F426411

General Info

Members Datasets Scaffolds Average Seq Length
373 221 372 355

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0008709|Ga0316574_0008709_3672_4904
Length 410
Sequence LPADCVLSNRTKQNEDPILQTVYNLASISPGFSKARRPLTDLNEETTMADLSREQIETKLKEYIDPYMEKDLVSTKCLRNVMIEGDQVVVDVVLGFPAKGYMSELAAKLREMVESIEGVAKARVNVNMAIEAHSVQKGVKTISSIKNIIAVASGKGGVGKSTTATNLALALSAEGASVGVLDADIYGPSQPRMLGIHGKPESKDGQTLEPMMSYHIQTMSIGFLVDEETPMIWRGPMVTQALQQLLGDTNWNNLDYLVIDLPPGTGDVQLTLAQQVPVSGAVIVTTPQDIALLDARKGLKMFEKVEVPVLGIVENMSIHICSQCGHEEHIFGEGGGQRMAEQYDVDFLGALPLDKKIREEVDSGRPSVVADPDGRIAQIYREIARRTAAKLALKSKNYAAKFPQIVIQSN

Samples

Sample ID Description Type Environment
1 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
147 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
148 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
149 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
169 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
170 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
173 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
179 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.1
Metatranscriptomes 5.63
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 3.22
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 3.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055529_1001087 3300003763 Bacteria 12380
2 Ga0065707_10189806 3300005295 Bacteria 1368
3 Ga0070683_100089831 3300005329 Bacteria 2884
4 Ga0070690_100000866 3300005330 Bacteria 15397
5 Ga0068869_100015853 3300005334 Bacteria 5068
6 Ga0068868_100003645 3300005338 Bacteria 10750
7 Ga0068868_100161877 3300005338 Bacteria 1848
8 Ga0070660_100001108 3300005339 Bacteria 18149
9 Ga0070689_100001303 3300005340 Bacteria 15881
10 Ga0070661_100028670 3300005344 Bacteria 4017
11 Ga0070668_100008521 3300005347 Bacteria 7616
12 Ga0070668_100205421 3300005347 Bacteria 1618
13 Ga0070668_100261385 3300005347 Bacteria 1440
14 Ga0070675_100003529 3300005354 Bacteria 11864
15 Ga0070671_100013734 3300005355 Bacteria 6533
16 Ga0070671_100033931 3300005355 Bacteria 4223
17 Ga0070674_100000741 3300005356 Bacteria 16710
18 Ga0070673_100001325 3300005364 Bacteria 14429
19 Ga0070673_100002075 3300005364 Bacteria 12076
20 Ga0070673_100132030 3300005364 Bacteria 2097
21 Ga0070673_100296033 3300005364 Bacteria 1423
22 Ga0070688_100151289 3300005365 Bacteria 1586
23 Ga0070659_100056522 3300005366 Bacteria 3094
24 Ga0070667_100002987 3300005367 Bacteria 14532
25 Ga0070667_100239889 3300005367 Bacteria 1618
26 Ga0070714_100004338 3300005435 Bacteria 10694
27 Ga0070713_100000238 3300005436 Bacteria 36357
28 Ga0070710_10005829 3300005437 Bacteria 5878
29 Ga0070701_10021712 3300005438 Bacteria 3068
30 Ga0070711_100272989 3300005439 Bacteria 1335
31 Ga0070708_100025979 3300005445 Bacteria 5008
32 Ga0070678_100002018 3300005456 Bacteria 10977
33 Ga0070662_100064960 3300005457 Bacteria 2673
34 Ga0070681_10098907 3300005458 Bacteria 2863
35 Ga0068867_100146552 3300005459 Bacteria 1851
36 Ga0070685_10021008 3300005466 Bacteria 3542
37 Ga0070706_100125152 3300005467 Bacteria 2397
38 Ga0070707_100116983 3300005468 Bacteria 2587
39 Ga0070699_100305881 3300005518 Bacteria 1427
40 Ga0070684_100006429 3300005535 Bacteria 9092
41 Ga0068853_100308766 3300005539 Bacteria 1464
42 Ga0070672_100000965 3300005543 Bacteria 17373
43 Ga0070672_100057088 3300005543 Bacteria 3064
44 Ga0070686_100183215 3300005544 Bacteria 1489
45 Ga0070665_100004459 3300005548 Bacteria 14709
46 Ga0070665_100005516 3300005548 Bacteria 13020
47 Ga0070665_100005552 3300005548 Bacteria 12968
48 Ga0068855_100039589 3300005563 Bacteria 5596
49 Ga0068855_100147069 3300005563 Bacteria 2681
50 Ga0070664_100000772 3300005564 Bacteria 24693
51 Ga0070664_100189392 3300005564 Bacteria 1832
52 Ga0068857_100019569 3300005577 Bacteria 5946
53 Ga0068857_100033553 3300005577 Bacteria 4540
54 Ga0068856_100006730 3300005614 Bacteria 11261
55 Ga0068856_100032597 3300005614 Bacteria 5101
56 Ga0068856_100185981 3300005614 Bacteria 2091
57 Ga0068856_100393786 3300005614 Bacteria 1405
58 Ga0070702_100236502 3300005615 Bacteria 1230
59 Ga0068852_100000944 3300005616 Bacteria 19185
60 Ga0068852_100247083 3300005616 Bacteria 1708
61 Ga0068859_100027889 3300005617 Bacteria 5662
62 Ga0068859_100186893 3300005617 Bacteria 2156
63 Ga0068864_100004710 3300005618 Bacteria 11187
64 Ga0068864_100021290 3300005618 Bacteria 5432
65 Ga0068864_100107855 3300005618 Bacteria 2477
66 Ga0068861_100005356 3300005719 Bacteria 8673
67 Ga0068851_10006697 3300005834 Bacteria 5270
68 Ga0068870_10015763 3300005840 Bacteria 3593
69 Ga0068870_10154977 3300005840 Bacteria 1353
70 Ga0068863_100008287 3300005841 Bacteria 10156
71 Ga0068863_100020368 3300005841 Bacteria 6341
72 Ga0068863_100029818 3300005841 Bacteria 5210
73 Ga0068863_100045844 3300005841 Bacteria 4149
74 Ga0068858_100001841 3300005842 Bacteria 21624
