F426459

General Info

Members Datasets Scaffolds Average Seq Length
373 243 743 205

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0142303|Ga0495582_0142303_472_1143
Length 223
Sequence LVIKTEVGKPYLHQMELQTLTEFKSTKELNERLYAFGISKSFSEGDIILNENAFIKSIPIVTSGSIRVMRTDDEGREILLYYIVSGESCIMSFLGGMHHDTSKVKVIAEEKTDILFIPIDKVGQLIKEFPEWLDYIFRLYHKRFEELLEVVNAVAFKKMDERLLNLIKKKCELTHNKTLLVTHEQLANELGTARVVVSRLLKQMEDVGLIKLGRNKIALMDHK

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
201 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
202 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
203 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
204 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
205 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
206 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
207 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
208 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
209 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
210 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
211 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
212 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
213 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
214 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
215 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
216 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
217 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
218 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
219 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
220 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
221 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
222 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
223 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
224 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
225 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
226 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
227 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
228 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
229 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
230 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
231 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
232 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
233 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
234 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
235 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
236 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
237 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
238 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
239 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
240 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
241 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
242 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
243 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.4
Metatranscriptomes 0
Isolates 12.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 0.27
Rhizoplane 0.54
Rhizosphere 82.57
Stem 0
Stem Tuber 0
Unclassified 11.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0142303 3300046473 Unclassified 1360
2 SwRhRL2b_contig_1282653 2162886007 Bacteria 1454
3 JGI24740J21852_10065818 3300001979 Bacteria 985
4 JGI24739J22299_10000079 3300001989 Bacteria 27300
5 JGI24739J22299_10002868 3300001989 Bacteria 6614
6 JGI24744J21845_10031081 3300002077 Unclassified 1022
7 JGI25162J39368_1001015 3300002737 Bacteria 17521
8 JGI25165J46597_1005166 3300003214 Bacteria 2581
9 rootH2_10220209 3300003320 Unclassified 2971
10 rootH2_10260630 3300003320 Bacteria 4800
11 rootL2_10055485 3300003322 Bacteria 17147
12 rootH1_10017251 3300003316 Bacteria 3986
13 rootH1_10017251 3300003323 Bacteria 15453
14 rootH1_10083334 3300003323 Bacteria 6524
15 rootH1_10207970 3300003323 Bacteria 8626
16 Ga0055535_1008895 3300003761 Bacteria 1770
17 Ga0055542_1005119 3300003762 Bacteria 3023
18 Ga0055534_1016747 3300003784 Bacteria 1309
19 Ga0065165_1015714 3300005262 Unclassified 2875
20 Ga0065704_10071391 3300005289 Bacteria 11354
21 Ga0070658_10024802 3300005327 Bacteria 4809
