga0070690_100519257 Ga0070690_1005192572 115
56 3300005331 Ga0070670_100007485 Ga0070670_1000074852 115
57 3300005334 Ga0068869_100044387 Ga0068869_1000443872 115
58 3300005334 Ga0068869_100048796 Ga0068869_1000487963 115
59 3300005335 Ga0070666_10568008 Ga0070666_105680082 115
60 3300005336 Ga0070680_100009506 Ga0070680_1000095063 115
61 3300005336 Ga0070680_100779473 Ga0070680_1007794731 115
62 3300005337 Ga0070682_100000537 Ga0070682_1000005379 115
63 3300005337 Ga0070682_100337148 Ga0070682_1003371482 115
64 3300005337 Ga0070682_100422032 Ga0070682_1004220323 115
65 3300005338 Ga0068868_100145905 Ga0068868_1001459052 115
66 3300005339 Ga0070660_100042412 Ga0070660_1000424123 115
67 3300005339 Ga0070660_101018075 Ga0070660_1010180752 115
68 3300005341 Ga0070691_10031575 Ga0070691_100315752 115
69 3300005343 Ga0070687_100705856 Ga0070687_1007058562 115
70 3300005344 Ga0070661_100010501 Ga0070661_1000105014 115
71 3300005344 Ga0070661_100056570 Ga0070661_1000565704 115
72 3300005345 Ga0070692_10006368 Ga0070692_100063682 115
73 3300005345 Ga0070692_10012804 Ga0070692_100128044 115
74 3300005353 Ga0070669_100370090 Ga0070669_1003700902 115
75 3300005353 Ga0070669_100857510 Ga0070669_1008575102 115
76 3300005364 Ga0070673_100073556 Ga0070673_1000735562 115
77 3300005366 Ga0070659_100023818 Ga0070659_1000238183 115
78 3300005366 Ga0070659_100051849 Ga0070659_1000518492 115
79 3300005367 Ga0070667_100126554 Ga0070667_1001265542 115
80 3300005440 Ga0070705_100000862 Ga0070705_1000008625 115
81 3300005441 Ga0070700_100044041 Ga0070700_1000440412 115
82 3300005444 Ga0070694_100000499 Ga0070694_10000049917 115
83 3300005444 Ga0070694_100058161 Ga0070694_1000581612 115
84 3300005445 Ga0070708_101056488 Ga0070708_1010564882 115
85 3300005455 Ga0070663_100006552 Ga0070663_1000065526 115
86 3300005455 Ga0070663_100968069 Ga0070663_1009680692 115
87 3300005457 Ga0070662_100008470 Ga0070662_1000084705 115
88 3300005458 Ga0070681_10041472 Ga0070681_100414724 115
89 3300005458 Ga0070681_10126137 Ga0070681_101261372 115
90 3300005459 Ga0068867_100002925 Ga0068867_1000029253 115
91 3300005459 Ga0068867_101549640 Ga0068867_1015496401 115
92 3300005467 Ga0070706_100579042 Ga0070706_1005790423 115
93 3300005467 Ga0070706_100979389 Ga0070706_1009793892 115
94 3300005530 Ga0070679_100004161 Ga0070679_1000041614 115
95 3300005530 Ga0070679_100522931 Ga0070679_1005229312 115
96 3300005535 Ga0070684_100007046 Ga0070684_1000070463 115
97 3300005535 Ga0070684_100009601 Ga0070684_1000096014 115
98 3300005535 Ga0070684_100088744 Ga0070684_1000887442 115
99 3300005539 Ga0068853_100001435 Ga0068853_1000014359 115
100 3300005543 Ga0070672_100119005 Ga0070672_1001190052 115
101 3300005545 Ga0070695_100020683 Ga0070695_1000206833 115
102 3300005546 Ga0070696_100000680 Ga0070696_1000006807 115
103 3300005547 Ga0070693_100001434 Ga0070693_1000014345 115
104 3300005547 Ga0070693_100041479 Ga0070693_1000414793 115
105 3300005563 Ga0068855_100038923 Ga0068855_1000389235 115
106 3300005564 Ga0070664_100007070 Ga0070664_1000070704 115
107 3300005564 Ga0070664_100048018 Ga0070664_1000480185 115
108 3300005564 Ga0070664_100084895 Ga0070664_1000848952 115
109 3300005577 Ga0068857_100010423 Ga0068857_1000104235 115
