F426487

General Info

Members Datasets Scaffolds Average Seq Length
373 331 165 411

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0000422|Ga0496119_0000422_22333_23679
Length 448
Sequence MKILFVHQNFPAQYLHLARYLGSIPGNQIVFITQRQAGDIPGVRKIVYRPRRTVTPQVHHYLREAEAAVLNAQEVARIAMDLRTSGFVPDVMLGHNGWGEIWYLRDIFPQTPLVGYFEFFYRLQGADVGFDRADPITPDTAPRLRTKNLGNLLALDTATVGQCPTQWQKSGYPKRYHPILHVIHEGVDTQVVIPDRDARLSIPDCGVELAAGDEIVTYVARNLEPYRGFPIFMRSLPAILARRPNAHVVIVGGDEVSYGARLPPGRTFRQDSLNELKDSIDLSRVHFLGRVPYPTFLRVLQISRVHVYLTYPFVLSWSMLEAMSAGCFVVGSRTPPVEEVIRDCGNGVLVDFFSPAEIADRVVEALEDPHAHDSMRANARQTIVDEYDLRTVCLPAHLQLVGTLAKQSRNISPHPPNMAVIRRDAVREPNHSVLGTTVPLTEAESLKH

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
4 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
12 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
13 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
14 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
15 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
16 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
17 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
18 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
19 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
20 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
21 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
22 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
23 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
24 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
25 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
26 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
27 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
28 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
29 2643221718 Rhizobium sp. Root268 Isolate Unclassified
30 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
31 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
32 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
33 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
34 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
35 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
36 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
37 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
38 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
39 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
40 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
41 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
42 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
43 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
44 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
45 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
46 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
47 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
48 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
49 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
50 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
51 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
52 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
53 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
54 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
55 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
56 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
57 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
58 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
59 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
60 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
61 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
62 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
63 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
64 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
65 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
66 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
67 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
68 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
69 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
70 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
71 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
72 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
73 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
74 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
75 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
76 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
77 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
78 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
79 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
80 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
81 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
82 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
83 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
84 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
85 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
86 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
87 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
88 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
89 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
90 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
91 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
92 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
93 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
94 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
95 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
96 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
97 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
98 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
99 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
100 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
101 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
102 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