22 Ga0070676_10001603 3300005328 Bacteria 11503
23 Ga0070670_100013962 3300005331 Bacteria 6889
24 Ga0070670_100772760 3300005331 Bacteria 866
25 Ga0070677_10012758 3300005333 Unclassified 2923
26 Ga0068869_100062931 3300005334 Bacteria 2724
27 Ga0068869_100123655 3300005334 Bacteria 1982
28 Ga0068869_100167951 3300005334 Bacteria 1712
29 Ga0070666_10035915 3300005335 Bacteria 3286
30 Ga0070680_100097209 3300005336 Unclassified 2442
31 Ga0070682_100000327 3300005337 Bacteria 32624
32 Ga0068868_100072856 3300005338 Bacteria 2741
33 Ga0068868_100112952 3300005338 Bacteria 2208
34 Ga0070660_100012641 3300005339 Bacteria 6033
35 Ga0070660_100302601 3300005339 Bacteria 1311
36 Ga0070660_100415613 3300005339 Bacteria 1113
37 Ga0070668_100015470 3300005347 Bacteria 5703
38 Ga0070669_100046039 3300005353 Bacteria 3181
39 Ga0070669_100469165 3300005353 Unclassified 1040
40 Ga0070675_100096459 3300005354 Bacteria 2484
41 Ga0070674_100015219 3300005356 Bacteria 4800
42 Ga0070673_100003555 3300005364 Bacteria 9726
43 Ga0070688_100172646 3300005365 Unclassified 1493
44 Ga0070659_100014581 3300005366 Bacteria 5876
45 Ga0070667_100143086 3300005367 Bacteria 2096
46 Ga0070663_100085265 3300005455 Bacteria 2330
47 Ga0070678_100078833 3300005456 Bacteria 2489
48 Ga0068867_100193470 3300005459 Unclassified 1624
49 Ga0068867_100696721 3300005459 Bacteria 896
50 Ga0070685_10033767 3300005466 Unclassified 2877
51 Ga0070685_10366134 3300005466 Unclassified 989
52 Ga0070679_100077754 3300005530 Bacteria 3308
53 Ga0070679_100087603 3300005530 Bacteria 3101
54 Ga0068853_100014635 3300005539 Bacteria 6434
55 Ga0068853_100317172 3300005539 Unclassified 1444
56 Ga0070672_100108462 3300005543 Bacteria 2260
57 Ga0070665_100010114 3300005548 Bacteria 9544
58 Ga0068855_100000043 3300005563 Bacteria 149118
59 Ga0068855_100029344 3300005563 Bacteria 6577
60 Ga0068855_100031041 3300005563 Bacteria 6385
61 Ga0068854_100041787 3300005578 Bacteria 3241
62 Ga0068856_100002935 3300005614 Bacteria 17471
63 Ga0068856_100068402 3300005614 Bacteria 3510
64 Ga0068852_100008206 3300005616 Bacteria 7673
65 Ga0068852_100103315 3300005616 Unclassified 2577
66 Ga0068852_100369501 3300005616 Bacteria 1405
67 Ga0068852_100394216 3300005616 Unclassified 1361
68 Ga0068852_100432857 3300005616 Bacteria 1299
69 Ga0068859_100004553 3300005617 Bacteria 14139
70 Ga0068859_100036491 3300005617 Bacteria 4935
71 Ga0068859_100061320 3300005617 Bacteria 3790
72 Ga0068864_100111334 3300005618 Bacteria 2439
73 Ga0068864_100260703 3300005618 Bacteria 1612
74 Ga0068866_10018173 3300005718 Bacteria 3174
75 Ga0068861_100339024 3300005719 Unclassified 1315
76 Ga0068870_10003550 3300005840 Bacteria 6617
77 Ga0068858_100406761 3300005842 Unclassified 1308
78 Ga0068858_101200407 3300005842 Bacteria 746
79 Ga0068860_100005913 3300005843 Bacteria 12313
80 Ga0068860_100038533 3300005843 Unclassified 4573
81 Ga0068860_100084699 3300005843 Bacteria 3015
82 Ga0068860_100119124 3300005843 Unclassified 2527
83 Ga0068862_100070406 3300005844 Bacteria 3020
84 Ga0068862_100511000 3300005844 Unclassified 1142
85 Ga0075366_10006578 3300006195 Bacteria 6377
86 Ga0068871_100183150 3300006358 Bacteria 1801
87 Ga0068865_100002314 3300006881 Bacteria 11222
88 Ga0097620_100004553 3300006931 Bacteria 14139
89 Ga0097620_100036491 3300006931 Bacteria 4935
90 Ga0097620_100061320 3300006931 Bacteria 3790
91 Ga0097620_100366638 3300006931 Bacteria 1536
92 Ga0105244_10000011 3300009036 Bacteria 263939
93 Ga0105240_10000185 3300009093 Bacteria 126364
94 Ga0105245_10634977 3300009098 Unclassified 1097
95 Ga0105243_10000375 3300009148 Bacteria 47961
96 Ga0105241_10024908 3300009174 Bacteria 4446
97 Ga0105241_10038525 3300009174 Bacteria 3604
98 Ga0105241_10116544 3300009174 Bacteria 2145
99 Ga0105241_10557708 3300009174 Bacteria 1029
100 Ga0105242_10038381 3300009176 Bacteria 3851
101 Ga0105242_10142035 3300009176 Bacteria 2084
102 Ga0105237_10000154 3300009545 Bacteria 96509
103 Ga0105237_10028046 3300009545 Bacteria 5737
104 Ga0105237_10028766 3300009545 Bacteria 5655
105 Ga0105237_10430477 3300009545 Unclassified 1325
106 Ga0105249_10207305 3300009553 Bacteria 1921