75 Ga0068858_100011779 3300005842 Bacteria 8249
76 Ga0068858_100260079 3300005842 Bacteria 1650
77 Ga0068858_100285376 3300005842 Bacteria 1572
78 Ga0068858_100301949 3300005842 Bacteria 1527
79 Ga0068860_100036746 3300005843 Bacteria 4690
80 Ga0068860_100090935 3300005843 Bacteria 2907
81 Ga0068860_100404101 3300005843 Bacteria 1352
82 Ga0068862_100033281 3300005844 Bacteria 4356
83 Ga0081539_10105740 3300005985 Bacteria 1426
84 Ga0070712_100001041 3300006175 Bacteria 16748
85 Ga0070712_100281031 3300006175 Bacteria 1341
86 Ga0097621_100044301 3300006237 Bacteria 3590
87 Ga0068871_100127236 3300006358 Bacteria 2157
88 Ga0075428_100002640 3300006844 Bacteria 19508
89 Ga0075434_100386772 3300006871 Bacteria 1420
90 Ga0068865_100232675 3300006881 Bacteria 1447
91 Ga0097620_100027888 3300006931 Bacteria 5662
92 Ga0097620_100186901 3300006931 Bacteria 2156
93 Ga0105240_10018889 3300009093 Bacteria 9230
94 Ga0105240_10030358 3300009093 Bacteria 7025
95 Ga0105240_10243373 3300009093 Bacteria 2084
96 Ga0111539_10103020 3300009094 Bacteria 3349
97 Ga0105245_10006319 3300009098 Bacteria 10425
98 Ga0105245_10082519 3300009098 Bacteria 2940
99 Ga0105247_10017988 3300009101 Bacteria 4239
100 Ga0105248_10046332 3300009177 Bacteria 4873
101 Ga0105248_10062604 3300009177 Bacteria 4177
102 Ga0105237_10026431 3300009545 Bacteria 5933
103 Ga0105238_10019656 3300009551 Bacteria 6878
104 Ga0157373_10025755 3300013100 Bacteria 4252
105 Ga0157370_10001959 3300013104 Bacteria 25360
106 Ga0157370_10004642 3300013104 Bacteria 15700
107 Ga0157370_10006908 3300013104 Bacteria 12412
108 Ga0157370_10008379 3300013104 Bacteria 11151
109 Ga0157370_10028329 3300013104 Bacteria 5512
110 Ga0157369_10024431 3300013105 Bacteria 6722
111 Ga0157374_10000145 3300013296 Bacteria 64560
112 Ga0157374_10000529 3300013296 Bacteria 34188
113 Ga0157374_10156477 3300013296 Bacteria 2218
114 Ga0163162_10079823 3300013306 Bacteria 3338
115 Ga0157372_10037280 3300013307 Bacteria 5361
116 Ga0157372_10053840 3300013307 Bacteria 4487
117 Ga0157375_10028339 3300013308 Bacteria 5249
118 Ga0157375_10031644 3300013308 Bacteria 5006
119 Ga0157375_10075947 3300013308 Bacteria 3385
120 Ga0157375_10255156 3300013308 Bacteria 1915
121 Ga0163163_10000741 3300014325 Bacteria 27762
122 Ga0157377_10015229 3300014745 Bacteria 3928
123 Ga0157379_10003263 3300014968 Bacteria 13737
124 Ga0157379_10011326 3300014968 Bacteria 7774
125 Ga0183369_1009 3300015685 Bacteria 346348
126 Ga0163161_10035906 3300017792 Bacteria 3548
127 Ga0209672_106718 3300025228 Bacteria 1842
128 Ga0209258_103040 3300025242 Bacteria 3854
129 Ga0207697_10029754 3300025315 Bacteria 2236
130 Ga0207656_10021433 3300025321 Bacteria 2582
131 Ga0207682_10000348 3300025893 Bacteria 21135
132 Ga0207692_10070907 3300025898 Bacteria 1836
133 Ga0207710_10011178 3300025900 Bacteria 3779
134 Ga0207688_10023723 3300025901 Bacteria 3362
135 Ga0207680_10036018 3300025903 Bacteria 2847
136 Ga0207645_10000557 3300025907 Bacteria 31005
137 Ga0207645_10006274 3300025907 Bacteria 8543
138 Ga0207643_10020450 3300025908 Bacteria 3632
139 Ga0207684_10030323 3300025910 Bacteria 4604
140 Ga0207707_10053300 3300025912 Bacteria 3521
141 Ga0207671_10032170 3300025914 Bacteria 3905
142 Ga0207693_10000438 3300025915 Bacteria 38076
143 Ga0207693_10060065 3300025915 Bacteria 2978
144 Ga0207663_10001485 3300025916 Bacteria 10931
145 Ga0207660_10122897 3300025917 Bacteria 1968
146 Ga0207662_10002504 3300025918 Bacteria 9235
147 Ga0207657_10002377 3300025919 Bacteria 20356
148 Ga0207657_10225696 3300025919 Bacteria 1499
149 Ga0207649_10003982 3300025920 Bacteria 8049
150 Ga0207694_10008419 3300025924 Bacteria 7784
151 Ga0207650_10061432 3300025925 Bacteria 2805
152 Ga0207650_10140041 3300025925 Bacteria 1901
153 Ga0207700_10001746 3300025928 Bacteria 12338
154 Ga0207664_10002954 3300025929 Bacteria 11291
155 Ga0207664_10022763 3300025929 Bacteria 4685
156 Ga0207644_10002304 3300025931 Bacteria 12382
157 Ga0207644_10003122 3300025931 Bacteria 10664
158 Ga0207706_10288758 3300025933 Bacteria 1430
159 Ga0207669_10002125 3300025937 Bacteria 8397
160 Ga0207691_10000030 3300025940 Bacteria 119013
161 Ga0207691_10029671 3300025940 Bacteria 5115
162 Ga0207711_10001063 3300025941 Bacteria 26291
163 Ga0207711_10033355 3300025941 Bacteria 4356
164 Ga0207711_10049008 3300025941 Bacteria 3615
165 Ga0207711_10168089 3300025941 Bacteria 1989
166 Ga0207689_10000330 3300025942 Bacteria 43969
167 Ga0207689_10134814 3300025942 Bacteria 2033
168 Ga0207679_10009935 3300025945 Bacteria 6111
169 Ga0207651_10004459 3300025960 Bacteria 7062
170 Ga0207651_10095486 3300025960 Bacteria 2189
171 Ga0207668_10067616 3300025972 Bacteria 2537
172 Ga0207668_10097114 3300025972 Bacteria 2179
173 Ga0207640_10118517 3300025981 Bacteria 1891
174 Ga0207658_10017096 3300025986 Bacteria 4995
