F426741

General Info

Members Datasets Scaffolds Average Seq Length
374 268 748 340

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100171109|Ga0207675_1001711091
Length 410
Sequence MYVSGYQEDLSNTTVTILSGPSNAGTQGSPVWGGGWGWANILPGTYVVRVSTSCGSQDYTVTANPSPAQIWHQAITAEALSAGVILPDATTSPRWEANDRPSLKKAFDAAGIESDIQNAGGDKAKFGTICDGMINSGVSVLMIVNLDSDSGGACLKKAAAAGIKSIDYDRLTLGGGASYYVSFDNVKVGELMGQGLATCLDKMGKKTANIVFINGDPTDNNAALFKSGYVKALKPKMDSGAYKLVGDQTGLWDATKAGTAFEQIYTQNQGKVDGVVSANDTMAGGIIARLAANGLAGKVPVTGQDASVEGLQAILKGTQCMTVYKDTNLEAKAASDLAIALIKGDQAKADSLATGSVKDTETGKQVPSALATPEAIFQDSVKTVIADGFQPKSKVCAGSYADLCTKYGVQ

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 2643221572 Leifsonia sp. Root60 Isolate Unclassified
250 2643221615 Nocardioides sp. Root224 Isolate Unclassified
251 2643221649 Leifsonia sp. Root4 Isolate Unclassified
252 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
253 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
254 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
255 2773857759 Microbacterium sp. 1294 Isolate Unclassified
256 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
257 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
258 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
259 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
260 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
261 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
262 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
263 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
264 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
265 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
266 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
267 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
268 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75.4
Metatranscriptomes 19.25
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 9.63
Rhizosphere 82.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100171109 3300026118 Bacteria 2076
2 JGI24752J21851_1007075 3300001976 Bacteria 1464
3 JGI24033J26618_1004036 3300002155 Bacteria 1570
4 JGI24751J29686_10003451 3300002459 Bacteria 3183
5 Ga0006562J51391_1195128 3300003578 Bacteria 10740
6 Ga0058862_10120182 3300004803 Bacteria 1706
7 Ga0070658_10039892 3300005327 Bacteria 3788
8 Ga0070658_10042976 3300005327 Bacteria 3651
9 Ga0070676_10030518 3300005328 Bacteria 3074
10 Ga0070683_100051929 3300005329 Bacteria 3797
11 Ga0070683_100060948 3300005329 Bacteria 3507
12 Ga0070683_100108786 3300005329 Bacteria 2614
13 Ga0070670_100004660 3300005331 Bacteria 11506
14 Ga0068869_100003684 3300005334 Bacteria 9423
15 Ga0070680_100022765 3300005336 Bacteria 4992
16 Ga0070682_100001902 3300005337 Bacteria 11650
17 Ga0068868_100014790 3300005338 Bacteria 5760
18 Ga0068868_100132603 3300005338 Bacteria 2040
19 Ga0070660_100029157 3300005339 Bacteria 4133
20 Ga0070691_10001852 3300005341 Bacteria 9222
21 Ga0070661_100018027 3300005344 Bacteria 5015
22 Ga0070692_10031080 3300005345 Bacteria 2674
23 Ga0070675_100161452 3300005354 Bacteria 1927
24 Ga0070659_100034257 3300005366 Bacteria 3949
25 Ga0070659_100105172 3300005366 Bacteria 2274
26 Ga0070667_100148746 3300005367 Bacteria 2056
27 Ga0070701_10061844 3300005438 Bacteria 1976
28 Ga0070711_100053656 3300005439 Bacteria 2779
29 Ga0070663_100010651 3300005455 Bacteria 5737
30 Ga0070678_100003592 3300005456 Bacteria 8652
31 Ga0070681_10060543 3300005458 Bacteria 3762
32 Ga0070685_10033541 3300005466 Bacteria 2885
33 Ga0070679_100060906 3300005530 Bacteria 3762
34 Ga0070684_100049081 3300005535 Bacteria 3662
35 Ga0070684_100288757 3300005535 Bacteria 1503
36 Ga0068853_100191458 3300005539 Bacteria 1858