110 3300005577 Ga0068857_100084198 Ga0068857_1000841983 115
111 3300005577 Ga0068857_101839479 Ga0068857_1018394792 115
112 3300005578 Ga0068854_100016148 Ga0068854_1000161483 115
113 3300005614 Ga0068856_100000657 Ga0068856_10000065713 115
114 3300005617 Ga0068859_100002307 Ga0068859_1000023075 115
115 3300005618 Ga0068864_100031859 Ga0068864_1000318592 115
116 3300005719 Ga0068861_100027682 Ga0068861_1000276824 115
117 3300005834 Ga0068851_10161489 Ga0068851_101614891 115
118 3300005840 Ga0068870_10003115 Ga0068870_100031152 115
119 3300005841 Ga0068863_100056252 Ga0068863_1000562522 115
120 3300005842 Ga0068858_100705122 Ga0068858_1007051222 115
121 3300005843 Ga0068860_100039919 Ga0068860_1000399192 115
122 3300005844 Ga0068862_100006263 Ga0068862_1000062639 115
123 3300005937 Ga0081455_10001810 Ga0081455_1000181016 115
124 3300005937 Ga0081455_10054082 Ga0081455_100540823 115
125 3300006058 Ga0075432_10001182 Ga0075432_100011825 115
126 3300006358 Ga0068871_100039387 Ga0068871_1000393873 115
127 3300006852 Ga0075433_10076108 Ga0075433_100761083 115
128 3300006852 Ga0075433_11074727 Ga0075433_110747272 115
129 3300006871 Ga0075434_100857708 Ga0075434_1008577082 115
130 3300006881 Ga0068865_100129432 Ga0068865_1001294322 115
131 3300006914 Ga0075436_100483139 Ga0075436_1004831392 115
132 3300006931 Ga0097620_100002307 Ga0097620_1000023075 115
133 3300009093 Ga0105240_10451736 Ga0105240_104517362 115
134 3300009098 Ga0105245_10004844 Ga0105245_100048444 115
135 3300009148 Ga0105243_10860789 Ga0105243_108607892 115
136 3300009148 Ga0105243_11087913 Ga0105243_110879132 115
137 3300009174 Ga0105241_10000117 Ga0105241_100001172 115
138 3300009177 Ga0105248_10219671 Ga0105248_102196712 115
139 3300009551 Ga0105238_10382760 Ga0105238_103827602 115
140 3300009553 Ga0105249_10576810 Ga0105249_105768102 115
141 3300010375 Ga0105239_10112626 Ga0105239_101126262 115
142 3300010375 Ga0105239_11984611 Ga0105239_119846112 115
143 3300013100 Ga0157373_10001301 Ga0157373_100013014 115
144 3300013100 Ga0157373_10274605 Ga0157373_102746052 115
145 3300013100 Ga0157373_10326505 Ga0157373_103265053 115
146 3300013102 Ga0157371_10291560 Ga0157371_102915602 115
147 3300013102 Ga0157371_10406756 Ga0157371_104067562 115
148 3300013105 Ga0157369_10022751 Ga0157369_100227513 115
149 3300013307 Ga0157372_10003910 Ga0157372_1000391012 115
150 3300014497 Ga0182008_10210024 Ga0182008_102100242 115
151 3300014745 Ga0157377_10005359 Ga0157377_100053595 115
152 3300014969 Ga0157376_12279570 Ga0157376_122795701 115
153 3300015262 Ga0182007_10055766 Ga0182007_100557662 115
154 3300025321 Ga0207656_10118390 Ga0207656_101183902 115
155 3300025885 Ga0207653_10007291 Ga0207653_100072912 115
156 3300025901 Ga0207688_10000972 Ga0207688_1000097211 115
157 3300025903 Ga0207680_10770566 Ga0207680_107705662 115
158 3300025907 Ga0207645_10008414 Ga0207645_100084144 115
159 3300025908 Ga0207643_10001082 Ga0207643_100010825 115
160 3300025910 Ga0207684_10419324 Ga0207684_104193241 115
161 3300025911 Ga0207654_10002106 Ga0207654_100021066 115
162 3300025912 Ga0207707_10001157 Ga0207707_1000115713 115
163 3300025912 Ga0207707_10071418 Ga0207707_100714182 115
164 3300025913 Ga0207695_10369609 Ga0207695_103696092 115
