F426731

General Info

Members Datasets Scaffolds Average Seq Length
374 261 748 243

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10653252|Ga0207700_106532521
Length 265
Sequence MTKSSGTILAGEGRPEGRGAGTGPRNLTEFKALTFDCYGTLIDWETGLYAALQPLLKRGGVTLKRDEVLAAYARHESAQEAATPQMIYSELLAEVHRRLAREWNVSDDENEAIAFGRSVPDWPAFPDTAASLQYLQRYYKLVILSNVDRASFAGSNPKLGVTFDAICTAQDIGSYKPDPRNFAYAINKVAELGVLKRQLLHTAQSLFHDHAPAQAAGLSSAWIDRRHQQEGWGATVPPAGTPKFDFRFPSMADMVKAHQAELQGR

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
245 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
249 2643221734 Bosea sp. Root670 Isolate Unclassified
250 2738541307 Variovorax sp. GV008 Isolate Unclassified
251 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
252 2855730933 Achromobacter sp. HZ28 Isolate Nodule
253 2855767633 Achromobacter sp. HZ34 Isolate Nodule
254 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
255 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
256 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
257 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
258 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
259 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
260 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
261 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.99
Metatranscriptomes 0.27
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 2.94
Rhizoplane 4.81
Rhizosphere 69.25
Stem 0
Stem Tuber 0
Unclassified 8.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10653252 3300025928 Bacteria 938
2 JGI25151J46595_10003504 3300003187 Bacteria 8648
3 JGI25153J46596_10000121 3300003215 Bacteria 89230
4 rootH1_10266639 3300003323 Bacteria 2594
5 Ga0055526_1002855 3300003771 Bacteria 11395
6 Ga0055524_1000778 3300003775 Bacteria 21394
7 Ga0055531_10022092 3300003794 Bacteria 2439
8 Ga0070683_100037944 3300005329 Bacteria 4413
9 Ga0070690_100149418 3300005330 Bacteria 1593
10 Ga0070666_10008791 3300005335 Bacteria 6276
11 Ga0070680_100005144 3300005336 Bacteria 9886
12 Ga0070668_100526328 3300005347 Bacteria 1026
13 Ga0070667_100066519 3300005367 Bacteria 3062
14 Ga0070709_10033573 3300005434 Bacteria 3104
15 Ga0070713_100021480 3300005436 Bacteria 4968
16 Ga0070713_100077380 3300005436 Bacteria 2828
17 Ga0070710_10003255 3300005437 Bacteria 7698
18 Ga0070710_10419110 3300005437 Bacteria 901
19 Ga0070711_100102890 3300005439 Bacteria 2081
20 Ga0070711_100172484 3300005439 Bacteria 1650
21 Ga0070705_100060147 3300005440 Bacteria 2252
22 Ga0070694_100421329 3300005444 Bacteria 1049
23 Ga0070708_100271835 3300005445 Unclassified 1594
24 Ga0070663_100280978 3300005455 Bacteria 1327
25 Ga0070678_100440385 3300005456 Bacteria 1139
26 Ga0070662_100694997 3300005457 Bacteria 860
27 Ga0070681_10010855 3300005458 Bacteria 9004
28 Ga0070681_10016632 3300005458 Bacteria 7343
29 Ga0070706_100341531 3300005467 Unclassified 1396
30 Ga0070679_100162101 3300005530 Bacteria 2210
31 Ga0070679_100457849 3300005530 Unclassified 1220
32 Ga0068853_100007223 3300005539 Bacteria 8898
33 Ga0070672_100316413 3300005543 Bacteria 1326
34 Ga0070695_100049056 3300005545 Bacteria 2702
35 Ga0070695_100066171 3300005545 Bacteria 2355
36 Ga0070696_100158869 3300005546 Bacteria 1664
37 Ga0070696_100161250 3300005546 Bacteria 1652
38 Ga0070665_100008593 3300005548 Bacteria 10331
39 Ga0070665_100021244 3300005548 Bacteria 6527
40 Ga0070665_100029539 3300005548 Bacteria 5518
41 Ga0068855_100001502 3300005563 Bacteria 29218
42 Ga0070702_100550374 3300005615 Bacteria 856
43 Ga0068852_100515920 3300005616 Unclassified 1192
44 Ga0068859_100122674 3300005617 Bacteria 2665
45 Ga0068861_100391333 3300005719 Bacteria 1231