37 Ga0070672_100120285 3300005543 Bacteria 2149
38 Ga0070693_100003997 3300005547 Bacteria 6928
39 Ga0070665_100024455 3300005548 Bacteria 6083
40 Ga0070664_100004594 3300005564 Bacteria 11079
41 Ga0070664_100044709 3300005564 Bacteria 3739
42 Ga0070664_100176261 3300005564 Bacteria 1898
43 Ga0068857_100066874 3300005577 Bacteria 3198
44 Ga0068857_100175150 3300005577 Bacteria 1951
45 Ga0068856_100013838 3300005614 Bacteria 7800
46 Ga0068856_100062519 3300005614 Bacteria 3678
47 Ga0070702_100000119 3300005615 Bacteria 23939
48 Ga0068852_100044759 3300005616 Bacteria 3762
49 Ga0068859_100092730 3300005617 Bacteria 3072
50 Ga0068864_100017545 3300005618 Bacteria 5968
51 Ga0068851_10058589 3300005834 Bacteria 1969
52 Ga0068870_10002831 3300005840 Bacteria 7303
53 Ga0068870_10020936 3300005840 Bacteria 3193
54 Ga0068863_100003025 3300005841 Bacteria 16623
55 Ga0068858_100021093 3300005842 Bacteria 6085
56 Ga0081455_10002971 3300005937 Bacteria 19821
57 Ga0081540_1024505 3300005983 Bacteria 3500
58 Ga0075365_10002850 3300006038 Bacteria 8679
59 Ga0075364_10005358 3300006051 Bacteria 7450
60 Ga0075364_10137844 3300006051 Bacteria 1640
61 Ga0075432_10036794 3300006058 Bacteria 1702
62 Ga0097621_100008635 3300006237 Bacteria 7350
63 Ga0075433_10081186 3300006852 Bacteria 2859
64 Ga0075434_100010272 3300006871 Bacteria 8773
65 Ga0075436_100011132 3300006914 Bacteria 6167
66 Ga0097620_100092735 3300006931 Bacteria 3072
67 Ga0075435_100005908 3300007076 Bacteria 8613
68 Ga0105251_10023109 3300009011 Bacteria 3215
69 Ga0111539_10035968 3300009094 Bacteria 5991
70 Ga0105245_10002680 3300009098 Bacteria 16017
71 Ga0105245_10077789 3300009098 Bacteria 3025
72 Ga0105247_10021253 3300009101 Bacteria 3905
73 Ga0105247_10115630 3300009101 Bacteria 1731
74 Ga0105243_10145037 3300009148 Bacteria 2030
75 Ga0105241_10011145 3300009174 Bacteria 6591
76 Ga0105248_10038700 3300009177 Bacteria 5338
77 Ga0105237_10167365 3300009545 Bacteria 2197
78 Ga0105238_10159922 3300009551 Bacteria 2228
79 Ga0105249_10133493 3300009553 Bacteria 2373
80 Ga0105239_10537588 3300010375 Bacteria 1330
81 Ga0105246_10005081 3300011119 Bacteria 8007
82 Ga0157370_10014682 3300013104 Bacteria 8000
83 Ga0157369_10070016 3300013105 Bacteria 3768
84 Ga0157369_10188871 3300013105 Bacteria 2165
85 Ga0157369_10251773 3300013105 Bacteria 1843
86 Ga0171462_1004 3300013250 Bacteria 678877
87 Ga0157374_10020210 3300013296 Bacteria 5906
88 Ga0163162_10199570 3300013306 Bacteria 2129
89 Ga0163162_10346939 3300013306 Bacteria 1617
90 Ga0157372_10051828 3300013307 Bacteria 4567
91 Ga0157375_10204613 3300013308 Bacteria 2130
92 Ga0163163_10040175 3300014325 Bacteria 4567
93 Ga0163163_10113474 3300014325 Bacteria 2740
94 Ga0163163_10208538 3300014325 Bacteria 2003
95 Ga0157379_10091560 3300014968 Bacteria 2728
96 Ga0163161_10040640 3300017792 Bacteria 3341
97 Ga0197907_10679004 3300020069 Bacteria 3886
98 Ga0206356_10649433 3300020070 Bacteria 2627
99 Ga0206349_1946612 3300020075 Bacteria 1860
100 Ga0206351_10663125 3300020077 Bacteria 1760
101 Ga0206350_10205061 3300020080 Bacteria 2564
102 Ga0206354_10768629 3300020081 Bacteria 1273
103 Ga0206354_11076112 3300020081 Bacteria 2950
104 Ga0206353_10153946 3300020082 Bacteria 4983
105 Ga0206353_10816368 3300020082 Bacteria 2226
106 Ga0224712_10005002 3300022467 Bacteria 3643
107 Ga0224712_10069607 3300022467 Bacteria 1425
108 Ga0207656_10084762 3300025321 Bacteria 1430
109 Ga0207692_10047178 3300025898 Bacteria 2162
110 Ga0207710_10014858 3300025900 Bacteria 3288
111 Ga0207688_10009653 3300025901 Bacteria 5254
112 Ga0207688_10015743 3300025901 Bacteria 4102
113 Ga0207688_10146287 3300025901 Bacteria 1393
114 Ga0207643_10000117 3300025908 Bacteria 54338