103 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
104 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
105 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
106 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
107 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
108 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
109 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
110 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
111 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
112 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
113 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
114 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
115 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
116 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
117 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
118 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
119 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
120 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
121 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
122 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
123 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
124 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
125 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
126 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
127 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
128 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
129 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
130 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
131 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
132 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
133 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
134 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
135 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
136 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
137 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
138 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
139 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
140 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
141 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
142 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
143 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
144 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
145 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
146 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
147 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
148 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
149 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
150 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
151 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
152 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
153 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
154 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
155 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
156 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
157 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
158 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
159 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
160 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
161 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
162 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
163 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
164 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
165 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
166 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
167 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
168 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
169 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
170 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
171 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
172 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
173 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
174 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
175 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
176 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
177 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
178 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
179 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
180 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
181 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
182 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
183 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
184 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
185 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
186 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
187 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
188 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
189 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
190 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
191 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
192 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
193 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
194 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
195 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
196 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
197 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
198 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
199 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
200 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
201 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
202 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
203 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
204 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
205 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
206 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
207 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
208 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
209 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
210 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
211 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
212 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
213 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
214 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
215 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
216 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
217 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
218 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
219 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
220 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
221 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
222 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
223 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
224 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
225 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
226 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
227 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
228 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
229 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
230 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
231 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
232 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
233 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
234 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
237 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
247 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
257 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
330 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
331 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.24
Metatranscriptomes 0
Isolates 55.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 54.42
Rhizoplane 4.29
Rhizosphere 30.03
Stem 0
Stem Tuber 0
Unclassified 8.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000431 3300002459 Bacteria 12979
2 rootH2_10036043 3300003320 Bacteria 32519
3 rootH2_10045803 3300003320 Bacteria 5058
4 rootH2_10200901 3300003320 Bacteria 3269
5 rootL2_10029479 3300003322 Bacteria 10569
6 rootH1_10125919 3300003323 Bacteria 1700
7 Ga0055535_1000292 3300003761 Bacteria 52350
8 Ga0055529_1000130 3300003763 Bacteria 105654
9 Ga0070669_100000094 3300005353 Bacteria 87053
10 Ga0070671_100025723 3300005355 Bacteria 4831
11 Ga0070679_100307681 3300005530 Bacteria 1535
12 Ga0070665_100007420 3300005548 Bacteria 11151
13 Ga0070665_100024864 3300005548 Bacteria 6035
14 Ga0070665_100106580 3300005548 Bacteria 2805
15 Ga0068855_100046715 3300005563 Bacteria 5117
16 Ga0068857_100182251 3300005577 Bacteria 1911
17 Ga0068859_100007096 3300005617 Bacteria 11371
18 Ga0068858_100013523 3300005842 Bacteria 7701
19 Ga0075365_10016831 3300006038 Bacteria 4460
20 Ga0075365_10028243 3300006038 Bacteria 3577
21 Ga0075363_100009535 3300006048 Bacteria 4566
22 Ga0075369_10012595 3300006186 Bacteria 3340
23 Ga0097620_100007097 3300006931 Bacteria 11371
24 Ga0079104_1002181 3300006946 Bacteria 11045
25 Ga0079104_1005719 3300006946 Bacteria 4891
26 Ga0105248_10027950 3300009177 Bacteria 6281
27 Ga0105248_10377370 3300009177 Bacteria 1596
28 Ga0105237_10064662 3300009545 Bacteria 3654
29 Ga0105239_10061389 3300010375 Unclassified 4125
30 Ga0163163_10457442 3300014325 Bacteria 1337
31 Ga0214544_1000029 3300021320 Bacteria 153924
32 Ga0214542_1000092 3300021321 Bacteria 117288
33 Ga0214543_1000045 3300021327 Bacteria 152699
34 Ga0228711_1000011 3300022739 Bacteria 133208
35 Ga0228710_1000283 3300022740 Bacteria 56899
36 Ga0209258_100128 3300025242 Bacteria 177216
37 Ga0209148_1006285 3300025254 Bacteria 2589
38 Ga0209759_1000666 3300025256 Bacteria 31844
39 Ga0209455_1000116 3300025272 Bacteria 177216
40 Ga0209051_1001447 3300025303 Bacteria 20173
41 Ga0207681_10000995 3300025923 Bacteria 18525
42 Ga0207644_10039478 3300025931 Bacteria 3332
43 Ga0207711_10145103 3300025941 Bacteria 2138
44 Ga0207667_10009285 3300025949 Bacteria 11604
45 Ga0207667_10034756 3300025949 Bacteria 5410
46 Ga0207703_10009432 3300026035 Bacteria 7666
47 Ga0207703_10046286 3300026035 Bacteria 3503
48 Ga0207674_10268600 3300026116 Bacteria 1653
49 Ga0207674_10388175 3300026116 Bacteria 1350
50 Ga0207698_10024200 3300026142 Bacteria 4258
51 Ga0209281_1000087 3300027111 Bacteria 246142
52 Ga0209281_1000188 3300027111 Bacteria 141823
53 Ga0209282_1000008 3300027666 Bacteria 248526
54 Ga0268266_10003046 3300028379 Bacteria 17166
55 Ga0268266_10012727 3300028379 Bacteria 7271
56 Ga0268266_10024792 3300028379 Bacteria 5104
57 Ga0268266_10028683 3300028379 Bacteria 4731
58 Ga0268265_10017435 3300028380 Bacteria 4955
59 Ga0265325_10009100 3300031241 Bacteria 5819
60 Ga0265325_10065813 3300031241 Bacteria 1829
61 Ga0265331_10045867 3300031250 Bacteria 2108
62 Ga0265327_10010862 3300031251 Bacteria 6344
63 Ga0265327_10012998 3300031251 Bacteria 5566
64 Ga0307516_10001419 3300031730 Bacteria 33145
65 Ga0315914_1000011 3300031967 Bacteria 170175
66 Ga0307510_10005631 3300033180 Bacteria 14933
67 Ga0315913_1000008 3300033430 Bacteria 155397
68 Ga0315915_1000009 3300033464 Bacteria 252178
69 Ga0373936_0008324 3300035113 Unclassified 3902
70 Ga0395899_0113475 3300037312 Bacteria 1946
71 Ga0395905_0000173 3300037471 Bacteria 105060
72 Ga0395905_0040935 3300037471 Bacteria 4347
73 Ga0436361_0489077 3300039447 Bacteria 5371
74 Ga0436361_0821446 3300039447 Unclassified 1531
75 Ga0439449_0011348 3300042007 Bacteria 3353
76 Ga0451577_0002737 3300042876 Bacteria 20450
77 Ga0466972_0000043 3300044658 Bacteria 131471
78 Ga0466966_0005538 3300044684 Bacteria 8296
79 Ga0466961_0020124 3300044693 Bacteria 4295
80 Ga0466961_0079873 3300044693 Bacteria 2071
