F426706

General Info

Members Datasets Scaffolds Average Seq Length
374 201 748 198

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10088090|Ga0157374_100880901
Length 228
Sequence MRWTQKTARCRTRFLLTTLRGHFQAFFLCSGLLIGLPGVRSFAQTSSVAQIIVTTPASRDGQHDFDFEIGTWKTHLKRLLHPLTGSNTWVEYEGTSVVRKIWDGRANMVELVADGPGGHFEGLNLRLYNPQSRQWSLNFANSKGGSLTQPTIGAFKDGRGEFYDQETLNGRAILVRFVISDITPNSCRFEQAFSDDGGKTWEVNWIAVDTRVEDAPAKIAMTNRKGHR

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 2643221559 Lysobacter sp. Root559 Isolate Unclassified
199 2643221586 Lysobacter sp. Root667 Isolate Unclassified
200 2643221612 Lysobacter sp. Root76 Isolate Unclassified
201 2643221727 Lysobacter sp. Root96 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.53
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0
Rhizoplane 0.27
Rhizosphere 91.71
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10088090 3300013296 Bacteria 2956
2 SwRhRL2b_contig_1663308 2162886007 Bacteria 1416
3 SwRhRL2b_contig_455911 2162886007 Bacteria 1417
4 JGI24740J21852_10016900 3300001979 Bacteria 2623
5 rootH2_10008855 3300003320 Bacteria 4392
6 rootH2_10116314 3300003320 Unclassified 1677
7 rootL2_10084719 3300003322 Bacteria 6484
8 JGI25160J50197_1021646 3300003354 Bacteria 1903
9 Ga0055528_1000456 3300003790 Bacteria 32613
10 Ga0055530_10005306 3300003791 Bacteria 6184
11 Ga0065165_1000038 3300005262 Bacteria 211664
12 Ga0065704_10018183 3300005289 Bacteria 2927
13 Ga0065704_10109511 3300005289 Bacteria 2001
14 Ga0065707_10006375 3300005295 Bacteria 2842
15 Ga0065707_10098995 3300005295 Bacteria 3040
16 Ga0070658_10000286 3300005327 Bacteria 44320
17 Ga0070676_10199261 3300005328 Unclassified 1312
18 Ga0070683_100195280 3300005329 Bacteria 1922
19 Ga0070670_100747505 3300005331 Bacteria 881
20 Ga0070680_100081358 3300005336 Bacteria 2672
21 Ga0070680_100243197 3300005336 Unclassified 1521
22 Ga0070680_100487175 3300005336 Bacteria 1054
23 Ga0070660_100108806 3300005339 Bacteria 2203
24 Ga0070689_100138508 3300005340 Bacteria 1955
25 Ga0070661_100063388 3300005344 Bacteria 2715
26 Ga0070661_100238206 3300005344 Unclassified 1400
27 Ga0070669_100018490 3300005353 Bacteria 4980
28 Ga0070669_100488491 3300005353 Bacteria 1020
29 Ga0070675_100723386 3300005354 Bacteria 907
30 Ga0070674_100122384 3300005356 Bacteria 1928
31 Ga0070674_100330303 3300005356 Bacteria 1225
32 Ga0070673_101219991 3300005364 Bacteria 705
33 Ga0070659_100102643 3300005366 Bacteria 2302
34 Ga0070659_100270030 3300005366 Bacteria 1413
35 Ga0070659_100274431 3300005366 Unclassified 1401
36 Ga0070703_10000121 3300005406 Bacteria 40241
37 Ga0070709_10002654 3300005434 Bacteria 9658
38 Ga0070709_10010871 3300005434 Bacteria 5053
39 Ga0070709_10060756 3300005434 Bacteria 2403
40 Ga0070711_100103051 3300005439 Bacteria 2079
41 Ga0070711_100253705 3300005439 Bacteria 1381
42 Ga0070711_100422164 3300005439 Bacteria 1087
43 Ga0070711_100631071 3300005439 Unclassified 896
44 Ga0070700_100014702 3300005441 Bacteria 4423
45 Ga0070700_100026145 3300005441 Bacteria 3444
46 Ga0070694_100115520 3300005444 Bacteria 1918
47 Ga0070694_100116324 3300005444 Bacteria 1912
48 Ga0070694_100151445 3300005444 Bacteria 1694
49 Ga0070708_100002730 3300005445 Bacteria 13701
50 Ga0070708_100012260 3300005445 Bacteria 6989
51 Ga0070708_100077509 3300005445 Bacteria 3003
52 Ga0070708_100514605 3300005445 Bacteria 1129
53 Ga0070708_100665170 3300005445 Bacteria 981
54 Ga0070678_100291730 3300005456 Bacteria 1383
55 Ga0070662_100087458 3300005457 Bacteria 2333
56 Ga0070662_100221194 3300005457 Bacteria 1511
57 Ga0070681_10026925 3300005458 Bacteria 5781
58 Ga0070681_10083703 3300005458 Bacteria 3143