115 Ga0207643_10030270 3300025908 Bacteria 3011
116 Ga0207705_10006784 3300025909 Bacteria 8464
117 Ga0207654_10010633 3300025911 Bacteria 4686
118 Ga0207707_10041924 3300025912 Bacteria 3996
119 Ga0207663_10027752 3300025916 Bacteria 3305
120 Ga0207660_10005341 3300025917 Bacteria 8345
121 Ga0207657_10007220 3300025919 Bacteria 11410
122 Ga0207649_10005154 3300025920 Bacteria 7062
123 Ga0207652_10023163 3300025921 Bacteria 5142
124 Ga0207694_10120146 3300025924 Bacteria 2097
125 Ga0207694_10218467 3300025924 Bacteria 1554
126 Ga0207650_10000493 3300025925 Bacteria 32882
127 Ga0207659_10006521 3300025926 Bacteria 7157
128 Ga0207687_10008336 3300025927 Bacteria 6782
129 Ga0207687_10204107 3300025927 Bacteria 1547
130 Ga0207700_10029465 3300025928 Bacteria 3874
131 Ga0207644_10006761 3300025931 Bacteria 7474
132 Ga0207690_10006440 3300025932 Bacteria 6959
133 Ga0207709_10062652 3300025935 Bacteria 2328
134 Ga0207691_10024992 3300025940 Bacteria 5612
135 Ga0207711_10194470 3300025941 Bacteria 1850
136 Ga0207689_10007638 3300025942 Bacteria 9467
137 Ga0207661_10005874 3300025944 Bacteria 8661
138 Ga0207661_10036531 3300025944 Bacteria 3835
139 Ga0207679_10002230 3300025945 Bacteria 11971
140 Ga0207679_10003698 3300025945 Bacteria 9479
141 Ga0207668_10085142 3300025972 Bacteria 2306
142 Ga0207640_10019758 3300025981 Bacteria 3986
143 Ga0207703_10014677 3300026035 Bacteria 6113
144 Ga0207678_10012282 3300026067 Bacteria 7520
145 Ga0207708_10171673 3300026075 Bacteria 1718
146 Ga0207702_10002078 3300026078 Bacteria 19339
147 Ga0207702_10011057 3300026078 Bacteria 7534
148 Ga0207641_10021266 3300026088 Bacteria 5333
149 Ga0207676_10001839 3300026095 Bacteria 15547
150 Ga0207675_100102559 3300026118 Bacteria 2696
151 Ga0207683_10001487 3300026121 Bacteria 21129
152 Ga0207683_10058995 3300026121 Bacteria 3370
153 Ga0207698_10006951 3300026142 Bacteria 7080
154 Ga0207428_10008608 3300027907 Bacteria 9211
155 Ga0268266_10041225 3300028379 Bacteria 3938
156 Ga0268264_10325130 3300028381 Bacteria 1456
157 Ga0307413_10068755 3300031824 Bacteria 2220
158 Ga0307409_100006730 3300031995 Bacteria 6797
159 Ga0307409_100111267 3300031995 Bacteria 2297
160 Ga0307416_100010878 3300032002 Bacteria 6035
161 Ga0307414_10106194 3300032004 Bacteria 2125
162 Ga0307414_10167911 3300032004 Bacteria 1751
163 Ga0307411_10167133 3300032005 Bacteria 1655
164 Ga0307415_100003106 3300032126 Bacteria 8400
165 Ga0395905_0056813 3300037471 Bacteria 3660
166 Ga0395901_0060056 3300038443 Bacteria 3956
167 Ga0439447_034231 3300041407 Bacteria 1263
168 Ga0439461_0004884 3300041410 Bacteria 2260
169 Ga0451791_0043219 3300041451 Bacteria 1349
170 Ga0451793_1791310 3300041452 Bacteria 1503
171 Ga0451807_1113347 3300041486 Bacteria 1151
172 Ga0439431_0001367 3300041997 Bacteria 5384
173 Ga0439442_008604 3300042002 Bacteria 2060
174 Ga0439448_0010035 3300042005 Bacteria 2799
175 Ga0439446_0010139 3300042156 Bacteria 2534
176 Ga0439434_0001789 3300042435 Bacteria 6251
177 Ga0439464_0013293 3300042439 Bacteria 2203
178 Ga0439464_0035382 3300042439 Bacteria 1410
179 Ga0451577_0096760 3300042876 Bacteria 2636
180 Ga0466972_0114992 3300044658 Bacteria 1270
181 Ga0466965_0031508 3300044683 Bacteria 2586
182 Ga0466965_0034137 3300044683 Bacteria 2488
183 Ga0466961_0071467 3300044693 Bacteria 2202
184 Ga0466964_0017227 3300044706 Bacteria 2765
185 Ga0466970_0083738 3300044765 Bacteria 1726
186 Ga0466960_0002060 3300044901 Bacteria 7472
187 Ga0466960_0095482 3300044901 Bacteria 1522
188 Ga0466959_0157316 3300045049 Bacteria 1599
189 Ga0466958_0098315 3300045836 Bacteria 1817
190 Ga0466967_0023189 3300045976 Bacteria 5082
191 Ga0495638_0104068 3300046460 Bacteria 1693