81 Ga0466964_0020576 3300044706 Unclassified 2542
82 Ga0453684_0000519 3300044712 Bacteria 147315
83 Ga0453684_0000823 3300044712 Bacteria 104784
84 Ga0453684_0001185 3300044712 Bacteria 80717
85 Ga0453684_0001505 3300044712 Bacteria 65497
86 Ga0466971_0002870 3300044719 Bacteria 7308
87 Ga0466971_0085490 3300044719 Bacteria 1441
88 Ga0466959_0074424 3300045049 Bacteria 2456
89 Ga0451576_0000511 3300045051 Bacteria 85172
90 Ga0451576_0002030 3300045051 Bacteria 31965
91 Ga0451576_0025938 3300045051 Bacteria 6310
92 Ga0451576_0152593 3300045051 Bacteria 2409
93 Ga0466958_0010933 3300045836 Bacteria 5099
94 Ga0466967_0136327 3300045976 Bacteria 2283
95 Ga0495653_0084903 3300046463 Bacteria 2330
96 Ga0495594_0055356 3300046499 Bacteria 2187
97 Ga0495583_0000524 3300046506 Bacteria 54376
98 Ga0495606_0000329 3300046507 Bacteria 81972
99 Ga0495606_0000982 3300046507 Bacteria 41525
100 Ga0495630_0019885 3300046517 Bacteria 4944
101 Ga0495666_0003872 3300046526 Bacteria 7569
102 Ga0495652_0014363 3300046529 Bacteria 7108
103 Ga0495652_0049734 3300046529 Bacteria 3587
104 Ga0495665_0090075 3300046531 Bacteria 1611
105 Ga0495586_0004366 3300046535 Bacteria 7559
106 Ga0495587_0049200 3300046536 Bacteria 2495
107 Ga0495622_0013446 3300046557 Bacteria 3796
108 Ga0495667_0142334 3300046559 Bacteria 1545
109 Ga0495668_0010265 3300046616 Bacteria 5683
110 Ga0495588_0003728 3300046674 Bacteria 6664
111 Ga0495623_0050653 3300046679 Bacteria 2629
112 Ga0495669_0056220 3300046684 Bacteria 1773
113 Ga0495613_0028285 3300046689 Bacteria 4169
114 Ga0495649_0000204 3300046694 Bacteria 52437
115 Ga0495589_0093617 3300046794 Bacteria 1459
116 Ga0495600_0001943 3300046809 Bacteria 11614
117 Ga0495581_0010599 3300047315 Bacteria 5327
118 Ga0495604_0039569 3300047317 Bacteria 3705
119 Ga0495687_018409 3300047443 Bacteria 3453
120 Ga0495675_0136032 3300047444 Bacteria 1525
121 Ga0495602_0067192 3300048088 Bacteria 3085
122 Ga0496101_0023161 3300048904 Bacteria 4286
123 Ga0496104_0000287 3300048907 Bacteria 44415
124 Ga0496104_0022759 3300048907 Bacteria 5756
125 Ga0496104_0070111 3300048907 Bacteria 3332
126 Ga0496105_0000627 3300048908 Bacteria 23647
127 Ga0496105_0018093 3300048908 Bacteria 5656
128 Ga0496105_0053397 3300048908 Bacteria 3337
129 Ga0496106_0000445 3300048909 Bacteria 29521
130 Ga0496112_0001097 3300048915 Bacteria 20038
131 Ga0496112_0035353 3300048915 Bacteria 4867
132 Ga0496112_0096482 3300048915 Bacteria 2927
133 Ga0496113_0000316 3300048916 Bacteria 22992
134 Ga0496113_0002851 3300048916 Bacteria 10169
135 Ga0496114_0224171 3300048917 Bacteria 1651
136 Ga0496115_0003132 3300048918 Bacteria 11893
137 Ga0496115_0003997 3300048918 Bacteria 10640
138 Ga0496116_0034956 3300048919 Bacteria 3536
139 Ga0496117_0000581 3300048920 Bacteria 60186
140 Ga0496118_0000052 3300048921 Bacteria 237465
141 Ga0496119_0000422 3300048922 Bacteria 58155
142 Ga0496119_0031423 3300048922 Bacteria 3561
143 Ga0496120_0000451 3300048923 Bacteria 65201
144 Ga0496120_0036255 3300048923 Bacteria 2937
145 Ga0496121_0020959 3300048924 Bacteria 6431
146 Ga0496124_0077501 3300048927 Bacteria 2741
147 Ga0496125_0054082 3300048928 Bacteria 3284
148 Ga0496126_0000483 3300048929 Bacteria 78885
149 Ga0496126_0023294 3300048929 Bacteria 6000
150 Ga0496126_0182369 3300048929 Bacteria 1782
151 Ga0501033_0071859 3300049570 Bacteria 2541
152 Ga0501034_0034287 3300049571 Bacteria 5146
153 Ga0501037_0020037 3300049573 Bacteria 4938
154 Ga0501037_0189552 3300049573 Bacteria 1456
155 Ga0501038_0019723 3300049574 Bacteria 6071
156 Ga0501047_0005927 3300049581 Bacteria 11496
157 Ga0501070_0020125 3300049586 Bacteria 5598
158 Ga0501070_0031163 3300049586 Bacteria 4467
159 Ga0501073_0165018 3300049589 Unclassified 1534
160 Ga0501075_0095906 3300049591 Bacteria 2251
161 Ga0501080_0028453 3300049742 Bacteria 5199
162 Ga0501035_0016352 3300049822 Bacteria 6842
163 Ga0501045_0047236 3300049824 Bacteria 3136
164 Ga0501082_0089362 3300060353 Bacteria 2660
165 Ga0466962_0002710 3300061719 Bacteria 8420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0000287 Ga0496104_0000287_20484_21602 333
2 3300048908 Ga0496105_0000627 Ga0496105_0000627_17639_18757 333
3 iso_pu_bacteria 2937049772 2937053021 356
4 iso_pu_bacteria 2970040964 2970042070 356
5 iso_pu_bacteria 2970116247 2970116586 356
6 iso_pu_bacteria 2977579622 2977580903 356
7 3300045051 Ga0451576_0025938 Ga0451576_0025938_467_1552 358
8 3300031251 Ga0265327_10012998 Ga0265327_100129983 369
9 3300049573 Ga0501037_0189552 Ga0501037_0189552_20_1153 372
10 3300005530 Ga0070679_100307681 Ga0070679_1003076811 379
11 3300048929 Ga0496126_0023294 Ga0496126_0023294_2629_3834 384
12 3300006048 Ga0075363_100009535 Ga0075363_1000095353 385
13 3300009177 Ga0105248_10377370 Ga0105248_103773702 386
14 3300046463 Ga0495653_0084903 Ga0495653_0084903_336_1517 387
15 3300046507 Ga0495606_0000982 Ga0495606_0000982_3329_4507 387
16 3300046517 Ga0495630_0019885 Ga0495630_0019885_2155_3336 387
17 3300046529 Ga0495652_0049734 Ga0495652_0049734_641_1822 387
18 3300046535 Ga0495586_0004366 Ga0495586_0004366_6043_7224 387
19 3300046536 Ga0495587_0049200 Ga0495587_0049200_750_1931 387
20 3300046679 Ga0495623_0050653 Ga0495623_0050653_1241_2422 387
21 3300046689 Ga0495613_0028285 Ga0495613_0028285_2438_3619 387
22 3300046809 Ga0495600_0001943 Ga0495600_0001943_3180_4361 387
23 3300035113 Ga0373936_0008324 Ga0373936_0008324_1561_2841 390
24 iso_pu_bacteria 3000405567 3000405675 392
25 3300060353 Ga0501082_0089362 Ga0501082_0089362_1319_2590 393
26 3300048917 Ga0496114_0224171 Ga0496114_0224171_99_1364 394
27 3300048918 Ga0496115_0003997 Ga0496115_0003997_891_2156 394
28 3300046506 Ga0495583_0000524 Ga0495583_0000524_37893_39119 396
29 3300046507 Ga0495606_0000329 Ga0495606_0000329_74671_75897 396
30 3300046616 Ga0495668_0010265 Ga0495668_0010265_910_2136 396
31 3300046684 Ga0495669_0056220 Ga0495669_0056220_263_1489 396
32 3300046694 Ga0495649_0000204 Ga0495649_0000204_23983_25209 396