59 Ga0070681_10103418 3300005458 Bacteria 2792
60 Ga0070681_10335358 3300005458 Unclassified 1422
61 Ga0070681_10653788 3300005458 Bacteria 966
62 Ga0070685_10236453 3300005466 Bacteria 1204
63 Ga0070706_100005848 3300005467 Bacteria 11667
64 Ga0070706_100051757 3300005467 Bacteria 3791
65 Ga0070706_100637066 3300005467 Unclassified 990
66 Ga0070706_100708956 3300005467 Bacteria 933
67 Ga0070707_100010480 3300005468 Bacteria 8634
68 Ga0070698_100018945 3300005471 Bacteria 7240
69 Ga0070698_100083300 3300005471 Bacteria 3188
70 Ga0070699_100015307 3300005518 Bacteria 6591
71 Ga0070699_100340693 3300005518 Bacteria 1349
72 Ga0070699_100547872 3300005518 Bacteria 1053
73 Ga0070679_100019690 3300005530 Bacteria 6568
74 Ga0070679_100064740 3300005530 Bacteria 3644
75 Ga0070679_100621663 3300005530 Bacteria 1023
76 Ga0070684_100355324 3300005535 Bacteria 1348
77 Ga0070697_100014287 3300005536 Bacteria 6240
78 Ga0068853_100002771 3300005539 Bacteria 13243
79 Ga0068853_100459281 3300005539 Bacteria 1198
80 Ga0070672_100083851 3300005543 Bacteria 2559
81 Ga0070672_101317535 3300005543 Bacteria 645
82 Ga0070695_100091473 3300005545 Bacteria 2032
83 Ga0070695_100997665 3300005545 Bacteria 681
84 Ga0070696_100046883 3300005546 Bacteria 2998
85 Ga0070696_100259081 3300005546 Bacteria 1318
86 Ga0070693_100594330 3300005547 Unclassified 798
87 Ga0070665_100239192 3300005548 Unclassified 1816
88 Ga0070665_101048533 3300005548 Bacteria 827
89 Ga0070704_100103639 3300005549 Bacteria 2149
90 Ga0068855_100100555 3300005563 Bacteria 3329
91 Ga0070664_100001849 3300005564 Bacteria 16955
92 Ga0070664_100003382 3300005564 Bacteria 12877
93 Ga0070664_100113080 3300005564 Bacteria 2371
94 Ga0068857_100036164 3300005577 Bacteria 4375
95 Ga0068857_100203089 3300005577 Bacteria 1807
96 Ga0068854_100107356 3300005578 Bacteria 2101
97 Ga0068852_100007807 3300005616 Bacteria 7835
98 Ga0068852_101088785 3300005616 Bacteria 819
99 Ga0068859_100041079 3300005617 Bacteria 4646
100 Ga0068859_100050871 3300005617 Bacteria 4163
101 Ga0068859_100097395 3300005617 Bacteria 2995
102 Ga0068859_100129732 3300005617 Bacteria 2592
103 Ga0068859_100230897 3300005617 Bacteria 1938
104 Ga0068859_101639011 3300005617 Unclassified 710
105 Ga0068864_100080533 3300005618 Bacteria 2853
106 Ga0068861_100010367 3300005719 Bacteria 6466
107 Ga0068861_100045829 3300005719 Bacteria 3295
108 Ga0068861_100568846 3300005719 Unclassified 1035
109 Ga0068851_10028282 3300005834 Bacteria 2769
110 Ga0068870_10070964 3300005840 Bacteria 1900
111 Ga0068870_10122512 3300005840 Bacteria 1500
112 Ga0068863_100164567 3300005841 Bacteria 2126
113 Ga0068863_100304160 3300005841 Bacteria 1547
114 Ga0068858_100002893 3300005842 Bacteria 17262
115 Ga0068858_100168935 3300005842 Bacteria 2062
116 Ga0068858_101053307 3300005842 Bacteria 798
117 Ga0068860_101427735 3300005843 Bacteria 713
118 Ga0068862_100000909 3300005844 Bacteria 28692
119 Ga0068862_100018798 3300005844 Bacteria 5758
120 Ga0068862_100193390 3300005844 Bacteria 1832
121 Ga0070717_10115110 3300006028 Bacteria 2298
122 Ga0070715_10076811 3300006163 Bacteria 1506
123 Ga0070716_100054723 3300006173 Bacteria 2281
124 Ga0070712_100034430 3300006175 Bacteria 3432
125 Ga0070712_100118984 3300006175 Bacteria 1985
126 Ga0070712_100497235 3300006175 Unclassified 1022
127 Ga0075366_10026939 3300006195 Bacteria 3369
128 Ga0075428_100010272 3300006844 Bacteria 10391
129 Ga0075428_100090159 3300006844 Bacteria 3344
130 Ga0075428_100451066 3300006844 Bacteria 1378
131 Ga0075428_100537528 3300006844 Bacteria 1250
132 Ga0075431_100000634 3300006847 Bacteria 29712
133 Ga0075431_100036742 3300006847 Bacteria 5045