107 Ga0105249_10305354 3300009553 Bacteria 1597
108 Ga0105239_10004024 3300010375 Bacteria 17800
109 Ga0105239_10027864 3300010375 Bacteria 6215
110 Ga0105239_11505462 3300010375 Unclassified 778
111 Ga0105246_10025754 3300011119 Unclassified 3836
112 Ga0157373_10000024 3300013100 Bacteria 153349
113 Ga0157373_10038159 3300013100 Bacteria 3443
114 Ga0157373_10098630 3300013100 Bacteria 2056
115 Ga0157373_10272195 3300013100 Bacteria 1199
116 Ga0157371_10001686 3300013102 Bacteria 22505
117 Ga0157371_10006698 3300013102 Bacteria 9422
118 Ga0157371_10013848 3300013102 Bacteria 6109
119 Ga0157371_10020435 3300013102 Bacteria 4872
120 Ga0157371_10079146 3300013102 Bacteria 2328
121 Ga0157370_10000463 3300013104 Bacteria 50658
122 Ga0157370_10005447 3300013104 Bacteria 14277
123 Ga0157370_10010602 3300013104 Bacteria 9702
124 Ga0157370_10074770 3300013104 Bacteria 3195
125 Ga0157370_10189245 3300013104 Bacteria 1910
126 Ga0157370_10221117 3300013104 Bacteria 1754
127 Ga0157370_10321709 3300013104 Bacteria 1427
128 Ga0157369_10084522 3300013105 Bacteria 3392
129 Ga0157369_10084893 3300013105 Bacteria 3383
130 Ga0157369_10433530 3300013105 Bacteria 1362
131 Ga0157374_10275971 3300013296 Bacteria 1658
132 Ga0157374_10359811 3300013296 Unclassified 1447
133 Ga0157372_10013469 3300013307 Bacteria 8738
134 Ga0157372_10019675 3300013307 Bacteria 7274
135 Ga0157372_10052900 3300013307 Bacteria 4524
136 Ga0157372_10077958 3300013307 Bacteria 3744
137 Ga0157372_10218135 3300013307 Bacteria 2211
138 Ga0157372_10643206 3300013307 Bacteria 1235
139 Ga0157375_10014678 3300013308 Bacteria 6997
140 Ga0157375_10034449 3300013308 Bacteria 4824
141 Ga0157375_10669091 3300013308 Bacteria 1193
142 Ga0157375_11522106 3300013308 Bacteria 790
143 Ga0163163_10001214 3300014325 Bacteria 21788
144 Ga0182008_10000029 3300014497 Bacteria 176649
145 Ga0182008_10000791 3300014497 Bacteria 22182
146 Ga0157377_10129071 3300014745 Unclassified 1542
147 Ga0157376_10003976 3300014969 Bacteria 10216
148 Ga0182006_1000110 3300015261 Bacteria 88392
149 Ga0182006_1000489 3300015261 Bacteria 31083
150 Ga0182005_1000229 3300015265 Bacteria 36313
151 Ga0163161_10021066 3300017792 Bacteria 4582
152 Ga0209436_102026 3300025208 Bacteria 6401
153 Ga0207427_100043 3300025231 Bacteria 249595
154 Ga0209437_100008 3300025233 Bacteria 921142
155 Ga0209258_100193 3300025242 Bacteria 124682
156 Ga0209026_1005574 3300025250 Bacteria 3343
157 Ga0209148_1000167 3300025254 Bacteria 135407
158 Ga0209233_1000366 3300025261 Bacteria 40794
159 Ga0209675_1000042 3300025291 Bacteria 235989
160 Ga0207426_1006540 3300025302 Bacteria 5041
161 Ga0207655_1000546 3300025728 Bacteria 47374
162 Ga0207682_10014406 3300025893 Unclassified 3080
163 Ga0207642_10032774 3300025899 Unclassified 2192
164 Ga0207680_10006118 3300025903 Bacteria 5800
165 Ga0207647_10000988 3300025904 Bacteria 22050
166 Ga0207647_10090645 3300025904 Bacteria 1823
167 Ga0207645_10000088 3300025907 Bacteria 65894
168 Ga0207643_10007645 3300025908 Bacteria 5807
169 Ga0207705_10031685 3300025909 Bacteria 3775
170 Ga0207705_10154619 3300025909 Bacteria 1720
171 Ga0207654_10013498 3300025911 Bacteria 4204
172 Ga0207654_10027856 3300025911 Unclassified 3075
173 Ga0207695_10000117 3300025913 Bacteria 237982
174 Ga0207695_10292594 3300025913 Unclassified 1521
175 Ga0207671_10000185 3300025914 Bacteria 95649
176 Ga0207671_10026103 3300025914 Bacteria 4381
177 Ga0207671_10149851 3300025914 Unclassified 1802
178 Ga0207660_10283607 3300025917 Bacteria 1315
179 Ga0207657_10022458 3300025919 Bacteria 5901
180 Ga0207657_10253470 3300025919 Bacteria 1402
181 Ga0207657_10379891 3300025919 Bacteria 1113
182 Ga0207652_10086278 3300025921 Bacteria 2752
183 Ga0207681_10032871 3300025923 Bacteria 3399
184 Ga0207681_10266254 3300025923 Unclassified 1344
185 Ga0207694_10950692 3300025924 Bacteria 727
186 Ga0207659_10173908 3300025926 Bacteria 1701
187 Ga0207690_10013944 3300025932 Bacteria 4843
188 Ga0207709_10000601 3300025935 Bacteria 29889
189 Ga0207669_10009520 3300025937 Unclassified 4634
190 Ga0207704_10003660 3300025938 Bacteria 6983
191 Ga0207691_10011128 3300025940 Bacteria 8636