33 3300046794 Ga0495589_0093617 Ga0495589_0093617_57_1283 396
34 iso_pu_bacteria 2511231221 2512032825 398
35 iso_pu_bacteria 2837678835 2837681369 398
36 iso_pu_bacteria 2904578770 2904581462 398
37 iso_pu_bacteria 2919119836 2919122697 398
38 3300045051 Ga0451576_0002030 Ga0451576_0002030_9462_10688 399
39 3300049571 Ga0501034_0034287 Ga0501034_0034287_2289_3503 399
40 3300049581 Ga0501047_0005927 Ga0501047_0005927_8868_10082 399
41 3300049586 Ga0501070_0020125 Ga0501070_0020125_2724_3938 399
42 3300049586 Ga0501070_0031163 Ga0501070_0031163_371_1570 399
43 3300049589 Ga0501073_0165018 Ga0501073_0165018_255_1454 399
44 3300049742 Ga0501080_0028453 Ga0501080_0028453_3904_5118 399
45 3300049822 Ga0501035_0016352 Ga0501035_0016352_2945_4159 399
46 iso_pu_bacteria 2551306091 2551728526 399
47 3300044712 Ga0453684_0000519 Ga0453684_0000519_22162_23367 400
48 3300048915 Ga0496112_0096482 Ga0496112_0096482_68_1285 400
49 3300048919 Ga0496116_0034956 Ga0496116_0034956_1491_2708 400
50 3300048920 Ga0496117_0000581 Ga0496117_0000581_25561_26778 400
51 3300048921 Ga0496118_0000052 Ga0496118_0000052_229933_231150 400
52 3300048922 Ga0496119_0031423 Ga0496119_0031423_297_1514 400
53 3300048923 Ga0496120_0036255 Ga0496120_0036255_1503_2720 400
54 3300048924 Ga0496121_0020959 Ga0496121_0020959_342_1559 400
55 3300048927 Ga0496124_0077501 Ga0496124_0077501_505_1722 400
56 3300048928 Ga0496125_0054082 Ga0496125_0054082_1783_3000 400
57 3300048929 Ga0496126_0182369 Ga0496126_0182369_75_1292 400
58 3300049570 Ga0501033_0071859 Ga0501033_0071859_132_1340 400
59 3300049573 Ga0501037_0020037 Ga0501037_0020037_3626_4834 400
60 3300049574 Ga0501038_0019723 Ga0501038_0019723_1420_2628 400
61 iso_pu_bacteria 2510917028 2511186750 400
62 iso_pu_bacteria 2512047086 2512529190 400
63 iso_pu_bacteria 2513237087 2513591956 400
64 iso_pu_bacteria 2513237089 2513604907 400
65 iso_pu_bacteria 2513237156 2513983755 400
66 iso_pu_bacteria 2513237160 2514006617 400
67 iso_pu_bacteria 2517487022 2517565767 400
68 iso_pu_bacteria 2582581867 2585401880 400
69 iso_pu_bacteria 2585427590 2585820294 400
70 iso_pu_bacteria 2643221637 2644209750 400
71 iso_pu_bacteria 2643221718 2644653300 400
72 iso_pu_bacteria 2802428858 2802720574 400
73 iso_pu_bacteria 2802428859 2802726653 400
74 iso_pu_bacteria 2802428860 2802732603 400
75 iso_pu_bacteria 2802428861 2802739724 400
76 iso_pu_bacteria 2802428862 2802746085 400
77 iso_pu_bacteria 2802428863 2802748799 400
78 iso_pu_bacteria 2818991440 2819565925 400
79 iso_pu_bacteria 2838074704 2838078986 400
80 iso_pu_bacteria 2854916844 2854917946 400
81 iso_pu_bacteria 2896384573 2896386272 400
82 iso_pu_bacteria 2904463128 2904466196 400
83 iso_pu_bacteria 2915980308 2915981959 400
84 iso_pu_bacteria 2916061851 2916064390 400
85 iso_pu_bacteria 2916068649 2916072031 400
86 iso_pu_bacteria 2921250672 2921251904 400
87 iso_pu_bacteria 2921289301 2921289349 400
88 iso_pu_bacteria 2937029754 2937031500 400
89 iso_pu_bacteria 2937036028 2937037360 400
90 iso_pu_bacteria 2937078374 2937083546 400
91 iso_pu_bacteria 2937084907 2937091682 400
92 iso_pu_bacteria 2939669807 2939670630 400
93 iso_pu_bacteria 2957375807 2957379282 400
94 iso_pu_bacteria 2957437181 2957438435 400
95 iso_pu_bacteria 2960591022 2960594490 400
96 iso_pu_bacteria 2960631154 2960632404 400
97 iso_pu_bacteria 2960680706 2960682024 400
98 iso_pu_bacteria 2960693952 2960697957 400
99 iso_pu_bacteria 2967686174 2967692744 400
100 iso_pu_bacteria 2967728569 2967732299 400
101 iso_pu_bacteria 2970026789 2970031256 400
102 iso_pu_bacteria 2970122695 2970127147 400
103 iso_pu_bacteria 2970143518 2970145957 400
104 iso_pu_bacteria 2977530762 2977536735 400
105 iso_pu_bacteria 2977544691 2977551557 400
106 iso_pu_bacteria 8003999396 8004004250 400
107 3300006946 Ga0079104_1005719 Ga0079104_10057195 401
108 3300046529 Ga0495652_0014363 Ga0495652_0014363_936_2156 401
109 3300006038 Ga0075365_10016831 Ga0075365_100168314 402
110 3300006038 Ga0075365_10028243 Ga0075365_100282433 402
111 3300044658 Ga0466972_0000043 Ga0466972_0000043_16214_17437 402
112 iso_pu_bacteria 2510065057 2510303843 402
113 iso_pu_bacteria 2511231052 2511498033 402
114 iso_pu_bacteria 2513237086 2513583797 402
115 iso_pu_bacteria 2513237091 2513617320 402
116 iso_pu_bacteria 2513237140 2513882443 402
117 iso_pu_bacteria 2513237143 2513904123 402
118 iso_pu_bacteria 2515154107 2515612588 402
119 iso_pu_bacteria 2516653046 2516896322 402
120 iso_pu_bacteria 2524023207 2524449754 402
121 iso_pu_bacteria 2551306084 2551676199 402
122 iso_pu_bacteria 2551306085 2551685666 402
123 iso_pu_bacteria 2551306086 2551695177 402
124 iso_pu_bacteria 2551306087 2551698448 402
125 iso_pu_bacteria 2551306089 2551709951 402
126 iso_pu_bacteria 2551306090 2551723349 402
127 iso_pu_bacteria 2551306092 2551735487 402
128 iso_pu_bacteria 2855825444 2855828852 402
129 iso_pu_bacteria 2855839649 2855843976 402
130 iso_pu_bacteria 2858800743 2858806781 402
131 iso_pu_bacteria 2915993759 2915994631 402
132 iso_pu_bacteria 2916000859 2916007164 402
133 iso_pu_bacteria 2916007675 2916010266 402
134 iso_pu_bacteria 2916014648 2916016182 402
135 iso_pu_bacteria 2916021584 2916022815 402
136 iso_pu_bacteria 2916028427 2916031642 402
137 iso_pu_bacteria 2916035215 2916036148 402
138 iso_pu_bacteria 2916041962 2916044421 402
139 iso_pu_bacteria 2916048683 2916050894 402
140 iso_pu_bacteria 2916055098 2916061288 402
141 iso_pu_bacteria 2916076590 2916081748 402
142 iso_pu_bacteria 2921201388 2921203390 402
143 iso_pu_bacteria 2921208531 2921210521 402
144 iso_pu_bacteria 2921237296 2921238641 402
145 iso_pu_bacteria 2921244191 2921249269 402
146 iso_pu_bacteria 2921257292 2921262293 402
147 iso_pu_bacteria 2921263974 2921265629 402
148 iso_pu_bacteria 2921282425 2921282483 402
149 iso_pu_bacteria 2921296804 2921299748 402
150 iso_pu_bacteria 2924144063 2924145871 402
151 iso_pu_bacteria 2924150972 2924152599 402