192 Ga0495657_0130587 3300046675 Bacteria 1574
193 Ga0496100_0047488 3300048903 Bacteria 2767
194 Ga0496101_0041875 3300048904 Bacteria 3268
195 Ga0496102_0012562 3300048905 Bacteria 7335
196 Ga0496102_0320295 3300048905 Bacteria 1461
197 Ga0496102_0361532 3300048905 Bacteria 1367
198 Ga0496103_0188923 3300048906 Bacteria 1324
199 Ga0496104_0006768 3300048907 Bacteria 10095
200 Ga0496104_0097321 3300048907 Bacteria 2816
201 Ga0496104_0337097 3300048907 Bacteria 1421
202 Ga0496105_0004191 3300048908 Bacteria 10828
203 Ga0496106_0038926 3300048909 Bacteria 3560
204 Ga0496107_0013062 3300048910 Bacteria 5802
205 Ga0496107_0084620 3300048910 Bacteria 2314
206 Ga0496108_0001459 3300048911 Bacteria 18696
207 Ga0496108_0101990 3300048911 Bacteria 2448
208 Ga0496109_0030503 3300048912 Bacteria 4832
209 Ga0496109_0099696 3300048912 Bacteria 2694
210 Ga0496109_0121478 3300048912 Bacteria 2434
211 Ga0496110_0009935 3300048913 Bacteria 7715
212 Ga0496110_0310577 3300048913 Bacteria 1436
213 Ga0496111_0003674 3300048914 Bacteria 9529
214 Ga0496111_0026254 3300048914 Bacteria 4112
215 Ga0496112_0054827 3300048915 Bacteria 3917
216 Ga0496113_0001314 3300048916 Bacteria 13737
217 Ga0496113_0030079 3300048916 Bacteria 3928
218 Ga0496114_0010720 3300048917 Bacteria 7295
219 Ga0496114_0028479 3300048917 Bacteria 4585
220 Ga0496114_0038335 3300048917 Bacteria 3965
221 Ga0496114_0057030 3300048917 Bacteria 3260
222 Ga0496114_0124715 3300048917 Bacteria 2219
223 Ga0496114_0269458 3300048917 Bacteria 1500
224 Ga0496114_0335969 3300048917 Bacteria 1336
225 Ga0496115_0268790 3300048918 Bacteria 1401
226 Ga0496119_0004907 3300048922 Bacteria 13082
227 Ga0501305_009279 3300049161 Bacteria 1290
228 Ga0501307_005535 3300049162 Bacteria 1335
229 Ga0501311_010316 3300049527 Bacteria 1132
230 Ga0501031_0042001 3300049568 Bacteria 2985
231 Ga0501032_0004883 3300049569 Bacteria 10034
232 Ga0501032_0190880 3300049569 Bacteria 1339
233 Ga0501033_0012849 3300049570 Bacteria 6385
234 Ga0501033_0014389 3300049570 Bacteria 6010
235 Ga0501033_0183085 3300049570 Bacteria 1501
236 Ga0501033_0187377 3300049570 Bacteria 1481
237 Ga0501034_0012497 3300049571 Bacteria 8766
238 Ga0501036_0000932 3300049572 Bacteria 21959
239 Ga0501036_0011046 3300049572 Bacteria 7467
240 Ga0501036_0047151 3300049572 Bacteria 3649
241 Ga0501038_0004339 3300049574 Bacteria 13191
242 Ga0501038_0008938 3300049574 Bacteria 9190
243 Ga0501039_0006885 3300049575 Bacteria 8647
244 Ga0501039_0017290 3300049575 Bacteria 5532
245 Ga0501041_0186335 3300049577 Bacteria 1300
246 Ga0501042_0002050 3300049578 Bacteria 12219
247 Ga0501042_0045472 3300049578 Bacteria 3129
248 Ga0501042_0069141 3300049578 Bacteria 2525
249 Ga0501042_0092809 3300049578 Bacteria 2168
250 Ga0501042_0119290 3300049578 Bacteria 1899
251 Ga0501043_0073792 3300049579 Bacteria 2679
252 Ga0501043_0095156 3300049579 Bacteria 2341
253 Ga0501046_0001814 3300049580 Bacteria 20332
254 Ga0501046_0012936 3300049580 Bacteria 7094
255 Ga0501046_0019341 3300049580 Bacteria 5651
256 Ga0501047_0005964 3300049581 Bacteria 11450
257 Ga0501047_0168212 3300049581 Bacteria 2062
258 Ga0501047_0205934 3300049581 Bacteria 1826
259 Ga0501048_0012847 3300049582 Bacteria 6221
260 Ga0501048_0036737 3300049582 Bacteria 3521
261 Ga0501048_0211163 3300049582 Bacteria 1376
262 Ga0501067_0002075 3300049583 Bacteria 11034
263 Ga0501068_0054130 3300049584 Bacteria 2431
264 Ga0501070_0011575 3300049586 Bacteria 7449
265 Ga0501070_0091632 3300049586 Bacteria 2515
266 Ga0501070_0286664 3300049586 Bacteria 1343
267 Ga0501071_0300049 3300049587 Bacteria 1218
268 Ga0501073_0060970 3300049589 Bacteria 2632
269 Ga0501074_0070947 3300049590 Bacteria 2504