46 Ga0068858_100063940 3300005842 Bacteria 3404
47 Ga0068858_100085547 3300005842 Bacteria 2933
48 Ga0068858_100525195 3300005842 Bacteria 1145
49 Ga0068860_100477828 3300005843 Bacteria 1242
50 Ga0068862_100081095 3300005844 Bacteria 2814
51 Ga0068862_100138126 3300005844 Bacteria 2161
52 Ga0081540_1008322 3300005983 Bacteria 7254
53 Ga0081540_1037536 3300005983 Bacteria 2566
54 Ga0075365_10287000 3300006038 Bacteria 1158
55 Ga0070715_10003409 3300006163 Bacteria 5048
56 Ga0070716_100082699 3300006173 Bacteria 1921
57 Ga0070712_100034507 3300006175 Bacteria 3429
58 Ga0097621_100017313 3300006237 Bacteria 5470
59 Ga0097621_100679831 3300006237 Bacteria 946
60 Ga0075370_10333136 3300006353 Bacteria 905
61 Ga0075428_100212776 3300006844 Bacteria 2089
62 Ga0075431_100025001 3300006847 Bacteria 6122
63 Ga0075434_100204466 3300006871 Bacteria 1995
64 Ga0068865_100054293 3300006881 Bacteria 2783
65 Ga0097620_100122677 3300006931 Bacteria 2665
66 Ga0075435_100179279 3300007076 Bacteria 1790
67 Ga0105240_10000743 3300009093 Bacteria 59524
68 Ga0105240_10009991 3300009093 Bacteria 13375
69 Ga0105240_10018078 3300009093 Bacteria 9478
70 Ga0105240_10024935 3300009093 Bacteria 7872
71 Ga0105240_10208543 3300009093 Bacteria 2285
72 Ga0105245_10014927 3300009098 Bacteria 6767
73 Ga0105245_10915628 3300009098 Bacteria 919
74 Ga0105247_10006819 3300009101 Bacteria 7040
75 Ga0105247_10166067 3300009101 Bacteria 1465
76 Ga0114129_10107334 3300009147 Bacteria 3857
77 Ga0114129_10190491 3300009147 Bacteria 2785
78 Ga0114129_10407009 3300009147 Bacteria 1792
79 Ga0105241_10049305 3300009174 Bacteria 3206
80 Ga0105241_10640889 3300009174 Bacteria 964
81 Ga0105242_10039719 3300009176 Bacteria 3788
82 Ga0105237_10024982 3300009545 Bacteria 6112
83 Ga0105237_10029992 3300009545 Bacteria 5526
84 Ga0105237_10101690 3300009545 Bacteria 2866
85 Ga0105237_10157549 3300009545 Bacteria 2268
86 Ga0105237_10333817 3300009545 Unclassified 1520
87 Ga0105238_10192910 3300009551 Bacteria 2013
88 Ga0105238_10245721 3300009551 Bacteria 1767
89 Ga0105238_10835043 3300009551 Unclassified 938
90 Ga0105239_10007470 3300010375 Bacteria 12543
91 Ga0105239_10073286 3300010375 Bacteria 3765
92 Ga0157369_10200410 3300013105 Bacteria 2095
93 Ga0157374_10082541 3300013296 Bacteria 3052
94 Ga0157374_10330671 3300013296 Bacteria 1511
95 Ga0157378_10032183 3300013297 Bacteria 4633
96 Ga0163162_10190140 3300013306 Bacteria 2180
97 Ga0163162_10199368 3300013306 Bacteria 2130
98 Ga0157372_10204960 3300013307 Bacteria 2285
99 Ga0157375_10042978 3300013308 Bacteria 4379
100 Ga0157375_10065866 3300013308 Bacteria 3613
101 Ga0163163_10439278 3300014325 Unclassified 1364
102 Ga0157380_10748859 3300014326 Bacteria 988
103 Ga0182008_10000079 3300014497 Bacteria 76874
104 Ga0157379_10075811 3300014968 Bacteria 3012
105 Ga0163161_10000389 3300017792 Bacteria 36885
106 Ga0163161_10421785 3300017792 Bacteria 1073
107 Ga0213876_10123667 3300021384 Bacteria 1374
108 Ga0213875_10001439 3300021388 Bacteria 15431
109 Ga0209026_1006941 3300025250 Unclassified 2657
110 Ga0209675_1001065 3300025291 Bacteria 17013
111 Ga0209025_1000003 3300025294 Bacteria 1366495
112 Ga0209564_1000052 3300025295 Bacteria 356578
113 Ga0209758_1000202 3300025297 Bacteria 132401
114 Ga0209758_1026158 3300025297 Bacteria 2536
115 Ga0209050_1022778 3300025298 Bacteria 2231
116 Ga0209256_1000099 3300025299 Bacteria 203782
117 Ga0209257_1003689 3300025304 Bacteria 12763
118 Ga0207692_10019249 3300025898 Bacteria 3082
119 Ga0207699_10001279 3300025906 Bacteria 11957
120 Ga0207707_10003060 3300025912 Bacteria 14860
121 Ga0207707_10026152 3300025912 Bacteria 5103
122 Ga0207695_10061737 3300025913 Bacteria 3872