152 iso_pu_bacteria 2924158325 2924159612 402
153 iso_pu_bacteria 2924165586 2924170149 402
154 iso_pu_bacteria 2924172951 2924178097 402
155 iso_pu_bacteria 2924179722 2924182137 402
156 iso_pu_bacteria 2924186466 2924190624 402
157 iso_pu_bacteria 2924193448 2924199491 402
158 iso_pu_bacteria 2924200457 2924205146 402
159 iso_pu_bacteria 2924207177 2924208356 402
160 iso_pu_bacteria 2924221636 2924225380 402
161 iso_pu_bacteria 2924228884 2924229187 402
162 iso_pu_bacteria 2936996657 2937001972 402
163 iso_pu_bacteria 2937002841 2937007169 402
164 iso_pu_bacteria 2937009748 2937015857 402
165 iso_pu_bacteria 2937016420 2937022660 402
166 iso_pu_bacteria 2937023124 2937024194 402
167 iso_pu_bacteria 2937042894 2937048517 402
168 iso_pu_bacteria 2937056579 2937062741 402
169 iso_pu_bacteria 2937063883 2937066669 402
170 iso_pu_bacteria 2937071275 2937072431 402
171 iso_pu_bacteria 2937091812 2937098682 402
172 iso_pu_bacteria 2937098957 2937105303 402
173 iso_pu_bacteria 2937106411 2937107858 402
174 iso_pu_bacteria 2937113482 2937114388 402
175 iso_pu_bacteria 2937119839 2937122774 402
176 iso_pu_bacteria 2937126314 2937132168 402
177 iso_pu_bacteria 2957382221 2957384192 402
178 iso_pu_bacteria 2957388812 2957390419 402
179 iso_pu_bacteria 2957395598 2957401109 402
180 iso_pu_bacteria 2957402308 2957408027 402
181 iso_pu_bacteria 2957408893 2957409763 402
182 iso_pu_bacteria 2957415311 2957420632 402
183 iso_pu_bacteria 2957422303 2957425800 402
184 iso_pu_bacteria 2957443900 2957448812 402
185 iso_pu_bacteria 2957450854 2957452040 402
186 iso_pu_bacteria 2957457609 2957462915 402
187 iso_pu_bacteria 2957464669 2957467430 402
188 iso_pu_bacteria 2957471148 2957477764 402
189 iso_pu_bacteria 2957478035 2957484571 402
190 iso_pu_bacteria 2957484790 2957488125 402
191 iso_pu_bacteria 2957491536 2957497497 402
192 iso_pu_bacteria 2957505466 2957511122 402
193 iso_pu_bacteria 2960584000 2960589990 402
194 iso_pu_bacteria 2960597568 2960598595 402
195 iso_pu_bacteria 2960603979 2960605907 402
196 iso_pu_bacteria 2960610863 2960615450 402
197 iso_pu_bacteria 2960617483 2960622930 402
198 iso_pu_bacteria 2960624210 2960630441 402
199 iso_pu_bacteria 2960637947 2960641904 402
200 iso_pu_bacteria 2960645483 2960648209 402
201 iso_pu_bacteria 2960652885 2960657973 402
202 iso_pu_bacteria 2960660292 2960664650 402
203 iso_pu_bacteria 2960667422 2960667814 402
204 iso_pu_bacteria 2960674078 2960678195 402
205 iso_pu_bacteria 2960687367 2960693861 402
206 iso_pu_bacteria 2964607997 2964613282 402
207 iso_pu_bacteria 2964615318 2964615944 402
208 iso_pu_bacteria 2964628898 2964632372 402
209 iso_pu_bacteria 2964636051 2964636709 402
210 iso_pu_bacteria 2964643177 2964648434 402
211 iso_pu_bacteria 2964649959 2964656064 402
212 iso_pu_bacteria 2964656573 2964659157 402
213 iso_pu_bacteria 2964663802 2964670623 402
214 iso_pu_bacteria 2964670856 2964673715 402
215 iso_pu_bacteria 2964678106 2964679007 402
216 iso_pu_bacteria 2964685014 2964688391 402
217 iso_pu_bacteria 2964691889 2964697949 402
218 iso_pu_bacteria 2964705432 2964709498 402
219 iso_pu_bacteria 2964719344 2964724560 402
220 iso_pu_bacteria 2967664464 2967666854 402
221 iso_pu_bacteria 2967671571 2967674055 402
222 iso_pu_bacteria 2967678726 2967684337 402
223 iso_pu_bacteria 2967693043 2967693750 402
224 iso_pu_bacteria 2967699805 2967705182 402
225 iso_pu_bacteria 2967706974 2967710988 402
226 iso_pu_bacteria 2967714385 2967715513 402
227 iso_pu_bacteria 2967721400 2967724505 402
228 iso_pu_bacteria 2967735183 2967736095 402
229 iso_pu_bacteria 2967742019 2967747103 402
230 iso_pu_bacteria 2967748971 2967751176 402
231 iso_pu_bacteria 2967755722 2967762131 402
232 iso_pu_bacteria 2967762386 2967768288 402
233 iso_pu_bacteria 2967769361 2967775414 402
234 iso_pu_bacteria 2970019648 2970022961 402
235 iso_pu_bacteria 2970033650 2970037948 402
236 iso_pu_bacteria 2970047711 2970053234 402
237 iso_pu_bacteria 2970054988 2970055440 402
238 iso_pu_bacteria 2970061556 2970062188 402
239 iso_pu_bacteria 2970068827 2970071642 402
240 iso_pu_bacteria 2970076120 2970080638 402
241 iso_pu_bacteria 2970082768 2970088714 402
242 iso_pu_bacteria 2970088815 2970092311 402
243 iso_pu_bacteria 2970095765 2970100472 402
244 iso_pu_bacteria 2970102677 2970103588 402
245 iso_pu_bacteria 2970109326 2970114666 402
246 iso_pu_bacteria 2970129317 2970130549 402
247 iso_pu_bacteria 2970136068 2970137895 402
248 iso_pu_bacteria 2970149975 2970155124 402
249 iso_pu_bacteria 2970156795 2970157337 402
250 iso_pu_bacteria 2970164137 2970165794 402
251 iso_pu_bacteria 2970170962 2970177573 402
252 iso_pu_bacteria 2970177841 2970180351 402
253 iso_pu_bacteria 2970184632 2970186053 402
254 iso_pu_bacteria 2970191845 2970192121 402
255 iso_pu_bacteria 2977516862 2977518102 402
256 iso_pu_bacteria 2977523885 2977528315 402
257 iso_pu_bacteria 2977537788 2977538909 402
258 iso_pu_bacteria 2977551784 2977552487 402
259 iso_pu_bacteria 2977558990 2977561920 402
260 iso_pu_bacteria 2977565890 2977570716 402
261 iso_pu_bacteria 2977572785 2977579360 402
262 iso_pu_bacteria 648276728 648737586 402
263 iso_pu_bacteria 8003992118 8003996548 402
264 3300003320 rootH2_10036043 rootH2_100360438 403
265 3300003320 rootH2_10045803 rootH2_100458033 403
266 3300003322 rootL2_10029479 rootL2_100294792 403
267 3300003323 rootH1_10125919 rootH1_101259192 403
268 3300010375 Ga0105239_10061389 Ga0105239_100613895 403
269 3300031241 Ga0265325_10009100 Ga0265325_100091005 403
270 3300031241 Ga0265325_10065813 Ga0265325_100658131 403
271 3300033180 Ga0307510_10005631 Ga0307510_100056312 403
272 3300037471 Ga0395905_0000173 Ga0395905_0000173_88860_90104 403
273 3300037471 Ga0395905_0040935 Ga0395905_0040935_1251_2492 403
274 3300042876 Ga0451577_0002737 Ga0451577_0002737_15437_16711 403
275 3300044693 Ga0466961_0020124 Ga0466961_0020124_1461_2729 403
276 3300044693 Ga0466961_0079873 Ga0466961_0079873_134_1378 403
277 3300044712 Ga0453684_0001505 Ga0453684_0001505_40967_42241 403