175 Ga0207658_10053543 3300025986 Bacteria 2982
176 Ga0207658_10169005 3300025986 Bacteria 1799
177 Ga0207677_10001885 3300026023 Bacteria 11080
178 Ga0207677_10227481 3300026023 Bacteria 1500
179 Ga0207703_10005222 3300026035 Bacteria 10490
180 Ga0207703_10032378 3300026035 Bacteria 4138
181 Ga0207702_10011045 3300026078 Bacteria 7537
182 Ga0207702_10046732 3300026078 Bacteria 3645
183 Ga0207702_10253563 3300026078 Bacteria 1653
184 Ga0207641_10036643 3300026088 Bacteria 4094
185 Ga0207641_10078758 3300026088 Bacteria 2855
186 Ga0207641_10197781 3300026088 Bacteria 1851
187 Ga0207648_10002962 3300026089 Bacteria 17949
188 Ga0207648_10095455 3300026089 Bacteria 2601
189 Ga0207676_10001533 3300026095 Bacteria 17052
190 Ga0207676_10056745 3300026095 Bacteria 3080
191 Ga0207676_10103960 3300026095 Bacteria 2361
192 Ga0207674_10000292 3300026116 Bacteria 63309
193 Ga0207674_10018094 3300026116 Bacteria 7670
194 Ga0207674_10382551 3300026116 Bacteria 1361
195 Ga0207675_100004879 3300026118 Bacteria 12931
196 Ga0207675_100172221 3300026118 Bacteria 2069
197 Ga0207683_10000019 3300026121 Bacteria 119524
198 Ga0207683_10050920 3300026121 Bacteria 3628
199 Ga0207683_10268972 3300026121 Bacteria 1557
200 Ga0207698_10150994 3300026142 Bacteria 2016
201 Ga0268266_10006943 3300028379 Bacteria 10294
202 Ga0268266_10095913 3300028379 Bacteria 2605
203 Ga0268265_10070187 3300028380 Bacteria 2723
204 Ga0268265_10352090 3300028380 Bacteria 1345
205 Ga0268264_10008725 3300028381 Bacteria 8414
206 Ga0268264_10012218 3300028381 Bacteria 7065
207 Ga0268264_10238759 3300028381 Bacteria 1682
208 Ga0265334_10026663 3300028573 Bacteria 2332
209 Ga0265318_10005228 3300028577 Bacteria 6119
210 Ga0265338_10014948 3300028800 Bacteria 8580
211 Ga0265330_10033122 3300031235 Bacteria 2313
212 Ga0265332_10003432 3300031238 Bacteria 7655
213 Ga0265328_10003873 3300031239 Bacteria 6581
214 Ga0265331_10002356 3300031250 Bacteria 12840
215 Ga0265327_10000247 3300031251 Bacteria 107636
216 Ga0265327_10004296 3300031251 Bacteria 12726
217 Ga0265316_10001281 3300031344 Bacteria 27017
218 Ga0265316_10017559 3300031344 Bacteria 6177
219 Ga0265313_10000125 3300031595 Bacteria 77022
220 Ga0316575_10017806 3300031665 Bacteria 2702
221 Ga0316575_10033991 3300031665 Bacteria 2002
222 Ga0316575_10052607 3300031665 Bacteria 1622
223 Ga0316575_10059549 3300031665 Bacteria 1524
224 Ga0316579_10015159 3300031691 Bacteria 3342
225 Ga0265314_10004077 3300031711 Bacteria 13784
226 Ga0265342_10012115 3300031712 Bacteria 5853
227 Ga0316576_10001899 3300031727 Bacteria 11628
228 Ga0316576_10056805 3300031727 Bacteria 2860
229 Ga0316576_10181215 3300031727 Bacteria 1589
230 Ga0316576_10271407 3300031727 Bacteria 1271
231 Ga0316578_10002765 3300031728 Bacteria 7815
232 Ga0316578_10006485 3300031728 Bacteria 5782
233 Ga0316578_10006514 3300031728 Bacteria 5773
234 Ga0316578_10031624 3300031728 Bacteria 3017
235 Ga0316578_10046419 3300031728 Bacteria 2532
236 Ga0316578_10097367 3300031728 Bacteria 1762
237 Ga0316578_10110873 3300031728 Bacteria 1648
238 Ga0316578_10142737 3300031728 Bacteria 1442
239 Ga0316577_10001634 3300031733 Bacteria 10715
240 Ga0316577_10080054 3300031733 Bacteria 1826
241 Ga0307413_10204072 3300031824 Bacteria 1430
242 Ga0307407_10186745 3300031903 Bacteria 1378
243 Ga0316583_10002605 3300032133 Bacteria 6290
244 Ga0316583_10006483 3300032133 Bacteria 4206
245 Ga0316583_10030044 3300032133 Bacteria 1935
246 Ga0316585_10000435 3300032137 Bacteria 9775
247 Ga0316585_10012211 3300032137 Bacteria 2541
248 Ga0316585_10049150 3300032137 Bacteria 1352
249 Ga0316580_10003978 3300032139 Bacteria 4251
250 Ga0316593_10003788 3300032168 Bacteria 3800
251 Ga0316593_10012047 3300032168 Bacteria 2530
252 Ga0316593_10015556 3300032168 Bacteria 2291
253 Ga0316593_10023548 3300032168 Bacteria 1945
254 Ga0316593_10027568 3300032168 Bacteria 1824
255 Ga0316593_10027973 3300032168 Bacteria 1813
256 Ga0316593_10049757 3300032168 Bacteria 1413
257 Ga0316593_10050081 3300032168 Bacteria 1409
258 Ga0316593_10058551 3300032168 Bacteria 1314
259 Ga0316593_10063770 3300032168 Bacteria 1264
260 Ga0316593_10074314 3300032168 Bacteria 1179
261 Ga0316592_1014031 3300033524 Bacteria 1658
262 Ga0316592_1015546 3300033524 Bacteria 1586
263 Ga0316587_1012359 3300033529 Bacteria 1387
264 Ga0316587_1014802 3300033529 Bacteria 1290
265 Ga0316587_1015060 3300033529 Bacteria 1280
266 Ga0316596_1015187 3300033541 Bacteria 1917
267 Ga0316596_1029834 3300033541 Bacteria 1413
268 Ga0316596_1036785 3300033541 Bacteria 1280
269 Ga0316596_1040277 3300033541 Bacteria 1227
270 Ga0316596_1043984 3300033541 Bacteria 1176
271 Ga0373934_0009219 3300035086 Bacteria 3694
272 Ga0373923_0000628 3300035111 Bacteria 8849
273 Ga0373953_0016158 3300035117 Bacteria 2720
274 Ga0373954_0001047 3300035118 Bacteria 10995
275 Ga0373954_0002006 3300035118 Bacteria 8457