165 3300025917 Ga0207660_10000638 Ga0207660_100006388 115
166 3300025917 Ga0207660_10331199 Ga0207660_103311992 115
167 3300025917 Ga0207660_11024364 Ga0207660_110243642 115
168 3300025919 Ga0207657_10000385 Ga0207657_1000038514 115
169 3300025919 Ga0207657_10811523 Ga0207657_108115232 115
170 3300025920 Ga0207649_10006029 Ga0207649_100060295 115
171 3300025920 Ga0207649_10098359 Ga0207649_100983592 115
172 3300025921 Ga0207652_10002294 Ga0207652_1000229413 115
173 3300025921 Ga0207652_10471599 Ga0207652_104715992 115
174 3300025921 Ga0207652_11341488 Ga0207652_113414882 115
175 3300025923 Ga0207681_10211160 Ga0207681_102111601 115
176 3300025923 Ga0207681_10376254 Ga0207681_103762542 115
177 3300025924 Ga0207694_10289213 Ga0207694_102892132 115
178 3300025925 Ga0207650_10041151 Ga0207650_100411512 115
179 3300025926 Ga0207659_11410697 Ga0207659_114106971 115
180 3300025932 Ga0207690_10038832 Ga0207690_100388322 115
181 3300025932 Ga0207690_10749118 Ga0207690_107491182 115
182 3300025933 Ga0207706_10007882 Ga0207706_100078826 115
183 3300025935 Ga0207709_10060050 Ga0207709_100600502 115
184 3300025936 Ga0207670_10050943 Ga0207670_100509432 115
185 3300025938 Ga0207704_10128145 Ga0207704_101281452 115
186 3300025940 Ga0207691_10418339 Ga0207691_104183393 115
187 3300025940 Ga0207691_11005664 Ga0207691_110056642 115
188 3300025941 Ga0207711_10832997 Ga0207711_108329972 115
189 3300025942 Ga0207689_10000204 Ga0207689_1000020424 115
190 3300025944 Ga0207661_10007223 Ga0207661_100072237 115
191 3300025944 Ga0207661_10372557 Ga0207661_103725571 115
192 3300025945 Ga0207679_10002954 Ga0207679_100029542 115
193 3300025945 Ga0207679_10027640 Ga0207679_100276405 115
194 3300025945 Ga0207679_10356719 Ga0207679_103567193 115
195 3300025949 Ga0207667_10009064 Ga0207667_100090646 115
196 3300025960 Ga0207651_10095121 Ga0207651_100951212 115
197 3300025981 Ga0207640_10088591 Ga0207640_100885912 115
198 3300026023 Ga0207677_11193813 Ga0207677_111938132 115
199 3300026035 Ga0207703_10616102 Ga0207703_106161022 115
200 3300026041 Ga0207639_10008111 Ga0207639_100081114 115
201 3300026067 Ga0207678_10000861 Ga0207678_100008619 115
202 3300026067 Ga0207678_11641101 Ga0207678_116411012 115
203 3300026078 Ga0207702_10004257 Ga0207702_100042576 115
204 3300026088 Ga0207641_10108868 Ga0207641_101088682 115
205 3300026095 Ga0207676_10019496 Ga0207676_100194964 115
206 3300026116 Ga0207674_10003861 Ga0207674_1000386113 115
207 3300026116 Ga0207674_10016989 Ga0207674_100169898 115
208 3300026118 Ga0207675_100023039 Ga0207675_1000230394 115
209 3300027907 Ga0207428_10009728 Ga0207428_100097284 115
210 3300028380 Ga0268265_10003933 Ga0268265_100039333 115
211 3300028381 Ga0268264_10043183 Ga0268264_100431832 115
212 3300031665 Ga0316575_10001733 Ga0316575_100017333 115
213 3300031691 Ga0316579_10625328 Ga0316579_106253281 115
214 3300031728 Ga0316578_10114951 Ga0316578_101149513 115
215 3300031733 Ga0316577_10096618 Ga0316577_100966181 115
216 3300031995 Ga0307409_100295986 Ga0307409_1002959862 115
217 3300034817 Ga0373948_0108534 Ga0373948_0108534_190_537 115
218 3300034820 Ga0373959_0008965 Ga0373959_0008965_279_626 115
219 3300035090 Ga0373949_0098128 Ga0373949_0098128_45_392 115
220 3300035091 Ga0373951_0072687 Ga0373951_0072687_518_865 115