270 Ga0501075_0152769 3300049591 Bacteria 1760
271 Ga0501080_0364000 3300049742 Bacteria 1304
272 Ga0501083_0000052 3300049744 Bacteria 84349
273 Ga0501083_0004406 3300049744 Bacteria 9926
274 Ga0501035_0162147 3300049822 Bacteria 1934
275 Ga0501035_0162882 3300049822 Bacteria 1930
276 Ga0501035_0249533 3300049822 Bacteria 1507
277 Ga0501044_0093631 3300049823 Bacteria 3029
278 Ga0501044_0102473 3300049823 Bacteria 2878
279 Ga0501044_0138468 3300049823 Bacteria 2423
280 Ga0501044_0149380 3300049823 Bacteria 2320
281 Ga0501045_0025581 3300049824 Bacteria 4245
282 Ga0501045_0285995 3300049824 Bacteria 1227
283 nmdc:mga00v17_192517_c1 3300050491 Bacteria 1317
284 nmdc:mga00v17_863_c1 3300050491 Bacteria 16368
285 nmdc:mga0yw44_31662_c1 3300050492 Bacteria 2416
286 nmdc:mga0yw44_9277_c1 3300050492 Bacteria 4960
287 nmdc:mga08y16_33609_c1 3300050511 Bacteria 5386
288 nmdc:mga0n895_29226_c1 3300050512 Bacteria 5255
289 nmdc:mga0rr50_1772_c1 3300050513 Bacteria 11923
290 nmdc:mga08x19_41994_c1 3300050514 Bacteria 2914
291 nmdc:mga0a205_30486_c1 3300050515 Bacteria 5164
292 nmdc:mga0sz30_5349_c1 3300050516 Bacteria 4702
293 Ga0495619_0045682 3300053085 Bacteria 2878
294 Ga0500556_0004285 3300053104 Bacteria 4068
295 Ga0500593_002000 3300053117 Bacteria 7385
296 Ga0500559_0000727 3300053136 Bacteria 21701
297 Ga0501084_0280436 3300054114 Bacteria 1407
298 Ga0587084_001305 3300059477 Bacteria 2332
299 Ga0587084_006733 3300059477 Bacteria 1405
300 Ga0587093_007016 3300059478 Bacteria 1245
301 Ga0587070_000625 3300059491 Bacteria 3097
302 Ga0587070_013268 3300059491 Bacteria 1268
303 Ga0587073_0003282 3300059492 Bacteria 2203
304 Ga0587073_0004280 3300059492 Bacteria 2036
305 Ga0587073_0021248 3300059492 Bacteria 1247
306 Ga0587077_002036 3300059493 Bacteria 2315
307 Ga0587077_003735 3300059493 Bacteria 1942
308 Ga0587077_017950 3300059493 Bacteria 1212
309 Ga0587080_011619 3300059503 Bacteria 1319
310 Ga0587082_002224 3300059504 Bacteria 2157
311 Ga0587083_0004968 3300059505 Bacteria 1890
312 Ga0587083_0015623 3300059505 Bacteria 1328
313 Ga0587085_000953 3300059506 Bacteria 2467
314 Ga0587085_009446 3300059506 Bacteria 1271
315 Ga0587085_009900 3300059506 Bacteria 1253
316 Ga0587085_011751 3300059506 Bacteria 1189
317 Ga0587086_001153 3300059507 Bacteria 2197
318 Ga0587088_010721 3300059508 Bacteria 1349
319 Ga0587089_010073 3300059509 Bacteria 1171
320 Ga0587090_004778 3300059510 Bacteria 1663
321 Ga0587090_010594 3300059510 Bacteria 1281
322 Ga0587094_001847 3300059513 Bacteria 2094
323 Ga0587094_008922 3300059513 Bacteria 1267
324 Ga0587094_009368 3300059513 Bacteria 1249
325 Ga0587095_000476 3300059514 Bacteria 2072
326 Ga0587106_001951 3300059605 Bacteria 1943
327 Ga0587099_002849 3300059622 Bacteria 1397
328 Ga0587101_001298 3300059623 Bacteria 2112
329 Ga0587109_007251 3300059624 Bacteria 1669
330 Ga0587115_000445 3300059626 Bacteria 3044
331 Ga0587128_001189 3300059630 Bacteria 2369
332 Ga0587128_001751 3300059630 Bacteria 2122
333 Ga0587128_010003 3300059630 Bacteria 1265
334 Ga0587062_005152 3300059639 Bacteria 1429
335 Ga0587067_010191 3300059640 Bacteria 1419
336 Ga0587068_002406 3300059641 Bacteria 2270
337 Ga0587069_002487 3300059642 Bacteria 1864
338 Ga0587069_002630 3300059642 Bacteria 1837
339 Ga0587072_003529 3300059643 Bacteria 2205
340 Ga0587072_019418 3300059643 Bacteria 1190
341 Ga0587076_000545 3300059645 Bacteria 3165
342 Ga0587076_012055 3300059645 Bacteria 1284
343 Ga0587078_007737 3300059646 Bacteria 1194
344 Ga0587079_002727 3300059647 Bacteria 2209
345 Ga0587079_007160 3300059647 Bacteria 1658
346 Ga0587079_012932 3300059647 Bacteria 1374
347 Ga0587079_014612 3300059647 Bacteria 1321
348 Ga0587100_000621 3300059648 Bacteria 1775