123 Ga0207695_10169160 3300025913 Unclassified 2112
124 Ga0207695_10193403 3300025913 Bacteria 1951
125 Ga0207695_10377109 3300025913 Bacteria 1304
126 Ga0207671_10251029 3300025914 Bacteria 1391
127 Ga0207671_10288760 3300025914 Unclassified 1295
128 Ga0207671_10315727 3300025914 Bacteria 1236
129 Ga0207693_10000554 3300025915 Bacteria 33783
130 Ga0207663_10423337 3300025916 Unclassified 1022
131 Ga0207660_10022916 3300025917 Bacteria 4211
132 Ga0207660_10475133 3300025917 Bacteria 1013
133 Ga0207652_10410392 3300025921 Unclassified 1222
134 Ga0207700_10087505 3300025928 Bacteria 2450
135 Ga0207700_10157362 3300025928 Bacteria 1884
136 Ga0207664_10176497 3300025929 Bacteria 1832
137 Ga0207665_10002548 3300025939 Bacteria 12244
138 Ga0207711_10621273 3300025941 Unclassified 1008
139 Ga0207661_10056214 3300025944 Bacteria 3159
140 Ga0207667_10009793 3300025949 Bacteria 11269
141 Ga0207658_10297179 3300025986 Bacteria 1390
142 Ga0207658_10337700 3300025986 Unclassified 1309
143 Ga0207703_10077691 3300026035 Bacteria 2756
144 Ga0207703_10187695 3300026035 Bacteria 1828
145 Ga0207678_10283221 3300026067 Bacteria 1423
146 Ga0207641_10367276 3300026088 Unclassified 1375
147 Ga0207683_10104367 3300026121 Bacteria 2533
148 Ga0207683_10143267 3300026121 Unclassified 2154
149 Ga0207683_10464838 3300026121 Bacteria 1167
150 Ga0268266_10015780 3300028379 Bacteria 6467
151 Ga0268266_10021815 3300028379 Bacteria 5455
152 Ga0268266_10357010 3300028379 Bacteria 1374
153 Ga0268266_10360627 3300028379 Bacteria 1368
154 Ga0268265_10038342 3300028380 Bacteria 3524
155 Ga0268265_10107688 3300028380 Bacteria 2267
156 Ga0268264_10157715 3300028381 Bacteria 2041
157 Ga0268264_10182606 3300028381 Bacteria 1906
158 Ga0265334_10053044 3300028573 Bacteria 1550
159 Ga0307517_10107541 3300028786 Bacteria 2148
160 Ga0307515_10000997 3300028794 Bacteria 64733
161 Ga0307515_10003607 3300028794 Bacteria 32504
162 Ga0307515_10018629 3300028794 Bacteria 12545
163 Ga0265331_10021090 3300031250 Bacteria 3337
164 Ga0307513_10056113 3300031456 Bacteria 4208
165 Ga0307513_10082502 3300031456 Bacteria 3310
166 Ga0307513_10094806 3300031456 Bacteria 3028
167 Ga0307513_10136989 3300031456 Bacteria 2382
168 Ga0307508_10022833 3300031616 Bacteria 5686
169 Ga0307508_10122623 3300031616 Bacteria 2202
170 Ga0307508_10266282 3300031616 Bacteria 1308
171 Ga0307514_10003051 3300031649 Bacteria 16527
172 Ga0307514_10087349 3300031649 Bacteria 2285
173 Ga0316576_10042072 3300031727 Bacteria 3292
174 Ga0307516_10037001 3300031730 Bacteria 4881
175 Ga0316577_10123544 3300031733 Bacteria 1455
176 Ga0307412_10602426 3300031911 Unclassified 931
177 Ga0307510_10005915 3300033180 Bacteria 14601
178 Ga0307510_10014109 3300033180 Bacteria 9462
179 Ga0316215_1000647 3300033544 Bacteria 3658
180 Ga0373946_0023921 3300035171 Bacteria 2390
181 Ga0373955_0062540 3300035172 Bacteria 2059
182 Ga0316574_0005955 3300035398 Bacteria 6543
183 Ga0316574_0016053 3300035398 Bacteria 4356
184 Ga0316574_0166570 3300035398 Bacteria 1419
185 Ga0373935_0019072 3300035692 Bacteria 4183
186 Ga0373927_0008346 3300035695 Bacteria 6973
187 Ga0373927_0011405 3300035695 Bacteria 5921
188 Ga0373947_0019144 3300035725 Bacteria 3946
189 Ga0373937_0003589 3300036401 Bacteria 13083
190 Ga0372808_002667 3300036459 Bacteria 2092
191 Ga0373925_0217951 3300037068 Bacteria 1522
192 Ga0373925_0681507 3300037068 Unclassified 847
193 Ga0395905_0000025 3300037471 Bacteria 317571
194 Ga0395905_0072376 3300037471 Bacteria 3232
195 Ga0436364_1564824 3300037853 Bacteria 8926
196 Ga0436365_0989990 3300039437 Bacteria 1130
197 Ga0436365_1297074 3300039437 Bacteria 5524