276 Ga0373956_0010799 3300035119 Bacteria 3750
277 Ga0373957_0007527 3300035120 Bacteria 3486
278 Ga0373955_0000980 3300035172 Bacteria 12132
279 Ga0316574_0000460 3300035398 Bacteria 16419
280 Ga0316574_0001096 3300035398 Bacteria 12390
281 Ga0316574_0008709 3300035398 Bacteria 5646
282 Ga0316574_0010502 3300035398 Bacteria 5237
283 Ga0316574_0039109 3300035398 Bacteria 2915
284 Ga0316574_0041459 3300035398 Bacteria 2838
285 Ga0316574_0087326 3300035398 Bacteria 1985
286 Ga0316574_0166466 3300035398 Bacteria 1420
287 Ga0316574_0190243 3300035398 Bacteria 1320
288 Ga0316574_0192827 3300035398 Bacteria 1310
289 Ga0316574_0194590 3300035398 Bacteria 1303
290 Ga0373924_0025449 3300035410 Bacteria 2340
291 Ga0373931_0017024 3300035691 Bacteria 3587
292 Ga0373931_0175636 3300035691 Bacteria 1265
293 Ga0373933_0004684 3300035724 Bacteria 7491
294 Ga0373937_0009188 3300036401 Bacteria 8580
295 Ga0373937_0026765 3300036401 Bacteria 5212
296 Ga0316582_0000694 3300036647 Bacteria 13303
297 Ga0316582_0006255 3300036647 Bacteria 6232
298 Ga0316582_0033267 3300036647 Bacteria 3166
299 Ga0316582_0034789 3300036647 Bacteria 3105
300 Ga0316582_0036144 3300036647 Bacteria 3055
301 Ga0316582_0046122 3300036647 Bacteria 2747
302 Ga0316582_0124663 3300036647 Bacteria 1726
303 Ga0316584_0001884 3300036712 Bacteria 13022
304 Ga0316584_0002131 3300036712 Bacteria 12389
305 Ga0316584_0023849 3300036712 Bacteria 4470
306 Ga0316584_0030052 3300036712 Bacteria 4012
307 Ga0316584_0078838 3300036712 Bacteria 2467
308 Ga0316584_0116847 3300036712 Bacteria 1995
309 Ga0316584_0141166 3300036712 Bacteria 1796
310 Ga0395900_0000033 3300037418 Bacteria 260271
311 Ga0316581_0019325 3300037588 Bacteria 1986
312 Ga0316581_0044424 3300037588 Bacteria 1356
313 Ga0400484_25749 3300038725 Bacteria 3127
314 Ga0400486_02321 3300038742 Bacteria 14529
315 Ga0400483_103279 3300039062 Bacteria 1685
316 Ga0400483_140056 3300039062 Bacteria 2700
317 Ga0400483_182485 3300039062 Bacteria 1460
318 Ga0400483_223868 3300039062 Bacteria 4690
319 Ga0400489_50892 3300039093 Bacteria 21669
320 Ga0400487_30323 3300039110 Bacteria 38833
321 Ga0436365_0213237 3300039437 Bacteria 2498
322 Ga0439465_0002769 3300041413 Bacteria 5740
323 Ga0451791_1367609 3300041451 Bacteria 2558
324 Ga0451793_0236231 3300041452 Bacteria 2687
325 Ga0451837_1566477 3300041494 Bacteria 2537
326 Ga0439441_004455 3300042001 Bacteria 2124
327 Ga0439445_0011279 3300042004 Bacteria 2129
328 Ga0439449_0000018 3300042007 Bacteria 46636
329 Ga0466982_0000009 3300044672 Bacteria 221166
330 Ga0453684_0024367 3300044712 Bacteria 8846
331 Ga0453684_0104554 3300044712 Bacteria 3456
332 Ga0451576_0233961 3300045051 Bacteria 1919
333 Ga0466967_0177725 3300045976 Bacteria 2006
334 Ga0495580_0046286 3300046472 Bacteria 3087
335 Ga0495630_0056827 3300046517 Bacteria 2932
336 Ga0495652_0122372 3300046529 Bacteria 2073
337 Ga0495647_0001667 3300046681 Bacteria 6874
338 Ga0495658_0064887 3300046683 Bacteria 2105
339 Ga0495604_0048837 3300047317 Bacteria 3291
340 Ga0495674_0139342 3300047319 Bacteria 2040
341 Ga0496102_0046336 3300048905 Bacteria 3949
342 Ga0496104_0004868 3300048907 Bacteria 11704
343 Ga0496105_0193797 3300048908 Bacteria 1661
344 Ga0496108_0039005 3300048911 Bacteria 3959
345 Ga0496108_0104724 3300048911 Bacteria 2414
346 Ga0496109_0019071 3300048912 Bacteria 6040
347 Ga0496111_0316977 3300048914 Bacteria 1155
348 Ga0496112_0082543 3300048915 Bacteria 3178
349 Ga0496113_0116286 3300048916 Bacteria 2087
350 Ga0496114_0025917 3300048917 Bacteria 4797
351 Ga0496116_0029774 3300048919 Bacteria 3930
352 Ga0501032_0022297 3300049569 Bacteria 4391
353 Ga0501033_0008916 3300049570 Bacteria 7749
354 Ga0501033_0053102 3300049570 Bacteria 3002
355 Ga0501038_0062117 3300049574 Bacteria 3192
356 Ga0501038_0063804 3300049574 Bacteria 3143
357 Ga0501039_0006191 3300049575 Bacteria 9084
358 Ga0501040_0091380 3300049576 Bacteria 2116
359 Ga0501042_0022650 3300049578 Bacteria 4389
360 Ga0501048_0077807 3300049582 Bacteria 2341
361 Ga0501072_0085000 3300049588 Bacteria 2509
362 Ga0501073_0002738 3300049589 Bacteria 13213
363 Ga0501076_0024667 3300049592 Bacteria 4650
364 Ga0501079_0019744 3300049741 Bacteria 5148
365 Ga0501080_0151091 3300049742 Bacteria 2146
366 Ga0501081_0062461 3300049743 Bacteria 2584
367 Ga0501083_0062418 3300049744 Bacteria 2486
368 Ga0501035_0004063 3300049822 Bacteria 13927
369 nmdc:mga08y16_345781_c1 3300050511 Bacteria 1528
370 nmdc:mga0n895_202165_c1 3300050512 Bacteria 2017
371 nmdc:mga0n895_527368_c1 3300050512 Bacteria 1188
372 Ga0501082_0247812 3300060353 Bacteria 1550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_202165_c1 nmdc:mga0n895_202165_c1_54_1142 268
2 3300028577 Ga0265318_10005228 Ga0265318_100052283 269
3 3300031235 Ga0265330_10033122 Ga0265330_100331223 269
4 3300031238 Ga0265332_10003432 Ga0265332_100034322 269