192 Ga0207689_10004872 3300025942 Bacteria 12099
193 Ga0207689_10053989 3300025942 Bacteria 3310
194 Ga0207661_10127827 3300025944 Bacteria 2173
195 Ga0207667_10000015 3300025949 Bacteria 417534
196 Ga0207667_10024242 3300025949 Bacteria 6666
197 Ga0207667_10055189 3300025949 Bacteria 4177
198 Ga0207667_10115734 3300025949 Bacteria 2764
199 Ga0207651_10034166 3300025960 Unclassified 3290
200 Ga0207712_10424454 3300025961 Bacteria 1122
201 Ga0207668_10062596 3300025972 Bacteria 2620
202 Ga0207640_10637344 3300025981 Bacteria 906
203 Ga0207677_10131488 3300026023 Bacteria 1901
204 Ga0207639_10242237 3300026041 Bacteria 1568
205 Ga0207639_10791575 3300026041 Unclassified 883
206 Ga0207678_10335749 3300026067 Bacteria 1302
207 Ga0207702_10035253 3300026078 Bacteria 4184
208 Ga0207702_10081419 3300026078 Bacteria 2811
209 Ga0207648_10006425 3300026089 Bacteria 11682
210 Ga0207676_10035249 3300026095 Bacteria 3797
211 Ga0207676_10095222 3300026095 Bacteria 2455
212 Ga0207675_100404254 3300026118 Unclassified 1346
213 Ga0207683_10004458 3300026121 Bacteria 12089
214 Ga0207698_10048544 3300026142 Unclassified 3224
215 Ga0207698_10235945 3300026142 Bacteria 1663
216 Ga0207698_10278836 3300026142 Bacteria 1545
217 Ga0207698_10866502 3300026142 Bacteria 909
218 Ga0209968_1026397 3300027526 Bacteria 960
219 Ga0209974_10012034 3300027876 Bacteria 2897
220 Ga0268266_10036196 3300028379 Bacteria 4200
221 Ga0268265_10173710 3300028380 Bacteria 1844
222 Ga0268264_10009376 3300028381 Bacteria 8102
223 Ga0268264_10053558 3300028381 Unclassified 3367
224 Ga0268264_10099216 3300028381 Unclassified 2527
225 Ga0265327_10002807 3300031251 Bacteria 17578
226 Ga0265327_10005420 3300031251 Bacteria 10642
227 Ga0265327_10198169 3300031251 Unclassified 911
228 Ga0307509_10408769 3300031507 Bacteria 1062
229 Ga0316576_10246785 3300031727 Bacteria 1341
230 Ga0307412_10000196 3300031911 Bacteria 41764
231 Ga0307416_100000052 3300032002 Bacteria 114516
232 Ga0307416_100993947 3300032002 Bacteria 942
233 Ga0307414_10001835 3300032004 Bacteria 10977
234 Ga0307414_10004972 3300032004 Bacteria 7268
235 Ga0307414_10005026 3300032004 Bacteria 7242
236 Ga0307414_10006995 3300032004 Bacteria 6323
237 Ga0307414_10014453 3300032004 Bacteria 4734
238 Ga0307414_10032140 3300032004 Bacteria 3452
239 Ga0307414_10039291 3300032004 Bacteria 3186
240 Ga0307414_10206327 3300032004 Bacteria 1603
241 Ga0316574_0000925 3300035398 Bacteria 13055
242 Ga0316574_0101487 3300035398 Bacteria 1842
243 Ga0316574_0417633 3300035398 Bacteria 843
244 Ga0373937_0021022 3300036401 Bacteria 5855
245 Ga0373937_0179892 3300036401 Bacteria 1986
246 Ga0316584_0012415 3300036712 Bacteria 6008
247 Ga0316584_0129594 3300036712 Unclassified 1884
248 Ga0395899_0025720 3300037312 Bacteria 4443
249 Ga0395900_0035399 3300037418 Bacteria 5142
250 Ga0395900_0047461 3300037418 Bacteria 4422
251 Ga0395900_0106064 3300037418 Bacteria 2886
252 Ga0395898_0197334 3300037466 Bacteria 1922
253 Ga0395898_0473122 3300037466 Bacteria 1192
254 Ga0395905_0002066 3300037471 Bacteria 22878
255 Ga0395901_0000271 3300038443 Bacteria 64591
256 Ga0395901_0093476 3300038443 Bacteria 3149
257 Ga0395901_0675482 3300038443 Bacteria 1033
258 Ga0400483_090890 3300039062 Bacteria 1671
259 Ga0451577_0026779 3300042876 Bacteria 5221
260 Ga0453684_0002659 3300044712 Bacteria 42636
261 Ga0453684_0008197 3300044712 Bacteria 18841
262 Ga0453684_0297739 3300044712 Bacteria 1835
263 Ga0451576_0002133 3300045051 Bacteria 30697
264 Ga0495627_000002 3300046453 Bacteria 903861
265 Ga0495627_000097 3300046453 Bacteria 107790
266 Ga0495664_0383194 3300046477 Bacteria 845
267 Ga0495596_0001760 3300046500 Bacteria 12121
268 Ga0495610_0000062 3300046512 Bacteria 128923
269 Ga0495630_0186232 3300046517 Bacteria 1584
270 Ga0495663_0000025 3300046525 Bacteria 96580
271 Ga0495654_0000001 3300046530 Bacteria 1513197
272 Ga0495645_0399570 3300046543 Bacteria 876
273 Ga0495633_0000018 3300046558 Bacteria 243398
274 Ga0495668_0000957 3300046616 Bacteria 32067
275 Ga0495668_0005306 3300046616 Bacteria 8812
276 Ga0495661_0023330 3300046665 Bacteria 4017
277 Ga0495658_0097180 3300046683 Bacteria 1753
278 Ga0495600_0701498 3300046809 Bacteria 609