198 Ga0436361_0921125 3300039447 Bacteria 2516
199 Ga0436361_1085205 3300039447 Bacteria 1764
200 Ga0436363_0494610 3300039450 Bacteria 11729
201 Ga0436363_1346271 3300039450 Bacteria 1645
202 Ga0436362_0718401 3300039453 Bacteria 2868
203 Ga0451853_3949391 3300041512 Bacteria 1472
204 Ga0439449_0053862 3300042007 Bacteria 1487
205 Ga0439449_0103905 3300042007 Unclassified 1051
206 Ga0439434_0017630 3300042435 Bacteria 2137
207 Ga0466963_0086171 3300044694 Bacteria 2134
208 Ga0453684_0246018 3300044712 Unclassified 2056
209 Ga0466958_0155565 3300045836 Unclassified 1443
210 Ga0495603_0059383 3300046455 Bacteria 2261
211 Ga0495629_0162946 3300046459 Unclassified 1549
212 Ga0495629_0172573 3300046459 Bacteria 1500
213 Ga0495629_0542931 3300046459 Unclassified 781
214 Ga0495651_0244345 3300046462 Bacteria 1229
215 Ga0495580_0000258 3300046472 Bacteria 42219
216 Ga0495580_0133605 3300046472 Bacteria 1720
217 Ga0495605_0000093 3300046474 Bacteria 113652
218 Ga0495605_0067006 3300046474 Bacteria 1704
219 Ga0495584_0000056 3300046491 Bacteria 81387
220 Ga0495585_0007673 3300046492 Bacteria 6580
221 Ga0495596_0103884 3300046500 Unclassified 1104
222 Ga0495607_0062422 3300046501 Bacteria 2112
223 Ga0495583_0000327 3300046506 Bacteria 75285
224 Ga0495583_0078730 3300046506 Bacteria 1435
225 Ga0495610_0002784 3300046512 Bacteria 14317
226 Ga0495620_0009341 3300046515 Bacteria 5220
227 Ga0495620_0052127 3300046515 Bacteria 1739
228 Ga0495628_0052117 3300046516 Bacteria 3233
229 Ga0495630_0054089 3300046517 Bacteria 3007
230 Ga0495631_0001380 3300046518 Bacteria 14779
231 Ga0495632_0032871 3300046519 Bacteria 2669
232 Ga0495648_0136599 3300046524 Unclassified 1296
233 Ga0495654_0039717 3300046530 Bacteria 2348
234 Ga0495654_0182206 3300046530 Bacteria 909
235 Ga0495587_0010176 3300046536 Bacteria 5998
236 Ga0495597_0009455 3300046542 Bacteria 4813
237 Ga0495633_0177142 3300046558 Unclassified 982
238 Ga0495656_0002310 3300046615 Bacteria 6305
239 Ga0495668_0091383 3300046616 Bacteria 1668
240 Ga0495611_0007824 3300046648 Bacteria 4537
241 Ga0495625_0027792 3300046660 Bacteria 4251
242 Ga0495625_0122409 3300046660 Unclassified 1769
243 Ga0495625_0248676 3300046660 Bacteria 1155
244 Ga0495659_0000023 3300046664 Bacteria 71429
245 Ga0495658_0091403 3300046683 Bacteria 1803
246 Ga0495669_0001255 3300046684 Bacteria 10554
247 Ga0495671_0057577 3300046692 Bacteria 1923
248 Ga0495589_0007479 3300046794 Bacteria 5725
249 Ga0495660_0053627 3300046810 Bacteria 2188
250 Ga0495660_0156944 3300046810 Bacteria 1119
251 Ga0495604_0063761 3300047317 Bacteria 2810
252 Ga0495674_0072898 3300047319 Bacteria 2961
253 Ga0495672_0000945 3300047320 Bacteria 30295
254 Ga0495672_0270022 3300047320 Bacteria 817
255 Ga0495683_0001281 3300047323 Bacteria 17041
256 Ga0495673_0017199 3300047469 Bacteria 3679
257 Ga0495686_0064837 3300047472 Bacteria 2260
258 Ga0495602_0130674 3300048088 Bacteria 2004
259 Ga0495626_0012204 3300048091 Bacteria 4514
260 Ga0495626_0022028 3300048091 Unclassified 3151
261 Ga0496101_0127505 3300048904 Bacteria 1929
262 Ga0496102_0206081 3300048905 Bacteria 1854
263 Ga0496102_0279694 3300048905 Bacteria 1573
264 Ga0496104_0079351 3300048907 Bacteria 3128
265 Ga0496104_0591143 3300048907 Unclassified 1020
266 Ga0496105_0032926 3300048908 Bacteria 4254
267 Ga0496105_0255509 3300048908 Unclassified 1419
268 Ga0496106_0160178 3300048909 Bacteria 1779
269 Ga0496107_0049891 3300048910 Bacteria 3016
270 Ga0496108_0609098 3300048911 Bacteria 951
271 Ga0496109_0050787 3300048912 Bacteria 3776
272 Ga0496110_0119973 3300048913 Bacteria 2369
273 Ga0496110_0167636 3300048913 Bacteria 1992
274 Ga0496112_0018571 3300048915 Bacteria 6551