134 Ga0075431_100056807 3300006847 Bacteria 4036
135 Ga0075431_100601202 3300006847 Unclassified 1084
136 Ga0075431_100703563 3300006847 Bacteria 988
137 Ga0075433_10020177 3300006852 Bacteria 5567
138 Ga0075433_10211529 3300006852 Unclassified 1723
139 Ga0075433_10421114 3300006852 Bacteria 1178
140 Ga0075433_10430077 3300006852 Bacteria 1164
141 Ga0075434_100002108 3300006871 Bacteria 17305
142 Ga0075434_100023940 3300006871 Bacteria 5961
143 Ga0075434_100838842 3300006871 Bacteria 935
144 Ga0075434_101209775 3300006871 Bacteria 767
145 Ga0075429_100086968 3300006880 Bacteria 2724
146 Ga0075429_100123007 3300006880 Unclassified 2268
147 Ga0075429_100208173 3300006880 Bacteria 1713
148 Ga0075429_100222284 3300006880 Bacteria 1654
149 Ga0075436_100012327 3300006914 Bacteria 5859
150 Ga0097620_100041077 3300006931 Bacteria 4646
151 Ga0097620_100050872 3300006931 Bacteria 4163
152 Ga0097620_100097393 3300006931 Bacteria 2995
153 Ga0097620_100129733 3300006931 Bacteria 2592
154 Ga0097620_100230907 3300006931 Bacteria 1938
155 Ga0097620_101639779 3300006931 Unclassified 710
156 Ga0075435_100019182 3300007076 Bacteria 5216
157 Ga0075435_100333236 3300007076 Bacteria 1300
158 Ga0075435_100373591 3300007076 Unclassified 1224
159 Ga0075435_100575954 3300007076 Bacteria 976
160 Ga0111539_10000007 3300009094 Bacteria 418059
161 Ga0111539_10046558 3300009094 Bacteria 5187
162 Ga0111539_10671011 3300009094 Bacteria 1207
163 Ga0111539_11387149 3300009094 Unclassified 815
164 Ga0114129_10013436 3300009147 Bacteria 11669
165 Ga0114129_10083770 3300009147 Bacteria 4428
166 Ga0114129_10115542 3300009147 Bacteria 3699
167 Ga0114129_10129722 3300009147 Bacteria 3464
168 Ga0105243_10000039 3300009148 Bacteria 166207
169 Ga0105243_10091394 3300009148 Bacteria 2506
170 Ga0105241_10110261 3300009174 Bacteria 2202
171 Ga0105241_11270364 3300009174 Unclassified 700
172 Ga0105242_10000013 3300009176 Bacteria 133981
173 Ga0105242_10003189 3300009176 Bacteria 12785
174 Ga0105242_10258525 3300009176 Bacteria 1572
175 Ga0105238_10067056 3300009551 Bacteria 3590
176 Ga0105249_10072645 3300009553 Bacteria 3181
177 Ga0105249_10098972 3300009553 Bacteria 2740
178 Ga0105249_10484709 3300009553 Bacteria 1280
179 Ga0105239_10576999 3300010375 Bacteria 1282
180 Ga0157373_10018086 3300013100 Bacteria 5133
181 Ga0157373_10020219 3300013100 Bacteria 4843
182 Ga0157373_10061342 3300013100 Bacteria 2663
183 Ga0157371_10000347 3300013102 Bacteria 59480
184 Ga0157371_10086499 3300013102 Bacteria 2220
185 Ga0157369_11020318 3300013105 Bacteria 847
186 Ga0163162_10046036 3300013306 Bacteria 4373
187 Ga0163162_11579272 3300013306 Bacteria 748
188 Ga0157372_10040366 3300013307 Bacteria 5155
189 Ga0157372_10131300 3300013307 Bacteria 2882
190 Ga0157375_10029535 3300013308 Bacteria 5157
191 Ga0163163_10006940 3300014325 Bacteria 9948
192 Ga0163163_10013263 3300014325 Bacteria 7538
193 Ga0163163_10020082 3300014325 Bacteria 6288
194 Ga0157380_10127997 3300014326 Bacteria 2162
195 Ga0157380_10401387 3300014326 Bacteria 1301
196 Ga0157377_10160581 3300014745 Bacteria 1397
197 Ga0157377_10505945 3300014745 Bacteria 845
198 Ga0163161_10099474 3300017792 Bacteria 2163
199 Ga0209673_1000130 3300025273 Bacteria 163870
200 Ga0209564_1008465 3300025295 Bacteria 5071
201 Ga0209758_1006269 3300025297 Bacteria 8652
202 Ga0209050_1001669 3300025298 Bacteria 22346
203 Ga0209051_1015647 3300025303 Bacteria 3478
204 Ga0209257_1009790 3300025304 Bacteria 5023
205 Ga0207653_10000027 3300025885 Bacteria 113830
206 Ga0207680_10000001 3300025903 Bacteria 1091453
207 Ga0207685_10058844 3300025905 Bacteria 1513
208 Ga0207699_10000010 3300025906 Bacteria 295869