5 3300031239 Ga0265328_10003873 Ga0265328_100038732 269
6 3300031250 Ga0265331_10002356 Ga0265331_100023564 269
7 3300031344 Ga0265316_10017559 Ga0265316_100175592 269
8 3300031711 Ga0265314_10004077 Ga0265314_100040776 269
9 3300031712 Ga0265342_10012115 Ga0265342_100121156 269
10 3300036401 Ga0373937_0026765 Ga0373937_0026765_3596_4684 269
11 3300035398 Ga0316574_0010502 Ga0316574_0010502_1745_2836 270
12 3300049575 Ga0501039_0006191 Ga0501039_0006191_3161_4249 270
13 3300049576 Ga0501040_0091380 Ga0501040_0091380_810_1898 270
14 3300049578 Ga0501042_0022650 Ga0501042_0022650_474_1562 270
15 3300049582 Ga0501048_0077807 Ga0501048_0077807_1173_2261 270
16 3300049588 Ga0501072_0085000 Ga0501072_0085000_1099_2187 270
17 3300049592 Ga0501076_0024667 Ga0501076_0024667_1302_2390 270
18 3300049741 Ga0501079_0019744 Ga0501079_0019744_1216_2304 270
19 3300049742 Ga0501080_0151091 Ga0501080_0151091_577_1665 270
20 3300049743 Ga0501081_0062461 Ga0501081_0062461_276_1364 270
21 3300060353 Ga0501082_0247812 Ga0501082_0247812_43_1131 270
22 3300005617 Ga0068859_100186893 Ga0068859_1001868932 273
23 3300005841 Ga0068863_100045844 Ga0068863_1000458442 273
24 3300006931 Ga0097620_100186901 Ga0097620_1001869012 273
25 3300005330 Ga0070690_100000866 Ga0070690_10000086612 274
26 3300005340 Ga0070689_100001303 Ga0070689_1000013032 274
27 3300005355 Ga0070671_100013734 Ga0070671_1000137346 274
28 3300005364 Ga0070673_100002075 Ga0070673_1000020758 274
29 3300005436 Ga0070713_100000238 Ga0070713_10000023810 274
30 3300005437 Ga0070710_10005829 Ga0070710_100058292 274
31 3300005438 Ga0070701_10021712 Ga0070701_100217121 274
32 3300005544 Ga0070686_100183215 Ga0070686_1001832151 274
33 3300005548 Ga0070665_100004459 Ga0070665_1000044597 274
34 3300005614 Ga0068856_100185981 Ga0068856_1001859812 274
35 3300005618 Ga0068864_100004710 Ga0068864_1000047109 274
36 3300005841 Ga0068863_100020368 Ga0068863_1000203684 274
37 3300005842 Ga0068858_100001841 Ga0068858_1000018413 274
38 3300006175 Ga0070712_100001041 Ga0070712_10000104113 274
39 3300006871 Ga0075434_100386772 Ga0075434_1003867722 274
40 3300006881 Ga0068865_100232675 Ga0068865_1002326751 274
41 3300009101 Ga0105247_10017988 Ga0105247_100179882 274
42 3300013296 Ga0157374_10000529 Ga0157374_1000052915 274
43 3300013308 Ga0157375_10031644 Ga0157375_100316442 274
44 3300014325 Ga0163163_10000741 Ga0163163_1000074115 274
45 3300014745 Ga0157377_10015229 Ga0157377_100152294 274
46 3300014968 Ga0157379_10003263 Ga0157379_1000326312 274
47 3300025898 Ga0207692_10070907 Ga0207692_100709072 274
48 3300025900 Ga0207710_10011178 Ga0207710_100111782 274
49 3300025915 Ga0207693_10000438 Ga0207693_100004387 274
50 3300025916 Ga0207663_10001485 Ga0207663_100014856 274
51 3300025925 Ga0207650_10140041 Ga0207650_101400412 274
52 3300025928 Ga0207700_10001746 Ga0207700_100017463 274
53 3300025931 Ga0207644_10003122 Ga0207644_100031227 274
54 3300025941 Ga0207711_10001063 Ga0207711_100010638 274
55 3300025960 Ga0207651_10004459 Ga0207651_100044592 274
56 3300025986 Ga0207658_10169005 Ga0207658_101690052 274
57 3300026023 Ga0207677_10001885 Ga0207677_100018856 274
58 3300026035 Ga0207703_10005222 Ga0207703_100052222 274
59 3300026095 Ga0207676_10001533 Ga0207676_1000153313 274
60 3300035086 Ga0373934_0009219 Ga0373934_0009219_1624_2712 274
61 3300035111 Ga0373923_0000628 Ga0373923_0000628_6923_8011 274
62 3300035117 Ga0373953_0016158 Ga0373953_0016158_928_2016 274
63 3300035118 Ga0373954_0001047 Ga0373954_0001047_2306_3394 274
64 3300035119 Ga0373956_0010799 Ga0373956_0010799_230_1318 274
65 3300035120 Ga0373957_0007527 Ga0373957_0007527_195_1283 274
66 3300035172 Ga0373955_0000980 Ga0373955_0000980_6693_7781 274
67 3300035410 Ga0373924_0025449 Ga0373924_0025449_73_1161 274
68 3300035724 Ga0373933_0004684 Ga0373933_0004684_4537_5625 274
69 3300036401 Ga0373937_0009188 Ga0373937_0009188_7214_8302 274
70 3300046472 Ga0495580_0046286 Ga0495580_0046286_195_1283 274
71 3300046529 Ga0495652_0122372 Ga0495652_0122372_954_2042 274
72 3300046681 Ga0495647_0001667 Ga0495647_0001667_3061_4149 274
73 3300047317 Ga0495604_0048837 Ga0495604_0048837_380_1468 274
74 3300047319 Ga0495674_0139342 Ga0495674_0139342_107_1195 274
75 3300048907 Ga0496104_0004868 Ga0496104_0004868_9952_11040 274
76 3300048912 Ga0496109_0019071 Ga0496109_0019071_4267_5355 274
77 3300048915 Ga0496112_0082543 Ga0496112_0082543_2002_3090 274
78 3300048916 Ga0496113_0116286 Ga0496113_0116286_40_1128 274
79 3300048917 Ga0496114_0025917 Ga0496114_0025917_2002_3090 274
80 3300044672 Ga0466982_0000009 Ga0466982_0000009_152732_153859 275
81 3300005843 Ga0068860_100404101 Ga0068860_1004041012 277
82 3300026088 Ga0207641_10078758 Ga0207641_100787582 277
83 3300028380 Ga0268265_10352090 Ga0268265_103520901 277
84 3300028381 Ga0268264_10238759 Ga0268264_102387592 277
85 3300005334 Ga0068869_100015853 Ga0068869_1000158532 278