275 Ga0496112_0121751 3300048915 Bacteria 2579
276 Ga0496114_0053737 3300048917 Bacteria 3357
277 Ga0496114_0407098 3300048917 Bacteria 1205
278 Ga0496115_0051900 3300048918 Bacteria 3288
279 Ga0496119_0053770 3300048922 Bacteria 2457
280 Ga0496121_0063466 3300048924 Bacteria 3018
281 Ga0496122_0043159 3300048925 Bacteria 3537
282 Ga0496124_0000007 3300048927 Bacteria 883534
283 Ga0496124_0065499 3300048927 Bacteria 3029
284 Ga0496126_0005451 3300048929 Bacteria 14511
285 Ga0496126_0024667 3300048929 Bacteria 5803
286 Ga0495678_024807 3300049459 Bacteria 2584
287 Ga0495678_025217 3300049459 Bacteria 2557
288 Ga0495682_0005152 3300049460 Bacteria 5466
289 Ga0501033_0247479 3300049570 Bacteria 1264
290 Ga0501034_0140292 3300049571 Bacteria 2397
291 Ga0501034_0902782 3300049571 Bacteria 771
292 Ga0501037_0133767 3300049573 Bacteria 1777
293 Ga0501038_0041224 3300049574 Bacteria 4027
294 Ga0501038_0138661 3300049574 Bacteria 1991
295 Ga0501043_0223098 3300049579 Bacteria 1457
296 Ga0501046_0133169 3300049580 Bacteria 1884
297 Ga0501047_0233881 3300049581 Bacteria 1690
298 Ga0501068_0045777 3300049584 Bacteria 2636
299 Ga0501070_0034625 3300049586 Bacteria 4221
300 Ga0501073_0094758 3300049589 Bacteria 2073
301 Ga0501076_0261011 3300049592 Bacteria 1418
302 Ga0501077_0123271 3300049593 Bacteria 1643
303 Ga0501080_0004978 3300049742 Bacteria 11830
304 Ga0501083_0176076 3300049744 Bacteria 1397
305 Ga0501035_0117261 3300049822 Bacteria 2330
306 Ga0501035_0373351 3300049822 Bacteria 1190
307 Ga0501044_0041137 3300049823 Bacteria 4812
308 Ga0501044_0047564 3300049823 Bacteria 4436
309 Ga0501044_0140876 3300049823 Bacteria 2400
310 Ga0501044_0265151 3300049823 Bacteria 1655
311 Ga0501044_0304301 3300049823 Bacteria 1522
312 nmdc:mga0yw44_299960_c1 3300050492 Bacteria 1076
313 nmdc:mga07m45_325717_c1 3300050496 Bacteria 893
314 nmdc:mga05p37_336528_c1 3300050507 Bacteria 1781
315 nmdc:mga06r32_220694_c1 3300050510 Bacteria 1884
316 nmdc:mga0n895_210799_c1 3300050512 Bacteria 1973
317 nmdc:mga0n895_569113_c1 3300050512 Bacteria 1138
318 nmdc:mga0n895_576055_c1 3300050512 Bacteria 1130
319 nmdc:mga0rr50_135925_c1 3300050513 Bacteria 1973
320 nmdc:mga0rr50_24139_c1 3300050513 Bacteria 4207
321 nmdc:mga0rr50_275417_c1 3300050513 Unclassified 1403
322 nmdc:mga08x19_148665_c1 3300050514 Bacteria 1585
323 nmdc:mga0a205_668983_c1 3300050515 Bacteria 889
324 Ga0495601_0384178 3300053077 Bacteria 911
325 Ga0495612_0038589 3300053078 Bacteria 1941
326 Ga0495655_0044359 3300053083 Bacteria 1150
327 Ga0500578_0022645 3300053086 Bacteria 4035
328 Ga0500578_0046178 3300053086 Bacteria 2794
329 Ga0500578_0260340 3300053086 Bacteria 1042
330 Ga0500644_0005793 3300053088 Bacteria 3133
331 Ga0500646_0006037 3300053090 Bacteria 3074
332 Ga0500566_0105699 3300053094 Bacteria 1537
333 Ga0500641_0000078 3300053096 Bacteria 39918
334 Ga0500654_080829 3300053099 Bacteria 1516
335 Ga0500555_005065 3300053103 Bacteria 3740
336 Ga0500562_013698 3300053108 Bacteria 2073
337 Ga0500594_0000593 3300053118 Bacteria 7771
338 Ga0500595_000050 3300053119 Bacteria 88696
339 Ga0500618_003704 3300053125 Bacteria 5142
340 Ga0500618_004984 3300053125 Bacteria 4110
341 Ga0500642_0000663 3300053130 Bacteria 10182
342 Ga0500642_0052800 3300053130 Bacteria 1800
343 Ga0500658_0025057 3300053134 Bacteria 2291
344 Ga0500559_0170446 3300053136 Bacteria 1024
345 Ga0500568_0046567 3300053139 Bacteria 1720
346 Ga0500577_0020469 3300053142 Bacteria 2164
347 Ga0500588_0054272 3300053146 Bacteria 1261
348 Ga0500590_000426 3300053148 Bacteria 14171
349 Ga0500604_0001343 3300053151 Bacteria 6849
350 Ga0500604_0020878 3300053151 Bacteria 1847