209 Ga0207699_10014468 3300025906 Bacteria 4068
210 Ga0207699_10030380 3300025906 Unclassified 3022
211 Ga0207699_10068554 3300025906 Bacteria 2160
212 Ga0207699_10096189 3300025906 Bacteria 1869
213 Ga0207705_10000282 3300025909 Bacteria 48349
214 Ga0207705_10001904 3300025909 Bacteria 16315
215 Ga0207705_10232164 3300025909 Bacteria 1404
216 Ga0207684_10000404 3300025910 Bacteria 57743
217 Ga0207684_10055678 3300025910 Bacteria 3355
218 Ga0207684_10206081 3300025910 Bacteria 1696
219 Ga0207684_10466712 3300025910 Bacteria 1083
220 Ga0207654_10433404 3300025911 Bacteria 919
221 Ga0207707_10566626 3300025912 Bacteria 964
222 Ga0207671_10068746 3300025914 Bacteria 2640
223 Ga0207693_10048317 3300025915 Bacteria 3341
224 Ga0207693_10126025 3300025915 Bacteria 2013
225 Ga0207663_10032282 3300025916 Bacteria 3107
226 Ga0207660_10127876 3300025917 Bacteria 1931
227 Ga0207660_10470614 3300025917 Bacteria 1018
228 Ga0207657_10001210 3300025919 Bacteria 27503
229 Ga0207657_10027403 3300025919 Bacteria 5219
230 Ga0207646_10010029 3300025922 Bacteria 9300
231 Ga0207681_10005003 3300025923 Bacteria 8145
232 Ga0207681_10356654 3300025923 Bacteria 1172
233 Ga0207694_10224947 3300025924 Bacteria 1531
234 Ga0207700_10016537 3300025928 Unclassified 4904
235 Ga0207690_10029390 3300025932 Bacteria 3494
236 Ga0207690_10143901 3300025932 Bacteria 1760
237 Ga0207690_10152742 3300025932 Bacteria 1713
238 Ga0207706_10029899 3300025933 Bacteria 4862
239 Ga0207706_10098805 3300025933 Bacteria 2568
240 Ga0207706_10492939 3300025933 Unclassified 1058
241 Ga0207686_10000006 3300025934 Bacteria 259583
242 Ga0207686_10003491 3300025934 Bacteria 8444
243 Ga0207709_10000037 3300025935 Bacteria 279771
244 Ga0207670_10290349 3300025936 Bacteria 1277
245 Ga0207669_10120081 3300025937 Bacteria 1782
246 Ga0207665_10087997 3300025939 Bacteria 2148
247 Ga0207691_10176154 3300025940 Bacteria 1870
248 Ga0207661_10485660 3300025944 Bacteria 1128
249 Ga0207679_10006896 3300025945 Bacteria 7196
250 Ga0207679_10052388 3300025945 Bacteria 2993
251 Ga0207712_10348368 3300025961 Bacteria 1230
252 Ga0207640_10002094 3300025981 Bacteria 10738
253 Ga0207640_10141164 3300025981 Bacteria 1756
254 Ga0207703_10000350 3300026035 Bacteria 49593
255 Ga0207703_10314860 3300026035 Bacteria 1431
256 Ga0207703_10318581 3300026035 Bacteria 1423
257 Ga0207639_10029743 3300026041 Bacteria 4002
258 Ga0207639_10132812 3300026041 Unclassified 2063
259 Ga0207639_10173232 3300026041 Bacteria 1829
260 Ga0207639_10258062 3300026041 Bacteria 1523
261 Ga0207678_10000553 3300026067 Bacteria 34126
262 Ga0207708_10025880 3300026075 Bacteria 4439
263 Ga0207708_10583080 3300026075 Bacteria 946
264 Ga0207641_10082041 3300026088 Bacteria 2801
265 Ga0207641_10295411 3300026088 Bacteria 1528
266 Ga0207676_10124379 3300026095 Bacteria 2181
267 Ga0207676_10280614 3300026095 Bacteria 1512
268 Ga0207674_10001436 3300026116 Bacteria 30766
269 Ga0207674_10010568 3300026116 Bacteria 10446
270 Ga0207674_10432970 3300026116 Unclassified 1271
271 Ga0207674_10610673 3300026116 Bacteria 1053
272 Ga0207675_100014668 3300026118 Bacteria 7308
273 Ga0207675_100125918 3300026118 Bacteria 2427
274 Ga0207698_10003602 3300026142 Bacteria 9354
275 Ga0207698_10196249 3300026142 Bacteria 1803
276 Ga0210000_1004298 3300027462 Bacteria 2057
277 Ga0209995_1008488 3300027471 Bacteria 1658
278 Ga0209999_1004037 3300027543 Bacteria 2641
279 Ga0209982_1004732 3300027552 Bacteria 1957
280 Ga0209983_1002188 3300027665 Bacteria 4303
281 Ga0209588_1010703 3300027671 Bacteria 2762
282 Ga0209971_1000995 3300027682 Bacteria 7295
283 Ga0209974_10005269 3300027876 Bacteria 4563