349 Ga0587110_002298 3300059654 Bacteria 1502
350 Ga0587114_001477 3300059655 Bacteria 1981
351 Ga0587071_002191 3300060344 Bacteria 2611
352 Ga0587111_0002605 3300060346 Bacteria 2435
353 Ga0587111_0010217 3300060346 Bacteria 1606
354 Ga0530510_0065728 3300061734 Bacteria 2628
355 2643875657 2643221572 Bacteria 3614809
356 2644093876 2643221615 Bacteria 5487866
357 2644278826 2643221649 Bacteria 3867359
358 2644323720 2643221657 Bacteria 5490246
359 2644382712 2643221669 Bacteria 3611286
360 2676480193 2675903059 Bacteria 8644972
361 2774383957 2773857759 Bacteria 2963774
362 2774392251 2773857762 Bacteria 5971770
363 2774398885 2773857763 Bacteria 4180068
364 2809196059 2808606439 Bacteria 5952208
365 2809227895 2808606447 Bacteria 3572005
366 2812325045 2811994872 Bacteria 4121241
367 2812351814 2811994878 Bacteria 5992952
368 2819689642 2818991462 Bacteria 4320267
369 2819726805 2818991469 Bacteria 4644110
370 2833711533 2833709550 Bacteria 4008291
371 2852634652 2852632344 Bacteria 3463163
372 2855386891 2855386786 Bacteria 4752232
373 2891970557 2891968417 Bacteria 5821697
374 2977254509 2977251589 Bacteria 2952848
375 Ga0207675_100171109
376 JGI24752J21851_1007075
377 JGI24033J26618_1004036
378 JGI24751J29686_10003451
379 Ga0006562J51391_1195128
380 Ga0058862_10120182
381 Ga0070658_10039892
382 Ga0070658_10042976
383 Ga0070676_10030518
384 Ga0070683_100051929
385 Ga0070683_100060948
386 Ga0070683_100108786
387 Ga0070670_100004660
388 Ga0068869_100003684
389 Ga0070680_100022765
390 Ga0070682_100001902
391 Ga0068868_100014790
392 Ga0068868_100132603
393 Ga0070660_100029157
394 Ga0070691_10001852
395 Ga0070661_100018027
396 Ga0070692_10031080
397 Ga0070675_100161452
398 Ga0070659_100034257
399 Ga0070659_100105172
400 Ga0070667_100148746
401 Ga0070701_10061844
402 Ga0070711_100053656
403 Ga0070663_100010651
404 Ga0070678_100003592
405 Ga0070681_10060543
406 Ga0070685_10033541
407 Ga0070679_100060906
408 Ga0070684_100049081
409 Ga0070684_100288757
410 Ga0068853_100191458
411 Ga0070672_100120285
412 Ga0070693_100003997
413 Ga0070665_100024455
414 Ga0070664_100004594
415 Ga0070664_100044709
416 Ga0070664_100176261
417 Ga0068857_100066874
418 Ga0068857_100175150
419 Ga0068856_100013838
420 Ga0068856_100062519
421 Ga0070702_100000119
422 Ga0068852_100044759
423 Ga0068859_100092730
424 Ga0068864_100017545
425 Ga0068851_10058589
426 Ga0068870_10002831
427 Ga0068870_10020936
428 Ga0068863_100003025
429 Ga0068858_100021093
430 Ga0081455_10002971
431 Ga0081540_1024505
432 Ga0075365_10002850
433 Ga0075364_10005358
434 Ga0075364_10137844
435 Ga0075432_10036794
436 Ga0097621_100008635
437 Ga0075433_10081186
438 Ga0075434_100010272
439 Ga0075436_100011132
440 Ga0097620_100092735
441 Ga0075435_100005908
442 Ga0105251_10023109
443 Ga0111539_10035968
444 Ga0105245_10002680
445 Ga0105245_10077789
446 Ga0105247_10021253
447 Ga0105247_10115630
448 Ga0105243_10145037
449 Ga0105241_10011145
450 Ga0105248_10038700
451 Ga0105237_10167365
452 Ga0105238_10159922
453 Ga0105249_10133493
454 Ga0105239_10537588
455 Ga0105246_10005081
456 Ga0157370_10014682
457 Ga0157369_10070016
458 Ga0157369_10188871
459 Ga0157369_10251773
460 Ga0171462_1004
461 Ga0157374_10020210
462 Ga0163162_10199570
463 Ga0163162_10346939
464 Ga0157372_10051828
465 Ga0157375_10204613
466 Ga0163163_10040175
467 Ga0163163_10113474
468 Ga0163163_10208538
469 Ga0157379_10091560
470 Ga0163161_10040640
471 Ga0197907_10679004
472 Ga0206356_10649433
473 Ga0206349_1946612
474 Ga0206351_10663125
475 Ga0206350_10205061
476 Ga0206354_10768629
477 Ga0206354_11076112
478 Ga0206353_10153946
479 Ga0206353_10816368
480 Ga0224712_10005002
481 Ga0224712_10069607
482 Ga0207656_10084762