351 Ga0500604_0026352 3300053151 Bacteria 1676
352 Ga0500616_0000904 3300053153 Bacteria 32548
353 Ga0500616_0043646 3300053153 Bacteria 2396
354 Ga0500616_0044192 3300053153 Bacteria 2377
355 Ga0500625_033490 3300053729 Bacteria 2438
356 Ga0500609_000043 3300053731 Bacteria 16927
357 Ga0500609_006263 3300053731 Bacteria 1622
358 Ga0501084_0606551 3300054114 Bacteria 925
359 Ga0501082_0004784 3300060353 Bacteria 11805
360 Ga0501082_0271063 3300060353 Bacteria 1477
361 2509396014 2509276022 Bacteria 6200534
362 2644733352 2643221734 Bacteria 5365412
363 2738886158 2738541307 Bacteria 8606193
364 2806065712 2802429636 Bacteria 7597525
365 2855734455 2855730933 Bacteria 7047938
366 2855770045 2855767633 Bacteria 7049357
367 2857544459 2857542790 Bacteria 5326616
368 2869283398 2869278585 Bacteria 7077053
369 2888339120 2888337043 Bacteria 6629336
370 2937975810 2937972304 Bacteria 7532020
371 2958039911 2958034702 Bacteria 6989922
372 2958054255 2958041894 Bacteria 13082850
373 2958095414 2958092219 Bacteria 6861151
374 2970598176 2970593180 Bacteria 7073582
375 Ga0207700_10653252
376 JGI25151J46595_10003504
377 JGI25153J46596_10000121
378 rootH1_10266639
379 Ga0055526_1002855
380 Ga0055524_1000778
381 Ga0055531_10022092
382 Ga0070683_100037944
383 Ga0070690_100149418
384 Ga0070666_10008791
385 Ga0070680_100005144
386 Ga0070668_100526328
387 Ga0070667_100066519
388 Ga0070709_10033573
389 Ga0070713_100021480
390 Ga0070713_100077380
391 Ga0070710_10003255
392 Ga0070710_10419110
393 Ga0070711_100102890
394 Ga0070711_100172484
395 Ga0070705_100060147
396 Ga0070694_100421329
397 Ga0070708_100271835
398 Ga0070663_100280978
399 Ga0070678_100440385
400 Ga0070662_100694997
401 Ga0070681_10010855
402 Ga0070681_10016632
403 Ga0070706_100341531
404 Ga0070679_100162101
405 Ga0070679_100457849
406 Ga0068853_100007223
407 Ga0070672_100316413
408 Ga0070695_100049056
409 Ga0070695_100066171
410 Ga0070696_100158869
411 Ga0070696_100161250
412 Ga0070665_100008593
413 Ga0070665_100021244
414 Ga0070665_100029539
415 Ga0068855_100001502
416 Ga0070702_100550374
417 Ga0068852_100515920
418 Ga0068859_100122674
419 Ga0068861_100391333
420 Ga0068858_100063940
421 Ga0068858_100085547
422 Ga0068858_100525195
423 Ga0068860_100477828
424 Ga0068862_100081095
425 Ga0068862_100138126
426 Ga0081540_1008322
427 Ga0081540_1037536
428 Ga0075365_10287000
429 Ga0070715_10003409
430 Ga0070716_100082699
431 Ga0070712_100034507
432 Ga0097621_100017313
433 Ga0097621_100679831
434 Ga0075370_10333136
435 Ga0075428_100212776
436 Ga0075431_100025001
437 Ga0075434_100204466
438 Ga0068865_100054293
439 Ga0097620_100122677
440 Ga0075435_100179279
441 Ga0105240_10000743
442 Ga0105240_10009991
443 Ga0105240_10018078
444 Ga0105240_10024935
445 Ga0105240_10208543
446 Ga0105245_10014927
447 Ga0105245_10915628
448 Ga0105247_10006819
449 Ga0105247_10166067
450 Ga0114129_10107334
451 Ga0114129_10190491
452 Ga0114129_10407009
453 Ga0105241_10049305
454 Ga0105241_10640889
455 Ga0105242_10039719
456 Ga0105237_10024982
457 Ga0105237_10029992
458 Ga0105237_10101690
459 Ga0105237_10157549
460 Ga0105237_10333817
461 Ga0105238_10192910
462 Ga0105238_10245721
463 Ga0105238_10835043
464 Ga0105239_10007470
465 Ga0105239_10073286
466 Ga0157369_10200410
467 Ga0157374_10082541
468 Ga0157374_10330671
469 Ga0157378_10032183
470 Ga0163162_10190140
471 Ga0163162_10199368
472 Ga0157372_10204960
473 Ga0157375_10042978
474 Ga0157375_10065866
475 Ga0163163_10439278
476 Ga0157380_10748859
477 Ga0182008_10000079
478 Ga0157379_10075811
479 Ga0163161_10000389
480 Ga0163161_10421785
481 Ga0213876_10123667
482 Ga0213875_10001439
483 Ga0209026_1006941
484 Ga0209675_1001065
485 Ga0209025_1000003