284 Ga0209974_10063788 3300027876 Bacteria 1249
285 Ga0207428_10000008 3300027907 Bacteria 423201
286 Ga0207428_10034715 3300027907 Bacteria 4129
287 Ga0268266_10027686 3300028379 Bacteria 4819
288 Ga0268265_10001085 3300028380 Bacteria 24236
289 Ga0265760_10054632 3300031090 Bacteria 1206
290 Ga0265760_10078381 3300031090 Unclassified 1021
291 Ga0307513_10019766 3300031456 Bacteria 8006
292 Ga0307513_10036735 3300031456 Bacteria 5460
293 Ga0307513_10065916 3300031456 Unclassified 3808
294 Ga0307416_100600135 3300032002 Bacteria 1181
295 Ga0307411_10151311 3300032005 Bacteria 1725
296 Ga0307411_10649378 3300032005 Unclassified 913
297 Ga0307415_100142712 3300032126 Bacteria 1832
298 Ga0395899_0126843 3300037312 Bacteria 1825
299 Ga0395905_0003536 3300037471 Bacteria 16647
300 Ga0395905_0013603 3300037471 Bacteria 7795
301 Ga0436364_1018338 3300037853 Bacteria 1455
302 Ga0395901_0815465 3300038443 Bacteria 921
303 Ga0395901_1212945 3300038443 Unclassified 720
304 Ga0439431_0025206 3300041997 Bacteria 1451
305 Ga0439431_0062762 3300041997 Bacteria 980
306 Ga0439432_133476 3300042006 Unclassified 732
307 Ga0439449_0000302 3300042007 Bacteria 17655
308 Ga0439449_0002663 3300042007 Bacteria 6953
309 Ga0439449_0173431 3300042007 Unclassified 806
310 Ga0439462_0097707 3300042015 Unclassified 808
311 Ga0450894_018606 3300042131 Unclassified 929
312 Ga0451577_0584207 3300042876 Bacteria 1014
313 Ga0451576_0288059 3300045051 Bacteria 1717
314 Ga0495638_0000006 3300046460 Bacteria 668846
315 Ga0495605_0252789 3300046474 Bacteria 754
316 Ga0495639_0344923 3300046475 Bacteria 747
317 Ga0495621_0005073 3300046539 Bacteria 3757
318 Ga0495621_0112253 3300046539 Bacteria 1046
319 Ga0495667_0387147 3300046559 Unclassified 881
320 Ga0495668_0000463 3300046616 Bacteria 51811
321 Ga0495668_0000637 3300046616 Bacteria 42167
322 Ga0495668_0303636 3300046616 Unclassified 875
323 Ga0495635_0202056 3300046663 Unclassified 1347
324 Ga0495659_0022479 3300046664 Bacteria 2135
325 Ga0495658_0103043 3300046683 Bacteria 1706
326 Ga0495669_0078706 3300046684 Bacteria 1510
327 Ga0495669_0083067 3300046684 Unclassified 1472
328 Ga0495581_0284705 3300047315 Bacteria 966
329 Ga0495604_0422004 3300047317 Unclassified 875
330 Ga0495636_0023227 3300047318 Bacteria 2509
331 Ga0495636_0437721 3300047318 Unclassified 627
332 Ga0496115_0074326 3300048918 Unclassified 2759
333 Ga0496126_0031134 3300048929 Bacteria 5046
334 Ga0501291_041220 3300049514 Unclassified 813
335 Ga0501072_0047591 3300049588 Bacteria 3377
336 Ga0501073_0302774 3300049589 Unclassified 1103
337 Ga0501073_0553307 3300049589 Bacteria 795
338 nmdc:mga0k408_60192_c1 3300050493 Bacteria 2206
339 nmdc:mga05p37_127379_c1 3300050507 Bacteria 3126
340 nmdc:mga05p37_134437_c1 3300050507 Bacteria 3034
341 nmdc:mga05p37_427853_c1 3300050507 Bacteria 1539
342 nmdc:mga05p37_97492_c1 3300050507 Bacteria 3621
343 nmdc:mga09592_100074_c1 3300050508 Bacteria 2482
344 nmdc:mga09592_216845_c1 3300050508 Bacteria 1658
345 nmdc:mga09592_488624_c1 3300050508 Bacteria 1060
346 nmdc:mga09592_804712_c1 3300050508 Bacteria 795
347 nmdc:mga06r32_104137_c1 3300050510 Bacteria 2787
348 nmdc:mga06r32_16713_c1 3300050510 Bacteria 6688
349 nmdc:mga06r32_54778_c1 3300050510 Unclassified 3825
350 nmdc:mga08y16_13_c2 3300050511 Bacteria 418063
351 nmdc:mga08y16_1460509_c1 3300050511 Bacteria 645
352 nmdc:mga08y16_375592_c1 3300050511 Bacteria 1458
353 nmdc:mga08y16_61147_c1 3300050511 Bacteria 3933
354 nmdc:mga0n895_25225_c1 3300050512 Bacteria 5615
355 nmdc:mga0n895_641324_c1 3300050512 Bacteria 1062
356 nmdc:mga0n895_8269_c1 3300050512 Bacteria 8999
357 nmdc:mga0n895_92333_c1 3300050512 Bacteria 3030