221 3300035241 Ga0373961_0122662 Ga0373961_0122662_399_746 115
222 3300035242 Ga0373962_0042195 Ga0373962_0042195_882_1229 115
223 3300035398 Ga0316574_0000138 Ga0316574_0000138_6579_6932 115
224 3300036647 Ga0316582_0011632 Ga0316582_0011632_3635_3988 115
225 3300042005 Ga0439448_0000271 Ga0439448_0000271_6513_6860 115
226 3300042157 Ga0439458_0010794 Ga0439458_0010794_1553_1900 115
227 3300042438 Ga0439459_0000788 Ga0439459_0000788_3419_3766 115
228 3300042876 Ga0451577_0133145 Ga0451577_0133145_1581_1928 115
229 3300044706 Ga0466964_0041297 Ga0466964_0041297_546_893 115
230 3300045051 Ga0451576_0464995 Ga0451576_0464995_933_1280 115
231 3300045976 Ga0466967_1780451 Ga0466967_1780451_171_521 115
232 3300048905 Ga0496102_1566113 Ga0496102_1566113_20_367 115
233 3300048914 Ga0496111_1276058 Ga0496111_1276058_136_489 115
234 3300048915 Ga0496112_1768176 Ga0496112_1768176_112_459 115
235 3300049570 Ga0501033_0458070 Ga0501033_0458070_313_660 115
236 3300049572 Ga0501036_0110798 Ga0501036_0110798_654_1001 115
237 3300049574 Ga0501038_0053153 Ga0501038_0053153_440_787 115
238 3300049575 Ga0501039_0016451 Ga0501039_0016451_1721_2068 115
239 3300049575 Ga0501039_0589291 Ga0501039_0589291_294_641 115
240 3300049576 Ga0501040_0116707 Ga0501040_0116707_184_531 115
241 3300049577 Ga0501041_0013683 Ga0501041_0013683_1755_2102 115
242 3300049578 Ga0501042_0305896 Ga0501042_0305896_343_690 115
243 3300049579 Ga0501043_0024004 Ga0501043_0024004_2248_2595 115
244 3300049580 Ga0501046_0030951 Ga0501046_0030951_84_431 115
245 3300049582 Ga0501048_0091568 Ga0501048_0091568_1145_1492 115
246 3300049584 Ga0501068_0015269 Ga0501068_0015269_1233_1580 115
247 3300049585 Ga0501069_0061079 Ga0501069_0061079_178_525 115
248 3300049587 Ga0501071_0014613 Ga0501071_0014613_258_605 115
249 3300049588 Ga0501072_0005506 Ga0501072_0005506_3012_3359 115
250 3300049590 Ga0501074_0033114 Ga0501074_0033114_1289_1636 115
251 3300049591 Ga0501075_0011674 Ga0501075_0011674_2294_2641 115
252 3300049592 Ga0501076_0023575 Ga0501076_0023575_545_892 115
253 3300049593 Ga0501077_0005159 Ga0501077_0005159_2377_2724 115
254 3300049593 Ga0501077_0108480 Ga0501077_0108480_1254_1601 115
255 3300049741 Ga0501079_0013687 Ga0501079_0013687_3728_4075 115
256 3300049741 Ga0501079_1619473 Ga0501079_1619473_67_414 115
257 3300049742 Ga0501080_0063187 Ga0501080_0063187_2126_2473 115
258 3300049743 Ga0501081_0021771 Ga0501081_0021771_1714_2061 115
259 3300049744 Ga0501083_0310581 Ga0501083_0310581_24_371 115
260 3300049822 Ga0501035_0026763 Ga0501035_0026763_4485_4832 115
261 3300049824 Ga0501045_0005683 Ga0501045_0005683_2294_2641 115
262 3300050511 nmdc:mga08y16_42420_c1 nmdc:mga08y16_42420_c1_3637_3984 115
263 3300050512 nmdc:mga0n895_95052_c1 nmdc:mga0n895_95052_c1_2453_2800 115
264 3300050513 nmdc:mga0rr50_183150_c1 nmdc:mga0rr50_183150_c1_939_1286 115
265 3300050514 nmdc:mga08x19_864901_c1 nmdc:mga08x19_864901_c1_256_603 115
266 3300050515 nmdc:mga0a205_94369_c1 nmdc:mga0a205_94369_c1_1870_2217 115
267 3300054114 Ga0501084_0007618 Ga0501084_0007618_6638_6985 115
268 3300060353 Ga0501082_0037276 Ga0501082_0037276_545_892 115
269 3300061734 Ga0530510_0113945 Ga0530510_0113945_1319_1666 115
270 3300005435 Ga0070714_100004989 Ga0070714_10000498910 116