486 Ga0209564_1000052
487 Ga0209758_1000202
488 Ga0209758_1026158
489 Ga0209050_1022778
490 Ga0209256_1000099
491 Ga0209257_1003689
492 Ga0207692_10019249
493 Ga0207699_10001279
494 Ga0207707_10003060
495 Ga0207707_10026152
496 Ga0207695_10061737
497 Ga0207695_10169160
498 Ga0207695_10193403
499 Ga0207695_10377109
500 Ga0207671_10251029
501 Ga0207671_10288760
502 Ga0207671_10315727
503 Ga0207693_10000554
504 Ga0207663_10423337
505 Ga0207660_10022916
506 Ga0207660_10475133
507 Ga0207652_10410392
508 Ga0207700_10087505
509 Ga0207700_10157362
510 Ga0207664_10176497
511 Ga0207665_10002548
512 Ga0207711_10621273
513 Ga0207661_10056214
514 Ga0207667_10009793
515 Ga0207658_10297179
516 Ga0207658_10337700
517 Ga0207703_10077691
518 Ga0207703_10187695
519 Ga0207678_10283221
520 Ga0207641_10367276
521 Ga0207683_10104367
522 Ga0207683_10143267
523 Ga0207683_10464838
524 Ga0268266_10015780
525 Ga0268266_10021815
526 Ga0268266_10357010
527 Ga0268266_10360627
528 Ga0268265_10038342
529 Ga0268265_10107688
530 Ga0268264_10157715
531 Ga0268264_10182606
532 Ga0265334_10053044
533 Ga0307517_10107541
534 Ga0307515_10000997
535 Ga0307515_10003607
536 Ga0307515_10018629
537 Ga0265331_10021090
538 Ga0307513_10056113
539 Ga0307513_10082502
540 Ga0307513_10094806
541 Ga0307513_10136989
542 Ga0307508_10022833
543 Ga0307508_10122623
544 Ga0307508_10266282
545 Ga0307514_10003051
546 Ga0307514_10087349
547 Ga0316576_10042072
548 Ga0307516_10037001
549 Ga0316577_10123544
550 Ga0307412_10602426
551 Ga0307510_10005915
552 Ga0307510_10014109
553 Ga0316215_1000647
554 Ga0373946_0023921
555 Ga0373955_0062540
556 Ga0316574_0005955
557 Ga0316574_0016053
558 Ga0316574_0166570
559 Ga0373935_0019072
560 Ga0373927_0008346
561 Ga0373927_0011405
562 Ga0373947_0019144
563 Ga0373937_0003589
564 Ga0372808_002667
565 Ga0373925_0217951
566 Ga0373925_0681507
567 Ga0395905_0000025
568 Ga0395905_0072376
569 Ga0436364_1564824
570 Ga0436365_0989990
571 Ga0436365_1297074
572 Ga0436361_0921125
573 Ga0436361_1085205
574 Ga0436363_0494610
575 Ga0436363_1346271
576 Ga0436362_0718401
577 Ga0451853_3949391
578 Ga0439449_0053862
579 Ga0439449_0103905
580 Ga0439434_0017630
581 Ga0466963_0086171
582 Ga0453684_0246018
583 Ga0466958_0155565
584 Ga0495603_0059383
585 Ga0495629_0162946
586 Ga0495629_0172573
587 Ga0495629_0542931
588 Ga0495651_0244345
589 Ga0495580_0000258
590 Ga0495580_0133605
591 Ga0495605_0000093
592 Ga0495605_0067006
593 Ga0495584_0000056
594 Ga0495585_0007673
595 Ga0495596_0103884
596 Ga0495607_0062422
597 Ga0495583_0000327
598 Ga0495583_0078730
599 Ga0495610_0002784
600 Ga0495620_0009341
601 Ga0495620_0052127
602 Ga0495628_0052117
603 Ga0495630_0054089
604 Ga0495631_0001380
605 Ga0495632_0032871
606 Ga0495648_0136599
607 Ga0495654_0039717
608 Ga0495654_0182206
609 Ga0495587_0010176
610 Ga0495597_0009455
611 Ga0495633_0177142
612 Ga0495656_0002310
613 Ga0495668_0091383
614 Ga0495611_0007824
615 Ga0495625_0027792
616 Ga0495625_0122409
617 Ga0495625_0248676
618 Ga0495659_0000023
619 Ga0495658_0091403
620 Ga0495669_0001255
621 Ga0495671_0057577
622 Ga0495589_0007479
623 Ga0495660_0053627
624 Ga0495660_0156944
625 Ga0495604_0063761
626 Ga0495674_0072898
627 Ga0495672_0000945
628 Ga0495672_0270022
629 Ga0495683_0001281
630 Ga0495673_0017199
631 Ga0495686_0064837
632 Ga0495602_0130674
633 Ga0495626_0012204
634 Ga0495626_0022028
635 Ga0496101_0127505
636 Ga0496102_0206081
637 Ga0496102_0279694
638 Ga0496104_0079351
639 Ga0496104_0591143
640 Ga0496105_0032926
641 Ga0496105_0255509
642 Ga0496106_0160178
643 Ga0496107_0049891
644 Ga0496108_0609098
645 Ga0496109_0050787
646 Ga0496110_0119973
647 Ga0496110_0167636
648 Ga0496112_0018571