483 Ga0207692_10047178
484 Ga0207710_10014858
485 Ga0207688_10009653
486 Ga0207688_10015743
487 Ga0207688_10146287
488 Ga0207643_10000117
489 Ga0207643_10030270
490 Ga0207705_10006784
491 Ga0207654_10010633
492 Ga0207707_10041924
493 Ga0207663_10027752
494 Ga0207660_10005341
495 Ga0207657_10007220
496 Ga0207649_10005154
497 Ga0207652_10023163
498 Ga0207694_10120146
499 Ga0207694_10218467
500 Ga0207650_10000493
501 Ga0207659_10006521
502 Ga0207687_10008336
503 Ga0207687_10204107
504 Ga0207700_10029465
505 Ga0207644_10006761
506 Ga0207690_10006440
507 Ga0207709_10062652
508 Ga0207691_10024992
509 Ga0207711_10194470
510 Ga0207689_10007638
511 Ga0207661_10005874
512 Ga0207661_10036531
513 Ga0207679_10002230
514 Ga0207679_10003698
515 Ga0207668_10085142
516 Ga0207640_10019758
517 Ga0207703_10014677
518 Ga0207678_10012282
519 Ga0207708_10171673
520 Ga0207702_10002078
521 Ga0207702_10011057
522 Ga0207641_10021266
523 Ga0207676_10001839
524 Ga0207675_100102559
525 Ga0207683_10001487
526 Ga0207683_10058995
527 Ga0207698_10006951
528 Ga0207428_10008608
529 Ga0268266_10041225
530 Ga0268264_10325130
531 Ga0307413_10068755
532 Ga0307409_100006730
533 Ga0307409_100111267
534 Ga0307416_100010878
535 Ga0307414_10106194
536 Ga0307414_10167911
537 Ga0307411_10167133
538 Ga0307415_100003106
539 Ga0395905_0056813
540 Ga0395901_0060056
541 Ga0439447_034231
542 Ga0439461_0004884
543 Ga0451791_0043219
544 Ga0451793_1791310
545 Ga0451807_1113347
546 Ga0439431_0001367
547 Ga0439442_008604
548 Ga0439448_0010035
549 Ga0439446_0010139
550 Ga0439434_0001789
551 Ga0439464_0013293
552 Ga0439464_0035382
553 Ga0451577_0096760
554 Ga0466972_0114992
555 Ga0466965_0031508
556 Ga0466965_0034137
557 Ga0466961_0071467
558 Ga0466964_0017227
559 Ga0466970_0083738
560 Ga0466960_0002060
561 Ga0466960_0095482
562 Ga0466959_0157316
563 Ga0466958_0098315
564 Ga0466967_0023189
565 Ga0495638_0104068
566 Ga0495657_0130587
567 Ga0496100_0047488
568 Ga0496101_0041875
569 Ga0496102_0012562
570 Ga0496102_0320295
571 Ga0496102_0361532
572 Ga0496103_0188923
573 Ga0496104_0006768
574 Ga0496104_0097321
575 Ga0496104_0337097
576 Ga0496105_0004191
577 Ga0496106_0038926
578 Ga0496107_0013062
579 Ga0496107_0084620
580 Ga0496108_0001459
581 Ga0496108_0101990
582 Ga0496109_0030503
583 Ga0496109_0099696
584 Ga0496109_0121478
585 Ga0496110_0009935
586 Ga0496110_0310577
587 Ga0496111_0003674
588 Ga0496111_0026254
589 Ga0496112_0054827
590 Ga0496113_0001314
591 Ga0496113_0030079
592 Ga0496114_0010720
593 Ga0496114_0028479
594 Ga0496114_0038335
595 Ga0496114_0057030
596 Ga0496114_0124715
597 Ga0496114_0269458
598 Ga0496114_0335969
599 Ga0496115_0268790
600 Ga0496119_0004907
601 Ga0501305_009279
602 Ga0501307_005535
603 Ga0501311_010316
604 Ga0501031_0042001
605 Ga0501032_0004883
606 Ga0501032_0190880
607 Ga0501033_0012849
608 Ga0501033_0014389
609 Ga0501033_0183085
610 Ga0501033_0187377
611 Ga0501034_0012497
612 Ga0501036_0000932
613 Ga0501036_0011046
614 Ga0501036_0047151
615 Ga0501038_0004339
616 Ga0501038_0008938
617 Ga0501039_0006885
618 Ga0501039_0017290
619 Ga0501041_0186335
620 Ga0501042_0002050
621 Ga0501042_0045472
622 Ga0501042_0069141
623 Ga0501042_0092809
624 Ga0501042_0119290
625 Ga0501043_0073792
626 Ga0501043_0095156
627 Ga0501046_0001814
628 Ga0501046_0012936
629 Ga0501046_0019341
630 Ga0501047_0005964
631 Ga0501047_0168212
632 Ga0501047_0205934
633 Ga0501048_0012847
634 Ga0501048_0036737
635 Ga0501048_0211163
636 Ga0501067_0002075
637 Ga0501068_0054130
638 Ga0501070_0011575
639 Ga0501070_0091632
640 Ga0501070_0286664
641 Ga0501071_0300049
642 Ga0501073_0060970
643 Ga0501074_0070947
644 Ga0501075_0152769
645 Ga0501080_0364000
646 Ga0501083_0000052
647 Ga0501083_0004406
648 Ga0501035_0162147