271 3300025929 Ga0207664_10000796 Ga0207664_1000079618 116
272 3300026041 Ga0207639_10156415 Ga0207639_101564152 116
273 3300032126 Ga0307415_100074625 Ga0307415_1000746253 116
274 3300037588 Ga0316581_0005873 Ga0316581_0005873_1697_2047 116
275 3300045976 Ga0466967_0124319 Ga0466967_0124319_410_784 116
276 3300049588 Ga0501072_0132819 Ga0501072_0132819_677_1036 116
277 3300049592 Ga0501076_0221117 Ga0501076_0221117_889_1248 116
278 3300049660 Ga0501216_028939 Ga0501216_028939_312_662 116
279 3300049664 Ga0501224_068775 Ga0501224_068775_121_471 116
280 3300049822 Ga0501035_1253745 Ga0501035_1253745_140_499 116
281 3300049823 Ga0501044_0167738 Ga0501044_0167738_1009_1359 116
282 3300054114 Ga0501084_0135784 Ga0501084_0135784_294_653 116
283 3300060353 Ga0501082_1195561 Ga0501082_1195561_46_405 116
284 iso_pu_bacteria 2739367664 2739652395 116
285 iso_pu_bacteria 2739367865 2740030868 116
286 3300006844 Ga0075428_100256266 Ga0075428_1002562662 117
287 3300013307 Ga0157372_11064420 Ga0157372_110644202 117
288 3300014969 Ga0157376_11143361 Ga0157376_111433612 117
289 3300050507 nmdc:mga05p37_90577_c1 nmdc:mga05p37_90577_c1_2236_2589 117
290 3300050515 nmdc:mga0a205_520346_c1 nmdc:mga0a205_520346_c1_200_553 117
291 iso_pu_bacteria 2684623219 2687239894 117
292 3300005341 Ga0070691_10430796 Ga0070691_104307961 118
293 3300005535 Ga0070684_100140406 Ga0070684_1001404063 118
294 3300006847 Ga0075431_100009051 Ga0075431_1000090518 118
295 3300013105 Ga0157369_10006649 Ga0157369_1000664916 118
296 3300025917 Ga0207660_10113379 Ga0207660_101133793 118
297 3300025945 Ga0207679_10118573 Ga0207679_101185734 118
298 3300044735 Ga0466968_0303017 Ga0466968_0303017_142_507 118
299 3300049572 Ga0501036_0335339 Ga0501036_0335339_206_574 118
300 3300049575 Ga0501039_0707981 Ga0501039_0707981_130_498 118
301 3300049576 Ga0501040_0501128 Ga0501040_0501128_88_456 118
302 3300049578 Ga0501042_0522231 Ga0501042_0522231_271_639 118
303 3300049580 Ga0501046_0333590 Ga0501046_0333590_470_838 118
304 3300049582 Ga0501048_0306526 Ga0501048_0306526_424_792 118
305 3300049584 Ga0501068_0962050 Ga0501068_0962050_115_483 118
306 3300049585 Ga0501069_0606842 Ga0501069_0606842_131_499 118
307 3300049588 Ga0501072_0535767 Ga0501072_0535767_20_388 118
308 3300049591 Ga0501075_0198575 Ga0501075_0198575_188_556 118
309 3300049592 Ga0501076_0851284 Ga0501076_0851284_191_559 118
310 3300049743 Ga0501081_0184157 Ga0501081_0184157_987_1355 118
311 3300060353 Ga0501082_0190990 Ga0501082_0190990_339_707 118
312 3300061734 Ga0530510_0477391 Ga0530510_0477391_516_872 118
313 3300038705 Ga0237819_04688 Ga0237819_04688_1243_1614 119
314 3300045976 Ga0466967_0292171 Ga0466967_0292171_1034_1402 119
315 3300049575 Ga0501039_0389194 Ga0501039_0389194_89_469 119
316 3300049577 Ga0501041_0148214 Ga0501041_0148214_49_429 119
317 3300049580 Ga0501046_0027422 Ga0501046_0027422_2259_2639 119
318 3300049587 Ga0501071_0083991 Ga0501071_0083991_1408_1788 119
319 3300049592 Ga0501076_0219343 Ga0501076_0219343_796_1176 119
320 3300049593 Ga0501077_0016179 Ga0501077_0016179_1954_2334 119
321 3300049741 Ga0501079_0080916 Ga0501079_0080916_1941_2321 119
322 3300049742 Ga0501080_0883503 Ga0501080_0883503_292_672 119