358 nmdc:mga0rr50_45881_c1 3300050513 Bacteria 3215
359 nmdc:mga0rr50_480884_c1 3300050513 Unclassified 1055
360 nmdc:mga0a205_10777_c1 3300050515 Bacteria 8406
361 nmdc:mga0a205_111041_c1 3300050515 Unclassified 2640
362 nmdc:mga0a205_21859_c1 3300050515 Bacteria 6050
363 nmdc:mga0a205_446949_c1 3300050515 Bacteria 1153
364 Ga0500610_0304141 3300053079 Bacteria 701
365 Ga0500583_0152919 3300053092 Bacteria 1149
366 Ga0500641_0161461 3300053096 Unclassified 966
367 Ga0500617_247296 3300053124 Bacteria 608
368 Ga0500588_0036244 3300053146 Bacteria 1457
369 Ga0500616_0000044 3300053153 Bacteria 339611
370 Ga0501084_0298804 3300054114 Bacteria 1360
371 2643815131 2643221559 Bacteria 4424915
372 2643938017 2643221586 Bacteria 4446529
373 2644076867 2643221612 Bacteria 4361984
374 2644695182 2643221727 Bacteria 4415595
375 Ga0157374_10088090
376 SwRhRL2b_contig_1663308
377 SwRhRL2b_contig_455911
378 JGI24740J21852_10016900
379 rootH2_10008855
380 rootH2_10116314
381 rootL2_10084719
382 JGI25160J50197_1021646
383 Ga0055528_1000456
384 Ga0055530_10005306
385 Ga0065165_1000038
386 Ga0065704_10018183
387 Ga0065704_10109511
388 Ga0065707_10006375
389 Ga0065707_10098995
390 Ga0070658_10000286
391 Ga0070676_10199261
392 Ga0070683_100195280
393 Ga0070670_100747505
394 Ga0070680_100081358
395 Ga0070680_100243197
396 Ga0070680_100487175
397 Ga0070660_100108806
398 Ga0070689_100138508
399 Ga0070661_100063388
400 Ga0070661_100238206
401 Ga0070669_100018490
402 Ga0070669_100488491
403 Ga0070675_100723386
404 Ga0070674_100122384
405 Ga0070674_100330303
406 Ga0070673_101219991
407 Ga0070659_100102643
408 Ga0070659_100270030
409 Ga0070659_100274431
410 Ga0070703_10000121
411 Ga0070709_10002654
412 Ga0070709_10010871
413 Ga0070709_10060756
414 Ga0070711_100103051
415 Ga0070711_100253705
416 Ga0070711_100422164
417 Ga0070711_100631071
418 Ga0070700_100014702
419 Ga0070700_100026145
420 Ga0070694_100115520
421 Ga0070694_100116324
422 Ga0070694_100151445
423 Ga0070708_100002730
424 Ga0070708_100012260
425 Ga0070708_100077509
426 Ga0070708_100514605
427 Ga0070708_100665170
428 Ga0070678_100291730
429 Ga0070662_100087458
430 Ga0070662_100221194
431 Ga0070681_10026925
432 Ga0070681_10083703
433 Ga0070681_10103418
434 Ga0070681_10335358
435 Ga0070681_10653788
436 Ga0070685_10236453
437 Ga0070706_100005848
438 Ga0070706_100051757
439 Ga0070706_100637066
440 Ga0070706_100708956
441 Ga0070707_100010480
442 Ga0070698_100018945
443 Ga0070698_100083300
444 Ga0070699_100015307
445 Ga0070699_100340693
446 Ga0070699_100547872
447 Ga0070679_100019690
448 Ga0070679_100064740
449 Ga0070679_100621663
450 Ga0070684_100355324
451 Ga0070697_100014287
452 Ga0068853_100002771
453 Ga0068853_100459281
454 Ga0070672_100083851
455 Ga0070672_101317535
456 Ga0070695_100091473
457 Ga0070695_100997665
458 Ga0070696_100046883
459 Ga0070696_100259081
460 Ga0070693_100594330
461 Ga0070665_100239192
462 Ga0070665_101048533
463 Ga0070704_100103639
464 Ga0068855_100100555
465 Ga0070664_100001849
466 Ga0070664_100003382
467 Ga0070664_100113080
468 Ga0068857_100036164
469 Ga0068857_100203089
470 Ga0068854_100107356
471 Ga0068852_100007807
472 Ga0068852_101088785
473 Ga0068859_100041079
474 Ga0068859_100050871
475 Ga0068859_100097395
476 Ga0068859_100129732
477 Ga0068859_100230897
478 Ga0068859_101639011
479 Ga0068864_100080533
480 Ga0068861_100010367
481 Ga0068861_100045829
482 Ga0068861_100568846
483 Ga0068851_10028282
484 Ga0068870_10070964
485 Ga0068870_10122512
486 Ga0068863_100164567
487 Ga0068863_100304160
488 Ga0068858_100002893
489 Ga0068858_100168935
490 Ga0068858_101053307
491 Ga0068860_101427735
492 Ga0068862_100000909