278 3300044719 Ga0466971_0085490 Ga0466971_0085490_134_1402 403
279 3300045051 Ga0451576_0000511 Ga0451576_0000511_23492_24766 403
280 3300045836 Ga0466958_0010933 Ga0466958_0010933_2190_3458 403
281 3300045976 Ga0466967_0136327 Ga0466967_0136327_770_2038 403
282 3300002459 JGI24751J29686_10000431 JGI24751J29686_100004315 404
283 3300003320 rootH2_10200901 rootH2_102009012 404
284 3300003761 Ga0055535_1000292 Ga0055535_100029214 404
285 3300003763 Ga0055529_1000130 Ga0055529_10001309 404
286 3300005353 Ga0070669_100000094 Ga0070669_10000009446 404
287 3300005355 Ga0070671_100025723 Ga0070671_1000257232 404
288 3300005548 Ga0070665_100007420 Ga0070665_1000074204 404
289 3300005548 Ga0070665_100024864 Ga0070665_1000248644 404
290 3300005548 Ga0070665_100106580 Ga0070665_1001065803 404
291 3300005563 Ga0068855_100046715 Ga0068855_1000467152 404
292 3300005577 Ga0068857_100182251 Ga0068857_1001822512 404
293 3300005617 Ga0068859_100007096 Ga0068859_1000070962 404
294 3300005842 Ga0068858_100013523 Ga0068858_1000135232 404
295 3300006186 Ga0075369_10012595 Ga0075369_100125951 404
296 3300006931 Ga0097620_100007097 Ga0097620_1000070972 404
297 3300006946 Ga0079104_1002181 Ga0079104_10021817 404
298 3300009177 Ga0105248_10027950 Ga0105248_100279506 404
299 3300009545 Ga0105237_10064662 Ga0105237_100646621 404
300 3300014325 Ga0163163_10457442 Ga0163163_104574422 404
301 3300021320 Ga0214544_1000029 Ga0214544_100002934 404
302 3300021321 Ga0214542_1000092 Ga0214542_10000923 404
303 3300021327 Ga0214543_1000045 Ga0214543_100004534 404
304 3300022739 Ga0228711_1000011 Ga0228711_100001116 404
305 3300022740 Ga0228710_1000283 Ga0228710_100028335 404
306 3300025242 Ga0209258_100128 Ga0209258_10012826 404
307 3300025254 Ga0209148_1006285 Ga0209148_10062852 404
308 3300025256 Ga0209759_1000666 Ga0209759_100066614 404
309 3300025272 Ga0209455_1000116 Ga0209455_100011626 404
310 3300025303 Ga0209051_1001447 Ga0209051_10014477 404
311 3300025923 Ga0207681_10000995 Ga0207681_100009952 404
312 3300025931 Ga0207644_10039478 Ga0207644_100394782 404
313 3300025941 Ga0207711_10145103 Ga0207711_101451032 404
314 3300025949 Ga0207667_10009285 Ga0207667_100092856 404
315 3300025949 Ga0207667_10034756 Ga0207667_100347561 404
316 3300026035 Ga0207703_10009432 Ga0207703_100094324 404
317 3300026035 Ga0207703_10046286 Ga0207703_100462862 404
318 3300026116 Ga0207674_10268600 Ga0207674_102686002 404
319 3300026116 Ga0207674_10388175 Ga0207674_103881751 404
320 3300026142 Ga0207698_10024200 Ga0207698_100242001 404
321 3300027111 Ga0209281_1000087 Ga0209281_100008757 404
322 3300027111 Ga0209281_1000188 Ga0209281_100018858 404
323 3300027666 Ga0209282_1000008 Ga0209282_100000858 404
324 3300028379 Ga0268266_10003046 Ga0268266_1000304615 404
325 3300028379 Ga0268266_10012727 Ga0268266_100127272 404
326 3300028379 Ga0268266_10024792 Ga0268266_100247924 404
327 3300028379 Ga0268266_10028683 Ga0268266_100286832 404
328 3300028380 Ga0268265_10017435 Ga0268265_100174352 404
329 3300031250 Ga0265331_10045867 Ga0265331_100458671 404
330 3300031251 Ga0265327_10010862 Ga0265327_100108623 404
331 3300031730 Ga0307516_10001419 Ga0307516_1000141910 404
332 3300031967 Ga0315914_1000011 Ga0315914_1000011115 404
333 3300033430 Ga0315913_1000008 Ga0315913_100000899 404
334 3300033464 Ga0315915_1000009 Ga0315915_1000009158 404
335 3300037312 Ga0395899_0113475 Ga0395899_0113475_411_1802 404
336 3300039447 Ga0436361_0489077 Ga0436361_0489077_1354_2616 404
337 3300039447 Ga0436361_0821446 Ga0436361_0821446_150_1412 404
338 3300042007 Ga0439449_0011348 Ga0439449_0011348_870_2105 404
339 3300044684 Ga0466966_0005538 Ga0466966_0005538_1927_3189 404
340 3300044706 Ga0466964_0020576 Ga0466964_0020576_1016_2278 404
341 3300044712 Ga0453684_0000823 Ga0453684_0000823_8546_9829 404
342 3300044712 Ga0453684_0001185 Ga0453684_0001185_12645_13880 404
343 3300044719 Ga0466971_0002870 Ga0466971_0002870_3118_4380 404
344 3300045049 Ga0466959_0074424 Ga0466959_0074424_171_1448 404
345 3300045051 Ga0451576_0152593 Ga0451576_0152593_621_1838 404
346 3300046499 Ga0495594_0055356 Ga0495594_0055356_114_1346 404
347 3300046526 Ga0495666_0003872 Ga0495666_0003872_4523_5755 404
348 3300046531 Ga0495665_0090075 Ga0495665_0090075_336_1568 404
349 3300046557 Ga0495622_0013446 Ga0495622_0013446_1317_2549 404
350 3300046559 Ga0495667_0142334 Ga0495667_0142334_290_1522 404
351 3300046674 Ga0495588_0003728 Ga0495588_0003728_803_2035 404
352 3300047315 Ga0495581_0010599 Ga0495581_0010599_699_1931 404
353 3300047317 Ga0495604_0039569 Ga0495604_0039569_1909_3141 404
354 3300047443 Ga0495687_018409 Ga0495687_018409_481_1821 404
355 3300047444 Ga0495675_0136032 Ga0495675_0136032_44_1276 404
356 3300048088 Ga0495602_0067192 Ga0495602_0067192_1759_2991 404
357 3300048904 Ga0496101_0023161 Ga0496101_0023161_658_1872 404
358 3300048907 Ga0496104_0022759 Ga0496104_0022759_914_2173 404
359 3300048907 Ga0496104_0070111 Ga0496104_0070111_784_2055 404
360 3300048908 Ga0496105_0018093 Ga0496105_0018093_3384_4643 404
361 3300048908 Ga0496105_0053397 Ga0496105_0053397_1539_2810 404
362 3300048909 Ga0496106_0000445 Ga0496106_0000445_25284_26498 404
363 3300048915 Ga0496112_0001097 Ga0496112_0001097_16076_17341 404
364 3300048915 Ga0496112_0035353 Ga0496112_0035353_230_1489 404
365 3300048916 Ga0496113_0000316 Ga0496113_0000316_19113_20327 404
366 3300048916 Ga0496113_0002851 Ga0496113_0002851_6718_7983 404
367 3300048918 Ga0496115_0003132 Ga0496115_0003132_4081_5346 404
368 3300048922 Ga0496119_0000422 Ga0496119_0000422_22333_23679 404
369 3300048923 Ga0496120_0000451 Ga0496120_0000451_10868_12214 404
370 3300048929 Ga0496126_0000483 Ga0496126_0000483_13703_14917 404
371 3300049591 Ga0501075_0095906 Ga0501075_0095906_806_2047 404
372 3300049824 Ga0501045_0047236 Ga0501045_0047236_170_1411 404
373 3300061719 Ga0466962_0002710 Ga0466962_0002710_1834_3096 404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12000