323 3300054114 Ga0501084_0122341 Ga0501084_0122341_777_1157 119
324 3300060353 Ga0501082_1525264 Ga0501082_1525264_122_502 119
325 2162886007 SwRhRL2b_contig_2101747 SwRhRL2b_0715.00004990 120
326 3300002075 JGI24738J21930_10031911 JGI24738J21930_100319112 120
327 3300005289 Ga0065704_10071643 Ga0065704_1007164311 120
328 3300005331 Ga0070670_101822282 Ga0070670_1018222821 120
329 3300005334 Ga0068869_100034073 Ga0068869_1000340732 120
330 3300005340 Ga0070689_100150927 Ga0070689_1001509273 120
331 3300005344 Ga0070661_100000034 Ga0070661_10000003411 120
332 3300005458 Ga0070681_10135656 Ga0070681_101356563 120
333 3300005539 Ga0068853_100024740 Ga0068853_1000247405 120
334 3300005548 Ga0070665_100064968 Ga0070665_1000649683 120
335 3300005563 Ga0068855_100028902 Ga0068855_1000289023 120
336 3300005578 Ga0068854_100116023 Ga0068854_1001160233 120
337 3300005618 Ga0068864_100016656 Ga0068864_1000166567 120
338 3300005834 Ga0068851_10082072 Ga0068851_100820722 120
339 3300009011 Ga0105251_10000071 Ga0105251_1000007126 120
340 3300009093 Ga0105240_10039090 Ga0105240_100390903 120
341 3300009177 Ga0105248_10028435 Ga0105248_100284358 120
342 3300009545 Ga0105237_11126638 Ga0105237_111266382 120
343 3300009551 Ga0105238_10018476 Ga0105238_100184765 120
344 3300010375 Ga0105239_10009809 Ga0105239_1000980910 120
345 3300013100 Ga0157373_10190869 Ga0157373_101908692 120
346 3300013104 Ga0157370_10262940 Ga0157370_102629403 120
347 3300014326 Ga0157380_11427851 Ga0157380_114278512 120
348 3300025735 Ga0207713_1001241 Ga0207713_100124111 120
349 3300025904 Ga0207647_10000037 Ga0207647_1000003748 120
350 3300025909 Ga0207705_10697806 Ga0207705_106978062 120
351 3300025911 Ga0207654_10315766 Ga0207654_103157662 120
352 3300025913 Ga0207695_10105291 Ga0207695_101052912 120
353 3300025920 Ga0207649_10000045 Ga0207649_1000004511 120
354 3300025924 Ga0207694_10053786 Ga0207694_100537864 120
355 3300025949 Ga0207667_10389071 Ga0207667_103890712 120
356 3300025981 Ga0207640_10249979 Ga0207640_102499792 120
357 3300026041 Ga0207639_11342001 Ga0207639_113420012 120
358 3300026095 Ga0207676_10003457 Ga0207676_1000345711 120
359 3300026116 Ga0207674_10032525 Ga0207674_100325257 120
360 3300026142 Ga0207698_10157493 Ga0207698_101574934 120
361 3300028379 Ga0268266_10135117 Ga0268266_101351172 120
362 3300028800 Ga0265338_10379651 Ga0265338_103796513 120
363 3300031731 Ga0307405_10509065 Ga0307405_105090652 120
364 3300045976 Ga0466967_0587841 Ga0466967_0587841_213_581 120
365 3300048903 Ga0496100_0000293 Ga0496100_0000293_973_1335 120
366 3300048904 Ga0496101_0017412 Ga0496101_0017412_2423_2785 120
367 3300048908 Ga0496105_0531873 Ga0496105_0531873_467_829 120
368 3300048909 Ga0496106_0000047 Ga0496106_0000047_57749_58111 120
369 3300048910 Ga0496107_0000035 Ga0496107_0000035_86021_86383 120
370 3300048919 Ga0496116_0000193 Ga0496116_0000193_17322_17684 120
371 3300048920 Ga0496117_0001656 Ga0496117_0001656_17236_17598 120
372 3300048921 Ga0496118_0000156 Ga0496118_0000156_17664_18026 120
373 3300048924 Ga0496121_0048856 Ga0496121_0048856_210_572 120
374 3300048927 Ga0496124_0277220 Ga0496124_0277220_15_377 120
375 3300048929 Ga0496126_1420071 Ga0496126_1420071_111_473 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