649 Ga0501035_0162882
650 Ga0501035_0249533
651 Ga0501044_0093631
652 Ga0501044_0102473
653 Ga0501044_0138468
654 Ga0501044_0149380
655 Ga0501045_0025581
656 Ga0501045_0285995
657 nmdc:mga00v17_192517_c1
658 nmdc:mga00v17_863_c1
659 nmdc:mga0yw44_31662_c1
660 nmdc:mga0yw44_9277_c1
661 nmdc:mga08y16_33609_c1
662 nmdc:mga0n895_29226_c1
663 nmdc:mga0rr50_1772_c1
664 nmdc:mga08x19_41994_c1
665 nmdc:mga0a205_30486_c1
666 nmdc:mga0sz30_5349_c1
667 Ga0495619_0045682
668 Ga0500556_0004285
669 Ga0500593_002000
670 Ga0500559_0000727
671 Ga0501084_0280436
672 Ga0587084_001305
673 Ga0587084_006733
674 Ga0587093_007016
675 Ga0587070_000625
676 Ga0587070_013268
677 Ga0587073_0003282
678 Ga0587073_0004280
679 Ga0587073_0021248
680 Ga0587077_002036
681 Ga0587077_003735
682 Ga0587077_017950
683 Ga0587080_011619
684 Ga0587082_002224
685 Ga0587083_0004968
686 Ga0587083_0015623
687 Ga0587085_000953
688 Ga0587085_009446
689 Ga0587085_009900
690 Ga0587085_011751
691 Ga0587086_001153
692 Ga0587088_010721
693 Ga0587089_010073
694 Ga0587090_004778
695 Ga0587090_010594
696 Ga0587094_001847
697 Ga0587094_008922
698 Ga0587094_009368
699 Ga0587095_000476
700 Ga0587106_001951
701 Ga0587099_002849
702 Ga0587101_001298
703 Ga0587109_007251
704 Ga0587115_000445
705 Ga0587128_001189
706 Ga0587128_001751
707 Ga0587128_010003
708 Ga0587062_005152
709 Ga0587067_010191
710 Ga0587068_002406
711 Ga0587069_002487
712 Ga0587069_002630
713 Ga0587072_003529
714 Ga0587072_019418
715 Ga0587076_000545
716 Ga0587076_012055
717 Ga0587078_007737
718 Ga0587079_002727
719 Ga0587079_007160
720 Ga0587079_012932
721 Ga0587079_014612
722 Ga0587100_000621
723 Ga0587110_002298
724 Ga0587114_001477
725 Ga0587071_002191
726 Ga0587111_0002605
727 Ga0587111_0010217
728 Ga0530510_0065728
729 2643875657
730 2644093876
731 2644278826
732 2644323720
733 2644382712
734 2676480193
735 2774383957
736 2774392251
737 2774398885
738 2809196059
739 2809227895
740 2812325045
741 2812351814
742 2819689642
743 2819726805
744 2833711533
745 2852634652
746 2855386891
747 2891970557
748 2977254509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

83

346

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsp-assembly1.cif.gz_A permutated c-terminal lobe of the ribose binding protein from thermotoga maritima 0.939 133 229
4ywh-assembly2.cif.gz_B crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose 0.9158 6 319
4ywh-assembly2.cif.gz_B crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose 0.9074 6 319
7qsq-assembly2.cif.gz_B permutated n-terminal lobe of the ribose binding protein from thermotoga maritima 0.9071 6 97
3m9x-assembly1.cif.gz_A open liganded crystal structure of xylose binding protein from escherichia coli 0.9029 6 318
ID Description Score Start End Superfamily
4ywhB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9392 112 319 3.40.50.2300
af_P37387_122_310_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9364 105 300 3.50.50.60
af_P37387_129_330_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9316 112 318 3.40.50.2300
af_P37387_122_310_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9269 105 300 3.50.50.60
4ywhB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9221 112 319 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3M0YV07-F1-model_v4 deleted 0.9482 5 98
AF-A0A0A2W3K5-F1-model_v4 D-xylose-binding periplasmic protein 0.9468 139 318 GO:0030246
AF-A0A847H6A3-F1-model_v4 Substrate-binding domain-containing protein 0.9457 73 319 GO:0030246
GO:0030288
AF-A0A0A2W3K5-F1-model_v4 D-xylose-binding periplasmic protein 0.9366 139 318 GO:0030246
AF-H6NJK0-F1-model_v4 Ribose ABC transporter periplasmic component 0.9351 2 322 GO:0030246
GO:0030288

Map