86 3300005364 Ga0070673_100132030 Ga0070673_1001320302 278
87 3300005539 Ga0068853_100308766 Ga0068853_1003087661 278
88 3300005577 Ga0068857_100033553 Ga0068857_1000335533 278
89 3300005617 Ga0068859_100027889 Ga0068859_1000278893 278
90 3300005618 Ga0068864_100021290 Ga0068864_1000212904 278
91 3300005719 Ga0068861_100005356 Ga0068861_1000053563 278
92 3300005840 Ga0068870_10015763 Ga0068870_100157632 278
93 3300005841 Ga0068863_100029818 Ga0068863_1000298182 278
94 3300005842 Ga0068858_100011779 Ga0068858_1000117793 278
95 3300005843 Ga0068860_100036746 Ga0068860_1000367462 278
96 3300005843 Ga0068860_100090935 Ga0068860_1000909352 278
97 3300005844 Ga0068862_100033281 Ga0068862_1000332812 278
98 3300006931 Ga0097620_100027888 Ga0097620_1000278883 278
99 3300013308 Ga0157375_10075947 Ga0157375_100759472 278
100 3300013308 Ga0157375_10255156 Ga0157375_102551562 278
101 3300014968 Ga0157379_10011326 Ga0157379_100113263 278
102 3300025908 Ga0207643_10020450 Ga0207643_100204503 278
103 3300025941 Ga0207711_10049008 Ga0207711_100490082 278
104 3300025942 Ga0207689_10000330 Ga0207689_1000033014 278
105 3300025972 Ga0207668_10067616 Ga0207668_100676162 278
106 3300025986 Ga0207658_10053543 Ga0207658_100535432 278
107 3300026035 Ga0207703_10032378 Ga0207703_100323782 278
108 3300026088 Ga0207641_10036643 Ga0207641_100366433 278
109 3300026095 Ga0207676_10103960 Ga0207676_101039602 278
110 3300026116 Ga0207674_10018094 Ga0207674_100180946 278
111 3300026118 Ga0207675_100004879 Ga0207675_1000048797 278
112 3300028380 Ga0268265_10070187 Ga0268265_100701872 278
113 3300028381 Ga0268264_10008725 Ga0268264_100087253 278
114 3300028381 Ga0268264_10012218 Ga0268264_100122183 278
115 3300048905 Ga0496102_0046336 Ga0496102_0046336_2044_3132 278
116 3300048911 Ga0496108_0104724 Ga0496108_0104724_196_1284 278
117 3300049569 Ga0501032_0022297 Ga0501032_0022297_2779_3867 280
118 3300049570 Ga0501033_0008916 Ga0501033_0008916_5586_6767 280
119 3300049574 Ga0501038_0062117 Ga0501038_0062117_981_2162 280
120 3300049822 Ga0501035_0004063 Ga0501035_0004063_12140_13228 280
121 3300005347 Ga0070668_100205421 Ga0070668_1002054211 281
122 3300005364 Ga0070673_100296033 Ga0070673_1002960331 281
123 3300005365 Ga0070688_100151289 Ga0070688_1001512891 281
124 3300005466 Ga0070685_10021008 Ga0070685_100210082 281
125 3300005564 Ga0070664_100189392 Ga0070664_1001893922 281
126 3300005615 Ga0070702_100236502 Ga0070702_1002365021 281
127 3300005842 Ga0068858_100285376 Ga0068858_1002853761 281
128 3300005842 Ga0068858_100301949 Ga0068858_1003019492 281
129 3300006358 Ga0068871_100127236 Ga0068871_1001272362 281
130 3300013296 Ga0157374_10156477 Ga0157374_101564773 281
131 3300025315 Ga0207697_10029754 Ga0207697_100297543 281
132 3300025901 Ga0207688_10023723 Ga0207688_100237233 281
133 3300025907 Ga0207645_10006274 Ga0207645_100062748 281
134 3300025918 Ga0207662_10002504 Ga0207662_1000250410 281
135 3300025925 Ga0207650_10061432 Ga0207650_100614322 281
136 3300025933 Ga0207706_10288758 Ga0207706_102887581 281
137 3300026088 Ga0207641_10197781 Ga0207641_101977812 281
138 3300026116 Ga0207674_10382551 Ga0207674_103825511 281
139 3300026118 Ga0207675_100172221 Ga0207675_1001722213 281
140 3300026121 Ga0207683_10268972 Ga0207683_102689721 281
141 3300046683 Ga0495658_0064887 Ga0495658_0064887_269_1357 281
142 3300050511 nmdc:mga08y16_345781_c1 nmdc:mga08y16_345781_c1_36_1124 281
143 3300044712 Ga0453684_0024367 Ga0453684_0024367_332_1423 283
144 3300013104 Ga0157370_10001959 Ga0157370_1000195920 284
145 3300049574 Ga0501038_0063804 Ga0501038_0063804_1863_2951 285
146 3300039437 Ga0436365_0213237 Ga0436365_0213237_746_1822 290
147 3300041413 Ga0439465_0002769 Ga0439465_0002769_4392_5396 290
148 3300042004 Ga0439445_0011279 Ga0439445_0011279_1016_2020 290
149 3300042007 Ga0439449_0000018 Ga0439449_0000018_13626_14630 290
150 3300031824 Ga0307413_10204072 Ga0307413_102040722 291
151 3300031903 Ga0307407_10186745 Ga0307407_101867452 291
152 3300026142 Ga0207698_10150994 Ga0207698_101509941 292
153 3300028573 Ga0265334_10026663 Ga0265334_100266632 292
154 3300028800 Ga0265338_10014948 Ga0265338_100149486 292
155 3300005435 Ga0070714_100004338 Ga0070714_1000043382 293
156 3300025929 Ga0207664_10022763 Ga0207664_100227634 293
157 3300031251 Ga0265327_10000247 Ga0265327_1000024717 293
158 3300031251 Ga0265327_10004296 Ga0265327_100042963 293
159 3300031344 Ga0265316_10001281 Ga0265316_1000128110 293
160 3300031595 Ga0265313_10000125 Ga0265313_1000012545 293
161 3300046517 Ga0495630_0056827 Ga0495630_0056827_910_1983 293
162 3300003763 Ga0055529_1001087 Ga0055529_10010873 294
163 3300005295 Ga0065707_10189806 Ga0065707_101898061 294
164 3300005329 Ga0070683_100089831 Ga0070683_1000898312 294
165 3300005338 Ga0068868_100003645 Ga0068868_1000036452 294
166 3300005338 Ga0068868_100161877 Ga0068868_1001618771 294