279 Ga0495604_0429010 3300047317 Bacteria 866
280 Ga0495674_0114885 3300047319 Bacteria 2279
281 Ga0495683_0100491 3300047323 Bacteria 1391
282 Ga0495686_0014235 3300047472 Bacteria 5483
283 Ga0496100_0605587 3300048903 Bacteria 851
284 Ga0496116_0000027 3300048919 Bacteria 448077
285 Ga0496117_0000021 3300048920 Bacteria 444168
286 Ga0496117_0286653 3300048920 Bacteria 879
287 Ga0496118_0001689 3300048921 Bacteria 32263
288 Ga0496119_0000004 3300048922 Bacteria 536344
289 Ga0496122_0000154 3300048925 Bacteria 160610
290 Ga0496122_0000352 3300048925 Bacteria 99090
291 Ga0496122_0000613 3300048925 Bacteria 73259
292 Ga0496122_0001584 3300048925 Bacteria 35758
293 Ga0496122_0001798 3300048925 Bacteria 32856
294 Ga0496122_0007600 3300048925 Bacteria 11978
295 Ga0496123_0001904 3300048926 Bacteria 27216
296 Ga0496123_0005589 3300048926 Bacteria 12567
297 Ga0496123_0005615 3300048926 Bacteria 12536
298 Ga0496123_0005818 3300048926 Bacteria 12234
299 Ga0496124_0001196 3300048927 Bacteria 40429
300 Ga0496124_0089678 3300048927 Unclassified 2510
301 Ga0496125_0003715 3300048928 Bacteria 18214
302 Ga0496125_0003732 3300048928 Bacteria 18150
303 Ga0496125_0198554 3300048928 Bacteria 1316
304 Ga0496126_0002136 3300048929 Bacteria 27566
305 Ga0501299_016394 3300049522 Bacteria 1311
306 Ga0501032_0009836 3300049569 Bacteria 6917
307 Ga0501034_0007007 3300049571 Bacteria 12035
308 Ga0501036_0006104 3300049572 Bacteria 9778
309 Ga0501038_0057287 3300049574 Unclassified 3346
310 Ga0501043_0021043 3300049579 Bacteria 5113
311 Ga0501046_0009509 3300049580 Bacteria 8401
312 Ga0501047_0012135 3300049581 Bacteria 8154
313 Ga0501048_0353866 3300049582 Bacteria 1047
314 Ga0501067_0085650 3300049583 Bacteria 1749
315 Ga0501070_0090789 3300049586 Bacteria 2528
316 Ga0501073_0019627 3300049589 Bacteria 4877
317 Ga0501074_0007106 3300049590 Bacteria 8093
318 Ga0501079_0108654 3300049741 Bacteria 2154
319 Ga0501080_0047777 3300049742 Bacteria 3984
320 Ga0501083_0059172 3300049744 Bacteria 2563
321 Ga0501035_0118937 3300049822 Bacteria 2311
322 Ga0501044_0007380 3300049823 Bacteria 12089
323 Ga0501045_0194838 3300049824 Bacteria 1510
324 nmdc:mga0k408_40286_c1 3300050493 Bacteria 2687
325 Ga0501082_0375788 3300060353 Bacteria 1240
326 2520879754 2519899754 Bacteria 5336938
327 2585144012 2582581278 Bacteria 5296881
328 2587677431 2585428045 Bacteria 5203023
329 2587745562 2585428060 Bacteria 5304711
330 2587866560 2585428095 Bacteria 3789702
331 2587943720 2585428115 Bacteria 4420269
332 2588208955 2585428182 Bacteria 5007281
333 2588212344 2585428183 Bacteria 5166119
334 2588220415 2585428184 Bacteria 4978681
335 2588225124 2585428185 Bacteria 4969476
336 2588445651 2588253712 Bacteria 5403181
337 2590602388 2588254255 Bacteria 5014294
338 2590611260 2588254257 Bacteria 5436094
339 2599481008 2599185184 Bacteria 6430550
340 2738700131 2738541273 Bacteria 4048577
341 2738700152 2738541273 Bacteria 4048577
342 2739253880 2738543014 Bacteria 4048139
343 2739253901 2738543014 Bacteria 4048139
344 2753671904 2751185877 Bacteria 4921427
345 2765576836 2765235839 Bacteria 5314748
346 2772605707 2772190705 Bacteria 4666226
347 2816872127 2816332188 Bacteria 5133218
348 2819575954 2818991442 Bacteria 8318214
349 2821140329 2821136567 Bacteria 8080116
350 2842723797 2842722452 Bacteria 6263924
351 2842910302 2842909656 Bacteria 6185908
352 2871724405 2871720351 Bacteria 4862476
353 2881957838 2881955468 Bacteria 3545609
354 2889292610 2889290771 Bacteria 5530962
355 2890739469 2890737413 Bacteria 4269751
356 2890805447 2890804823 Bacteria 3717572
357 2896088469 2896085136 Bacteria 6129793
358 2902049418 2902048731 Bacteria 4976191
359 2902051894 2902048731 Bacteria 4976191
360 2904473910 2904467357 Bacteria 8057758
361 2906000154 2905999023 Bacteria 4591259
362 2919189797 2919186247 Bacteria 6244071
363 2919400842 2919399522 Bacteria 5164947
364 2928080918 2928078545 Bacteria 6534839
365 2928150174 2928147474 Bacteria 6512076
366 2929155825 2929154850 Bacteria 6753285
367 2939668075 2939664404 Bacteria 6364494
368 2945926395 2945924605 Bacteria 4296724
369 2946020545 2946019816 Bacteria 4621265