649 Ga0496112_0121751
650 Ga0496114_0053737
651 Ga0496114_0407098
652 Ga0496115_0051900
653 Ga0496119_0053770
654 Ga0496121_0063466
655 Ga0496122_0043159
656 Ga0496124_0000007
657 Ga0496124_0065499
658 Ga0496126_0005451
659 Ga0496126_0024667
660 Ga0495678_024807
661 Ga0495678_025217
662 Ga0495682_0005152
663 Ga0501033_0247479
664 Ga0501034_0140292
665 Ga0501034_0902782
666 Ga0501037_0133767
667 Ga0501038_0041224
668 Ga0501038_0138661
669 Ga0501043_0223098
670 Ga0501046_0133169
671 Ga0501047_0233881
672 Ga0501068_0045777
673 Ga0501070_0034625
674 Ga0501073_0094758
675 Ga0501076_0261011
676 Ga0501077_0123271
677 Ga0501080_0004978
678 Ga0501083_0176076
679 Ga0501035_0117261
680 Ga0501035_0373351
681 Ga0501044_0041137
682 Ga0501044_0047564
683 Ga0501044_0140876
684 Ga0501044_0265151
685 Ga0501044_0304301
686 nmdc:mga0yw44_299960_c1
687 nmdc:mga07m45_325717_c1
688 nmdc:mga05p37_336528_c1
689 nmdc:mga06r32_220694_c1
690 nmdc:mga0n895_210799_c1
691 nmdc:mga0n895_569113_c1
692 nmdc:mga0n895_576055_c1
693 nmdc:mga0rr50_135925_c1
694 nmdc:mga0rr50_24139_c1
695 nmdc:mga0rr50_275417_c1
696 nmdc:mga08x19_148665_c1
697 nmdc:mga0a205_668983_c1
698 Ga0495601_0384178
699 Ga0495612_0038589
700 Ga0495655_0044359
701 Ga0500578_0022645
702 Ga0500578_0046178
703 Ga0500578_0260340
704 Ga0500644_0005793
705 Ga0500646_0006037
706 Ga0500566_0105699
707 Ga0500641_0000078
708 Ga0500654_080829
709 Ga0500555_005065
710 Ga0500562_013698
711 Ga0500594_0000593
712 Ga0500595_000050
713 Ga0500618_003704
714 Ga0500618_004984
715 Ga0500642_0000663
716 Ga0500642_0052800
717 Ga0500658_0025057
718 Ga0500559_0170446
719 Ga0500568_0046567
720 Ga0500577_0020469
721 Ga0500588_0054272
722 Ga0500590_000426
723 Ga0500604_0001343
724 Ga0500604_0020878
725 Ga0500604_0026352
726 Ga0500616_0000904
727 Ga0500616_0043646
728 Ga0500616_0044192
729 Ga0500625_033490
730 Ga0500609_000043
731 Ga0500609_006263
732 Ga0501084_0606551
733 Ga0501082_0004784
734 Ga0501082_0271063
735 2509396014
736 2644733352
737 2738886158
738 2806065712
739 2855734455
740 2855770045
741 2857544459
742 2869283398
743 2888339120
744 2937975810
745 2958039911
746 2958054255
747 2958095414
748 2970598176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

33

223

0.83

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

30

201

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hp5-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase 0.9699 1 241
8hp6-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase d12a mutant 0.9685 1 241
8hp7-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase k152a mutant trapped with (2r)-4-amino-2-hydroxybutanoic acid 0.9659 1 241
8hp5-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase 0.9659 1 241
8hp6-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase d12a mutant 0.9646 1 241
ID Description Score Start End Superfamily
3smvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9677 1 241 3.40.50.1000
3smvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9617 1 241 3.40.50.1000
3smvA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8804 20 94 1.10.150.750
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8588 97 231 3.40.50.1000
3smvA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8496 20 94 1.10.150.750
ID Description Score Start End GO Terms
AF-A0A2D5XWP4-F1-model_v4 Haloacid dehalogenase 0.9817 79 241
AF-A0A7W4JUE6-F1-model_v4 HAD hydrolase-like protein 0.9796 99 240 GO:0016787
AF-A0A386UH03-F1-model_v4 Haloacid dehalogenase type II (EC 3.8.1.2) 0.9759 1 241 GO:0018784
AF-A0A2D5XWP4-F1-model_v4 Haloacid dehalogenase 0.9757 79 241
AF-A0A6L8I7D8-F1-model_v4 HAD-IA family hydrolase 0.9752 1 174 GO:0016787

Map