493 Ga0068862_100018798
494 Ga0068862_100193390
495 Ga0070717_10115110
496 Ga0070715_10076811
497 Ga0070716_100054723
498 Ga0070712_100034430
499 Ga0070712_100118984
500 Ga0070712_100497235
501 Ga0075366_10026939
502 Ga0075428_100010272
503 Ga0075428_100090159
504 Ga0075428_100451066
505 Ga0075428_100537528
506 Ga0075431_100000634
507 Ga0075431_100036742
508 Ga0075431_100056807
509 Ga0075431_100601202
510 Ga0075431_100703563
511 Ga0075433_10020177
512 Ga0075433_10211529
513 Ga0075433_10421114
514 Ga0075433_10430077
515 Ga0075434_100002108
516 Ga0075434_100023940
517 Ga0075434_100838842
518 Ga0075434_101209775
519 Ga0075429_100086968
520 Ga0075429_100123007
521 Ga0075429_100208173
522 Ga0075429_100222284
523 Ga0075436_100012327
524 Ga0097620_100041077
525 Ga0097620_100050872
526 Ga0097620_100097393
527 Ga0097620_100129733
528 Ga0097620_100230907
529 Ga0097620_101639779
530 Ga0075435_100019182
531 Ga0075435_100333236
532 Ga0075435_100373591
533 Ga0075435_100575954
534 Ga0111539_10000007
535 Ga0111539_10046558
536 Ga0111539_10671011
537 Ga0111539_11387149
538 Ga0114129_10013436
539 Ga0114129_10083770
540 Ga0114129_10115542
541 Ga0114129_10129722
542 Ga0105243_10000039
543 Ga0105243_10091394
544 Ga0105241_10110261
545 Ga0105241_11270364
546 Ga0105242_10000013
547 Ga0105242_10003189
548 Ga0105242_10258525
549 Ga0105238_10067056
550 Ga0105249_10072645
551 Ga0105249_10098972
552 Ga0105249_10484709
553 Ga0105239_10576999
554 Ga0157373_10018086
555 Ga0157373_10020219
556 Ga0157373_10061342
557 Ga0157371_10000347
558 Ga0157371_10086499
559 Ga0157369_11020318
560 Ga0163162_10046036
561 Ga0163162_11579272
562 Ga0157372_10040366
563 Ga0157372_10131300
564 Ga0157375_10029535
565 Ga0163163_10006940
566 Ga0163163_10013263
567 Ga0163163_10020082
568 Ga0157380_10127997
569 Ga0157380_10401387
570 Ga0157377_10160581
571 Ga0157377_10505945
572 Ga0163161_10099474
573 Ga0209673_1000130
574 Ga0209564_1008465
575 Ga0209758_1006269
576 Ga0209050_1001669
577 Ga0209051_1015647
578 Ga0209257_1009790
579 Ga0207653_10000027
580 Ga0207680_10000001
581 Ga0207685_10058844
582 Ga0207699_10000010
583 Ga0207699_10014468
584 Ga0207699_10030380
585 Ga0207699_10068554
586 Ga0207699_10096189
587 Ga0207705_10000282
588 Ga0207705_10001904
589 Ga0207705_10232164
590 Ga0207684_10000404
591 Ga0207684_10055678
592 Ga0207684_10206081
593 Ga0207684_10466712
594 Ga0207654_10433404
595 Ga0207707_10566626
596 Ga0207671_10068746
597 Ga0207693_10048317
598 Ga0207693_10126025
599 Ga0207663_10032282
600 Ga0207660_10127876
601 Ga0207660_10470614
602 Ga0207657_10001210
603 Ga0207657_10027403
604 Ga0207646_10010029
605 Ga0207681_10005003
606 Ga0207681_10356654
607 Ga0207694_10224947
608 Ga0207700_10016537
609 Ga0207690_10029390
610 Ga0207690_10143901
611 Ga0207690_10152742
612 Ga0207706_10029899
613 Ga0207706_10098805
614 Ga0207706_10492939
615 Ga0207686_10000006
616 Ga0207686_10003491
617 Ga0207709_10000037
618 Ga0207670_10290349
619 Ga0207669_10120081
620 Ga0207665_10087997
621 Ga0207691_10176154
622 Ga0207661_10485660
623 Ga0207679_10006896
624 Ga0207679_10052388
625 Ga0207712_10348368
626 Ga0207640_10002094
627 Ga0207640_10141164
628 Ga0207703_10000350
629 Ga0207703_10314860
630 Ga0207703_10318581
631 Ga0207639_10029743
632 Ga0207639_10132812
633 Ga0207639_10173232
634 Ga0207639_10258062
635 Ga0207678_10000553
636 Ga0207708_10025880
637 Ga0207708_10583080
638 Ga0207641_10082041
639 Ga0207641_10295411
640 Ga0207676_10124379
641 Ga0207676_10280614
642 Ga0207674_10001436
643 Ga0207674_10010568
644 Ga0207674_10432970
645 Ga0207674_10610673
646 Ga0207675_100014668
647 Ga0207675_100125918
648 Ga0207698_10003602
649 Ga0207698_10196249