370 2993373056 2993372514 Bacteria 4214139
371 2993483739 2993480792 Bacteria 4022225
372 8036739290 8036736890 Bacteria 2944828
373 Ga0495582_0142303
374 SwRhRL2b_contig_1282653
375 JGI24740J21852_10065818
376 JGI24739J22299_10000079
377 JGI24739J22299_10002868
378 JGI24744J21845_10031081
379 JGI25162J39368_1001015
380 JGI25165J46597_1005166
381 rootH2_10220209
382 rootH2_10260630
383 rootL2_10055485
384 rootH1_10017251
385 rootH1_10083334
386 rootH1_10207970
387 Ga0055535_1008895
388 Ga0055542_1005119
389 Ga0055534_1016747
390 Ga0065165_1015714
391 Ga0065704_10071391
392 Ga0070658_10024802
393 Ga0070676_10001603
394 Ga0070670_100013962
395 Ga0070670_100772760
396 Ga0070677_10012758
397 Ga0068869_100062931
398 Ga0068869_100123655
399 Ga0068869_100167951
400 Ga0070666_10035915
401 Ga0070680_100097209
402 Ga0070682_100000327
403 Ga0068868_100072856
404 Ga0068868_100112952
405 Ga0070660_100012641
406 Ga0070660_100302601
407 Ga0070660_100415613
408 Ga0070668_100015470
409 Ga0070669_100046039
410 Ga0070669_100469165
411 Ga0070675_100096459
412 Ga0070674_100015219
413 Ga0070673_100003555
414 Ga0070688_100172646
415 Ga0070659_100014581
416 Ga0070667_100143086
417 Ga0070663_100085265
418 Ga0070678_100078833
419 Ga0068867_100193470
420 Ga0068867_100696721
421 Ga0070685_10033767
422 Ga0070685_10366134
423 Ga0070679_100077754
424 Ga0070679_100087603
425 Ga0068853_100014635
426 Ga0068853_100317172
427 Ga0070672_100108462
428 Ga0070665_100010114
429 Ga0068855_100000043
430 Ga0068855_100029344
431 Ga0068855_100031041
432 Ga0068854_100041787
433 Ga0068856_100002935
434 Ga0068856_100068402
435 Ga0068852_100008206
436 Ga0068852_100103315
437 Ga0068852_100369501
438 Ga0068852_100394216
439 Ga0068852_100432857
440 Ga0068859_100004553
441 Ga0068859_100036491
442 Ga0068859_100061320
443 Ga0068864_100111334
444 Ga0068864_100260703
445 Ga0068866_10018173
446 Ga0068861_100339024
447 Ga0068870_10003550
448 Ga0068858_100406761
449 Ga0068858_101200407
450 Ga0068860_100005913
451 Ga0068860_100038533
452 Ga0068860_100084699
453 Ga0068860_100119124
454 Ga0068862_100070406
455 Ga0068862_100511000
456 Ga0075366_10006578
457 Ga0068871_100183150
458 Ga0068865_100002314
459 Ga0097620_100004553
460 Ga0097620_100036491
461 Ga0097620_100061320
462 Ga0097620_100366638
463 Ga0105244_10000011
464 Ga0105240_10000185
465 Ga0105245_10634977
466 Ga0105243_10000375
467 Ga0105241_10024908
468 Ga0105241_10038525
469 Ga0105241_10116544
470 Ga0105241_10557708
471 Ga0105242_10038381
472 Ga0105242_10142035
473 Ga0105237_10000154
474 Ga0105237_10028046
475 Ga0105237_10028766
476 Ga0105237_10430477
477 Ga0105249_10207305
478 Ga0105249_10305354
479 Ga0105239_10004024
480 Ga0105239_10027864
481 Ga0105239_11505462
482 Ga0105246_10025754
483 Ga0157373_10000024
484 Ga0157373_10038159
485 Ga0157373_10098630
486 Ga0157373_10272195
487 Ga0157371_10001686
488 Ga0157371_10006698
489 Ga0157371_10013848
490 Ga0157371_10020435
491 Ga0157371_10079146
492 Ga0157370_10000463
493 Ga0157370_10005447
494 Ga0157370_10010602
495 Ga0157370_10074770
496 Ga0157370_10189245
497 Ga0157370_10221117
498 Ga0157370_10321709
499 Ga0157369_10084522
500 Ga0157369_10084893
501 Ga0157369_10433530
502 Ga0157374_10275971
503 Ga0157374_10359811
504 Ga0157372_10013469
505 Ga0157372_10019675
506 Ga0157372_10052900
507 Ga0157372_10077958
508 Ga0157372_10218135
509 Ga0157372_10643206
510 Ga0157375_10014678
511 Ga0157375_10034449
512 Ga0157375_10669091
513 Ga0157375_11522106
514 Ga0163163_10001214
515 Ga0182008_10000029
516 Ga0182008_10000791
517 Ga0157377_10129071
518 Ga0157376_10003976
519 Ga0182006_1000110
520 Ga0182006_1000489
521 Ga0182005_1000229
522 Ga0163161_10021066
523 Ga0209436_102026
524 Ga0207427_100043
525 Ga0209437_100008
526 Ga0209258_100193
527 Ga0209026_1005574
528 Ga0209148_1000167
529 Ga0209233_1000366
530 Ga0209675_1000042
531 Ga0207426_1006540
532 Ga0207655_1000546
533 Ga0207682_10014406
534 Ga0207642_10032774
535 Ga0207680_10006118
536 Ga0207647_10000988
537 Ga0207647_10090645
538 Ga0207645_10000088
539 Ga0207643_10007645
540 Ga0207705_10031685
541 Ga0207705_10154619
542 Ga0207654_10013498
543 Ga0207654_10027856
544 Ga0207695_10000117
545 Ga0207695_10292594