167 3300005339 Ga0070660_100001108 Ga0070660_10000110813 294
168 3300005344 Ga0070661_100028670 Ga0070661_1000286701 294
169 3300005347 Ga0070668_100008521 Ga0070668_1000085212 294
170 3300005347 Ga0070668_100261385 Ga0070668_1002613851 294
171 3300005354 Ga0070675_100003529 Ga0070675_1000035292 294
172 3300005355 Ga0070671_100033931 Ga0070671_1000339312 294
173 3300005356 Ga0070674_100000741 Ga0070674_1000007415 294
174 3300005364 Ga0070673_100001325 Ga0070673_1000013255 294
175 3300005366 Ga0070659_100056522 Ga0070659_1000565224 294
176 3300005367 Ga0070667_100002987 Ga0070667_1000029875 294
177 3300005367 Ga0070667_100239889 Ga0070667_1002398892 294
178 3300005439 Ga0070711_100272989 Ga0070711_1002729891 294
179 3300005445 Ga0070708_100025979 Ga0070708_1000259792 294
180 3300005456 Ga0070678_100002018 Ga0070678_1000020187 294
181 3300005457 Ga0070662_100064960 Ga0070662_1000649602 294
182 3300005458 Ga0070681_10098907 Ga0070681_100989072 294
183 3300005459 Ga0068867_100146552 Ga0068867_1001465521 294
184 3300005467 Ga0070706_100125152 Ga0070706_1001251522 294
185 3300005468 Ga0070707_100116983 Ga0070707_1001169831 294
186 3300005518 Ga0070699_100305881 Ga0070699_1003058812 294
187 3300005535 Ga0070684_100006429 Ga0070684_1000064293 294
188 3300005543 Ga0070672_100000965 Ga0070672_1000009654 294
189 3300005543 Ga0070672_100057088 Ga0070672_1000570882 294
190 3300005548 Ga0070665_100005516 Ga0070665_1000055162 294
191 3300005548 Ga0070665_100005552 Ga0070665_1000055526 294
192 3300005563 Ga0068855_100039589 Ga0068855_1000395894 294
193 3300005563 Ga0068855_100147069 Ga0068855_1001470692 294
194 3300005564 Ga0070664_100000772 Ga0070664_1000007728 294
195 3300005577 Ga0068857_100019569 Ga0068857_1000195696 294
196 3300005614 Ga0068856_100006730 Ga0068856_1000067306 294
197 3300005614 Ga0068856_100032597 Ga0068856_1000325974 294
198 3300005614 Ga0068856_100393786 Ga0068856_1003937862 294
199 3300005616 Ga0068852_100000944 Ga0068852_1000009443 294
200 3300005616 Ga0068852_100247083 Ga0068852_1002470833 294
201 3300005618 Ga0068864_100107855 Ga0068864_1001078552 294
202 3300005834 Ga0068851_10006697 Ga0068851_100066973 294
203 3300005840 Ga0068870_10154977 Ga0068870_101549771 294
204 3300005841 Ga0068863_100008287 Ga0068863_1000082872 294
205 3300005842 Ga0068858_100260079 Ga0068858_1002600792 294
206 3300005985 Ga0081539_10105740 Ga0081539_101057402 294
207 3300006175 Ga0070712_100281031 Ga0070712_1002810311 294
208 3300006237 Ga0097621_100044301 Ga0097621_1000443012 294
209 3300006844 Ga0075428_100002640 Ga0075428_10000264012 294
210 3300009093 Ga0105240_10018889 Ga0105240_100188897 294
211 3300009093 Ga0105240_10030358 Ga0105240_100303587 294
212 3300009093 Ga0105240_10243373 Ga0105240_102433731 294
213 3300009094 Ga0111539_10103020 Ga0111539_101030202 294
214 3300009098 Ga0105245_10006319 Ga0105245_1000631911 294
215 3300009098 Ga0105245_10082519 Ga0105245_100825192 294
216 3300009177 Ga0105248_10046332 Ga0105248_100463322 294
217 3300009177 Ga0105248_10062604 Ga0105248_100626042 294
218 3300009545 Ga0105237_10026431 Ga0105237_100264317 294
219 3300009551 Ga0105238_10019656 Ga0105238_100196562 294
220 3300013100 Ga0157373_10025755 Ga0157373_100257554 294
221 3300013104 Ga0157370_10004642 Ga0157370_1000464213 294
222 3300013104 Ga0157370_10006908 Ga0157370_100069082 294
223 3300013104 Ga0157370_10008379 Ga0157370_100083795 294
224 3300013104 Ga0157370_10028329 Ga0157370_100283296 294
225 3300013105 Ga0157369_10024431 Ga0157369_100244316 294
226 3300013296 Ga0157374_10000145 Ga0157374_1000014524 294
227 3300013306 Ga0163162_10079823 Ga0163162_100798232 294
228 3300013307 Ga0157372_10037280 Ga0157372_100372802 294
229 3300013307 Ga0157372_10053840 Ga0157372_100538404 294
230 3300013308 Ga0157375_10028339 Ga0157375_100283393 294
231 3300015685 Ga0183369_1009 Ga0183369_1009212 294
232 3300017792 Ga0163161_10035906 Ga0163161_100359062 294
233 3300025228 Ga0209672_106718 Ga0209672_1067181 294
234 3300025242 Ga0209258_103040 Ga0209258_1030403 294
235 3300025321 Ga0207656_10021433 Ga0207656_100214332 294
236 3300025893 Ga0207682_10000348 Ga0207682_100003482 294
237 3300025903 Ga0207680_10036018 Ga0207680_100360182 294
238 3300025907 Ga0207645_10000557 Ga0207645_100005578 294
239 3300025910 Ga0207684_10030323 Ga0207684_100303233 294
240 3300025912 Ga0207707_10053300 Ga0207707_100533003 294
241 3300025914 Ga0207671_10032170 Ga0207671_100321702 294
242 3300025915 Ga0207693_10060065 Ga0207693_100600653 294
243 3300025917 Ga0207660_10122897 Ga0207660_101228971 294
244 3300025919 Ga0207657_10002377 Ga0207657_100023773 294
245 3300025919 Ga0207657_10225696 Ga0207657_102256962 294
246 3300025920 Ga0207649_10003982 Ga0207649_100039823 294
247 3300025924 Ga0207694_10008419 Ga0207694_100084197 294
248 3300025929 Ga0207664_10002954 Ga0207664_100029548 294