3

111

0.97

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

1

130

0.95

PF22751

DUF488-N3a

Active DUF488-N3 subclade

2

115

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hci-assembly4.cif.gz_F-5 gpn-loop gtpase npa3 in complex with gdp 0.3865 22 98
5hci-assembly3.cif.gz_C-4 gpn-loop gtpase npa3 in complex with gdp 0.3854 22 98
3qpu-assembly1.cif.gz_A-2 pfkfb3 in complex with ppi 0.3853 20 115
5hci-assembly2.cif.gz_B-3 gpn-loop gtpase npa3 in complex with gdp 0.3769 22 98
2zi5-assembly2.cif.gz_C-2 c4s dck variant of dck in complex with l-da+udp 0.3362 53 117
ID Description Score Start End Superfamily
af_F1QGU0_1_82_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.517 82 118 3.40.50.1000
af_Q08726_3_267_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.4781 20 119 3.40.50.300
af_P87074_686_778_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.466 20 104 3.40.50.10190
af_P9WMT1_364_436_3.30.300.350 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;GTP-binding protein OBG, C-terminal domain 0.4447 50 101 3.30.300.350
af_A0A2R8QQ92_401_622_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.436 82 116 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A494TC78-F1-model_v4 DUF488 domain-containing protein 0.9963 6 120
AF-A0A2A6LC56-F1-model_v4 DUF488 domain-containing protein 0.9926 6 118
AF-A0A1R4EVU6-F1-model_v4 Uroporphyrin-III c-methyltransferase 0.9925 6 118
AF-A0A4U8Z269-F1-model_v4 Uroporphyrin-III C-methyltransferase 0.9917 6 118
AF-A0A503L7W6-F1-model_v4 DUF488 domain-containing protein 0.9903 7 117

Feature Viewer

pLDDT pTM Quality
92.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map