546 Ga0207671_10000185
547 Ga0207671_10026103
548 Ga0207671_10149851
549 Ga0207660_10283607
550 Ga0207657_10022458
551 Ga0207657_10253470
552 Ga0207657_10379891
553 Ga0207652_10086278
554 Ga0207681_10032871
555 Ga0207681_10266254
556 Ga0207694_10950692
557 Ga0207659_10173908
558 Ga0207690_10013944
559 Ga0207709_10000601
560 Ga0207669_10009520
561 Ga0207704_10003660
562 Ga0207691_10011128
563 Ga0207689_10004872
564 Ga0207689_10053989
565 Ga0207661_10127827
566 Ga0207667_10000015
567 Ga0207667_10024242
568 Ga0207667_10055189
569 Ga0207667_10115734
570 Ga0207651_10034166
571 Ga0207712_10424454
572 Ga0207668_10062596
573 Ga0207640_10637344
574 Ga0207677_10131488
575 Ga0207639_10242237
576 Ga0207639_10791575
577 Ga0207678_10335749
578 Ga0207702_10035253
579 Ga0207702_10081419
580 Ga0207648_10006425
581 Ga0207676_10035249
582 Ga0207676_10095222
583 Ga0207675_100404254
584 Ga0207683_10004458
585 Ga0207698_10048544
586 Ga0207698_10235945
587 Ga0207698_10278836
588 Ga0207698_10866502
589 Ga0209968_1026397
590 Ga0209974_10012034
591 Ga0268266_10036196
592 Ga0268265_10173710
593 Ga0268264_10009376
594 Ga0268264_10053558
595 Ga0268264_10099216
596 Ga0265327_10002807
597 Ga0265327_10005420
598 Ga0265327_10198169
599 Ga0307509_10408769
600 Ga0316576_10246785
601 Ga0307412_10000196
602 Ga0307416_100000052
603 Ga0307416_100993947
604 Ga0307414_10001835
605 Ga0307414_10004972
606 Ga0307414_10005026
607 Ga0307414_10006995
608 Ga0307414_10014453
609 Ga0307414_10032140
610 Ga0307414_10039291
611 Ga0307414_10206327
612 Ga0316574_0000925
613 Ga0316574_0101487
614 Ga0316574_0417633
615 Ga0373937_0021022
616 Ga0373937_0179892
617 Ga0316584_0012415
618 Ga0316584_0129594
619 Ga0395899_0025720
620 Ga0395900_0035399
621 Ga0395900_0047461
622 Ga0395900_0106064
623 Ga0395898_0197334
624 Ga0395898_0473122
625 Ga0395905_0002066
626 Ga0395901_0000271
627 Ga0395901_0093476
628 Ga0395901_0675482
629 Ga0400483_090890
630 Ga0451577_0026779
631 Ga0453684_0002659
632 Ga0453684_0008197
633 Ga0453684_0297739
634 Ga0451576_0002133
635 Ga0495627_000002
636 Ga0495627_000097
637 Ga0495664_0383194
638 Ga0495596_0001760
639 Ga0495610_0000062
640 Ga0495630_0186232
641 Ga0495663_0000025
642 Ga0495654_0000001
643 Ga0495645_0399570
644 Ga0495633_0000018
645 Ga0495668_0000957
646 Ga0495668_0005306
647 Ga0495661_0023330
648 Ga0495658_0097180
649 Ga0495600_0701498
650 Ga0495604_0429010
651 Ga0495674_0114885
652 Ga0495683_0100491
653 Ga0495686_0014235
654 Ga0496100_0605587
655 Ga0496116_0000027
656 Ga0496117_0000021
657 Ga0496117_0286653
658 Ga0496118_0001689
659 Ga0496119_0000004
660 Ga0496122_0000154
661 Ga0496122_0000352
662 Ga0496122_0000613
663 Ga0496122_0001584
664 Ga0496122_0001798
665 Ga0496122_0007600
666 Ga0496123_0001904
667 Ga0496123_0005589
668 Ga0496123_0005615
669 Ga0496123_0005818
670 Ga0496124_0001196
671 Ga0496124_0089678
672 Ga0496125_0003715
673 Ga0496125_0003732
674 Ga0496125_0198554
675 Ga0496126_0002136
676 Ga0501299_016394
677 Ga0501032_0009836
678 Ga0501034_0007007
679 Ga0501036_0006104
680 Ga0501038_0057287
681 Ga0501043_0021043
682 Ga0501046_0009509
683 Ga0501047_0012135
684 Ga0501048_0353866
685 Ga0501067_0085650
686 Ga0501070_0090789
687 Ga0501073_0019627
688 Ga0501074_0007106
689 Ga0501079_0108654
690 Ga0501080_0047777
691 Ga0501083_0059172
692 Ga0501035_0118937
693 Ga0501044_0007380
694 Ga0501045_0194838
695 nmdc:mga0k408_40286_c1
696 Ga0501082_0375788
697 2520879754
698 2585144012
699 2587677431
700 2587745562
701 2587866560
702 2587943720
703 2588208955
704 2588212344
705 2588220415
706 2588225124
707 2588445651
708 2590602388
709 2590611260
710 2599481008
711 2738700131
712 2738700152
713 2739253880
714 2739253901
715 2753671904
716 2765576836
717 2772605707
718 2816872127
719 2819575954
720 2821140329
721 2842723797
722 2842910302
723 2871724405
724 2881957838
725 2889292610
726 2890739469
727 2890805447
728 2896088469
729 2902049418
730 2902051894
731 2904473910
732 2906000154
733 2919189797
734 2919400842
735 2928080918
736 2928150174
737 2929155825
738 2939668075
739 2945926395
740 2946020545
741 2993373056
742 2993483739
743 8036739290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00325