650 Ga0210000_1004298
651 Ga0209995_1008488
652 Ga0209999_1004037
653 Ga0209982_1004732
654 Ga0209983_1002188
655 Ga0209588_1010703
656 Ga0209971_1000995
657 Ga0209974_10005269
658 Ga0209974_10063788
659 Ga0207428_10000008
660 Ga0207428_10034715
661 Ga0268266_10027686
662 Ga0268265_10001085
663 Ga0265760_10054632
664 Ga0265760_10078381
665 Ga0307513_10019766
666 Ga0307513_10036735
667 Ga0307513_10065916
668 Ga0307416_100600135
669 Ga0307411_10151311
670 Ga0307411_10649378
671 Ga0307415_100142712
672 Ga0395899_0126843
673 Ga0395905_0003536
674 Ga0395905_0013603
675 Ga0436364_1018338
676 Ga0395901_0815465
677 Ga0395901_1212945
678 Ga0439431_0025206
679 Ga0439431_0062762
680 Ga0439432_133476
681 Ga0439449_0000302
682 Ga0439449_0002663
683 Ga0439449_0173431
684 Ga0439462_0097707
685 Ga0450894_018606
686 Ga0451577_0584207
687 Ga0451576_0288059
688 Ga0495638_0000006
689 Ga0495605_0252789
690 Ga0495639_0344923
691 Ga0495621_0005073
692 Ga0495621_0112253
693 Ga0495667_0387147
694 Ga0495668_0000463
695 Ga0495668_0000637
696 Ga0495668_0303636
697 Ga0495635_0202056
698 Ga0495659_0022479
699 Ga0495658_0103043
700 Ga0495669_0078706
701 Ga0495669_0083067
702 Ga0495581_0284705
703 Ga0495604_0422004
704 Ga0495636_0023227
705 Ga0495636_0437721
706 Ga0496115_0074326
707 Ga0496126_0031134
708 Ga0501291_041220
709 Ga0501072_0047591
710 Ga0501073_0302774
711 Ga0501073_0553307
712 nmdc:mga0k408_60192_c1
713 nmdc:mga05p37_127379_c1
714 nmdc:mga05p37_134437_c1
715 nmdc:mga05p37_427853_c1
716 nmdc:mga05p37_97492_c1
717 nmdc:mga09592_100074_c1
718 nmdc:mga09592_216845_c1
719 nmdc:mga09592_488624_c1
720 nmdc:mga09592_804712_c1
721 nmdc:mga06r32_104137_c1
722 nmdc:mga06r32_16713_c1
723 nmdc:mga06r32_54778_c1
724 nmdc:mga08y16_13_c2
725 nmdc:mga08y16_1460509_c1
726 nmdc:mga08y16_375592_c1
727 nmdc:mga08y16_61147_c1
728 nmdc:mga0n895_25225_c1
729 nmdc:mga0n895_641324_c1
730 nmdc:mga0n895_8269_c1
731 nmdc:mga0n895_92333_c1
732 nmdc:mga0rr50_45881_c1
733 nmdc:mga0rr50_480884_c1
734 nmdc:mga0a205_10777_c1
735 nmdc:mga0a205_111041_c1
736 nmdc:mga0a205_21859_c1
737 nmdc:mga0a205_446949_c1
738 Ga0500610_0304141
739 Ga0500583_0152919
740 Ga0500641_0161461
741 Ga0500617_247296
742 Ga0500588_0036244
743 Ga0500616_0000044
744 Ga0501084_0298804
745 2643815131
746 2643938017
747 2644076867
748 2644695182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfp-assembly1.cif.gz_A crystal structure of osso, a spirocyclase involved in the biosynthesis of ossamycin 0.7858 46 204
5fgo-assembly2.cif.gz_C crystal structure of d. melanogaster pur-alpha repeat iii. 0.7782 143 188
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.7773 50 205
7sfp-assembly1.cif.gz_A crystal structure of osso, a spirocyclase involved in the biosynthesis of ossamycin 0.7674 46 204
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.75 50 205
ID Description Score Start End Superfamily
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7673 57 204 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7187 57 204 2.40.128.20
4ao6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7134 145 170 3.40.50.1820
af_A0A1D6NFT9_14_110_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7046 56 148 2.40.128.20
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6974 52 205 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A1M7P5S2-F1-model_v4 DUF1579 domain-containing protein 0.9986 48 205
AF-A0A2S8B3V8-F1-model_v4 DUF1579 domain-containing protein 0.9944 58 204
AF-A0A1Y0BR66-F1-model_v4 L536 0.9899 84 206
AF-A0A7X0ALX7-F1-model_v4 DUF1579 domain-containing protein 0.9877 88 205
AF-A0A318NJM8-F1-model_v4 DUF1579 domain-containing protein 0.9863 145 206

Map