Glyco_trans_4_3

Glycosyl transferase family 4 group

25

192

0.99

PF00534

Glycos_transf_1

Glycosyl transferases group 1

206

382

0.93

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

213

368

0.85

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

233

393

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8324 212 381
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8222 211 381
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8175 212 381
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8115 185 385
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8039 185 385
ID Description Score Start End Superfamily
3c4vA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8856 211 378 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8788 211 383 3.40.50.2000
af_Q58469_205_369_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8765 209 377 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8735 211 381 3.40.50.2000
af_P9WMY7_260_428_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8648 207 381 3.40.50.2000
ID Description Score Start End GO Terms
AF-C4XMP6-F1-model_v4 Putative glycosyltransferase 0.9743 2 401 GO:0016757
AF-A0A1F4CR23-F1-model_v4 Glycosyl transferase family 4 domain-containing protein 0.972 1 182
AF-C4XMP6-F1-model_v4 Putative glycosyltransferase 0.9624 2 401 GO:0016757
AF-A0A326QMJ4-F1-model_v4 Glycosyl transferase family 1 0.9594 1 401 GO:0009103
GO:0016757
GO:0045226
AF-A0A326QMJ4-F1-model_v4 Glycosyl transferase family 1 0.9501 1 401 GO:0009103
GO:0016757
GO:0045226

Feature Viewer

pLDDT pTM Quality
95.08 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map