Crp

Bacterial regulatory proteins, crp family

179

210

0.95

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

39

129

0.92

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

159

223

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7phd-assembly1.cif.gz_B chimeric carminomycin-4-o-methyltransferase (dnrk) with a region from 10-decarboxylase tamk 0.8919 145 185
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.8855 145 183
5n07-assembly1.cif.gz_A-2 structure of the [4fe-4s] form of the no response regulator nsrr 0.8832 145 185
7oy1-assembly1.cif.gz_B dnrk mutant rtcr 0.8772 145 185
5eeg-assembly1.cif.gz_B crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with tetrazole-sah 0.875 145 185
ID Description Score Start End Superfamily
2zcwA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9722 142 185 1.10.10.10
2zdbA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9423 142 185 1.10.10.10
3dv8A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9389 124 186 1.10.10.10
3nrvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9256 146 185 1.10.10.10
4n9iD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9142 142 187 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W6S1Z6-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9416 1 101
AF-A0A2W6S1Z6-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9241 1 101
AF-A0A3D4JSM5-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9234 1 130
AF-A0A3D3K1X6-F1-model_v4 Crp/Fnr family transcriptional regulator 0.8985 7 137
AF-A0A0D1ER57-F1-model_v4 Cyclic nucleotide-binding domain protein 0.894 16 125

Map