249 3300025931 Ga0207644_10002304 Ga0207644_100023044 294
250 3300025937 Ga0207669_10002125 Ga0207669_100021252 294
251 3300025940 Ga0207691_10000030 Ga0207691_1000003036 294
252 3300025940 Ga0207691_10029671 Ga0207691_100296712 294
253 3300025941 Ga0207711_10033355 Ga0207711_100333552 294
254 3300025941 Ga0207711_10168089 Ga0207711_101680892 294
255 3300025942 Ga0207689_10134814 Ga0207689_101348142 294
256 3300025945 Ga0207679_10009935 Ga0207679_100099352 294
257 3300025960 Ga0207651_10095486 Ga0207651_100954862 294
258 3300025972 Ga0207668_10097114 Ga0207668_100971142 294
259 3300025981 Ga0207640_10118517 Ga0207640_101185172 294
260 3300025986 Ga0207658_10017096 Ga0207658_100170962 294
261 3300026023 Ga0207677_10227481 Ga0207677_102274812 294
262 3300026078 Ga0207702_10011045 Ga0207702_100110452 294
263 3300026078 Ga0207702_10046732 Ga0207702_100467322 294
264 3300026078 Ga0207702_10253563 Ga0207702_102535632 294
265 3300026089 Ga0207648_10002962 Ga0207648_1000296213 294
266 3300026089 Ga0207648_10095455 Ga0207648_100954551 294
267 3300026095 Ga0207676_10056745 Ga0207676_100567451 294
268 3300026116 Ga0207674_10000292 Ga0207674_1000029255 294
269 3300026121 Ga0207683_10000019 Ga0207683_1000001937 294
270 3300026121 Ga0207683_10050920 Ga0207683_100509201 294
271 3300028379 Ga0268266_10006943 Ga0268266_100069434 294
272 3300028379 Ga0268266_10095913 Ga0268266_100959132 294
273 3300031665 Ga0316575_10017806 Ga0316575_100178063 294
274 3300031665 Ga0316575_10033991 Ga0316575_100339912 294
275 3300031665 Ga0316575_10052607 Ga0316575_100526071 294
276 3300031665 Ga0316575_10059549 Ga0316575_100595491 294
277 3300031691 Ga0316579_10015159 Ga0316579_100151592 294
278 3300031727 Ga0316576_10001899 Ga0316576_100018997 294
279 3300031727 Ga0316576_10056805 Ga0316576_100568052 294
280 3300031727 Ga0316576_10181215 Ga0316576_101812152 294
281 3300031727 Ga0316576_10271407 Ga0316576_102714071 294
282 3300031728 Ga0316578_10002765 Ga0316578_100027658 294
283 3300031728 Ga0316578_10006485 Ga0316578_100064856 294
284 3300031728 Ga0316578_10006514 Ga0316578_100065147 294
285 3300031728 Ga0316578_10031624 Ga0316578_100316243 294
286 3300031728 Ga0316578_10046419 Ga0316578_100464192 294
287 3300031728 Ga0316578_10097367 Ga0316578_100973672 294
288 3300031728 Ga0316578_10110873 Ga0316578_101108731 294
289 3300031728 Ga0316578_10142737 Ga0316578_101427372 294
290 3300031733 Ga0316577_10001634 Ga0316577_100016346 294
291 3300031733 Ga0316577_10080054 Ga0316577_100800541 294
292 3300032133 Ga0316583_10002605 Ga0316583_100026052 294
293 3300032133 Ga0316583_10006483 Ga0316583_100064836 294
294 3300032133 Ga0316583_10030044 Ga0316583_100300442 294
295 3300032137 Ga0316585_10000435 Ga0316585_100004357 294
296 3300032137 Ga0316585_10012211 Ga0316585_100122112 294
297 3300032137 Ga0316585_10049150 Ga0316585_100491501 294
298 3300032139 Ga0316580_10003978 Ga0316580_100039784 294
299 3300032168 Ga0316593_10003788 Ga0316593_100037882 294
300 3300032168 Ga0316593_10012047 Ga0316593_100120471 294
301 3300032168 Ga0316593_10015556 Ga0316593_100155563 294
302 3300032168 Ga0316593_10023548 Ga0316593_100235481 294
303 3300032168 Ga0316593_10027568 Ga0316593_100275681 294
304 3300032168 Ga0316593_10027973 Ga0316593_100279732 294
305 3300032168 Ga0316593_10049757 Ga0316593_100497571 294
306 3300032168 Ga0316593_10050081 Ga0316593_100500811 294
307 3300032168 Ga0316593_10058551 Ga0316593_100585511 294
308 3300032168 Ga0316593_10063770 Ga0316593_100637702 294
309 3300032168 Ga0316593_10074314 Ga0316593_100743141 294
310 3300033524 Ga0316592_1014031 Ga0316592_10140312 294
311 3300033524 Ga0316592_1015546 Ga0316592_10155461 294
312 3300033529 Ga0316587_1012359 Ga0316587_10123591 294
313 3300033529 Ga0316587_1014802 Ga0316587_10148021 294
314 3300033529 Ga0316587_1015060 Ga0316587_10150601 294
315 3300033541 Ga0316596_1015187 Ga0316596_10151871 294
316 3300033541 Ga0316596_1029834 Ga0316596_10298341 294
317 3300033541 Ga0316596_1036785 Ga0316596_10367851 294
318 3300033541 Ga0316596_1040277 Ga0316596_10402771 294
319 3300033541 Ga0316596_1043984 Ga0316596_10439841 294
320 3300035118 Ga0373954_0002006 Ga0373954_0002006_353_1486 294
321 3300035398 Ga0316574_0000460 Ga0316574_0000460_14211_15302 294
322 3300035398 Ga0316574_0001096 Ga0316574_0001096_11009_12100 294
323 3300035398 Ga0316574_0008709 Ga0316574_0008709_3672_4904 294
324 3300035398 Ga0316574_0039109 Ga0316574_0039109_18_1109 294
325 3300035398 Ga0316574_0041459 Ga0316574_0041459_13_1104 294
326 3300035398 Ga0316574_0087326 Ga0316574_0087326_42_1133 294
327 3300035398 Ga0316574_0166466 Ga0316574_0166466_197_1288 294
328 3300035398 Ga0316574_0190243 Ga0316574_0190243_168_1262 294
329 3300035398 Ga0316574_0192827 Ga0316574_0192827_125_1216 294
330 3300035398 Ga0316574_0194590 Ga0316574_0194590_171_1262 294
331 3300035691 Ga0373931_0017024 Ga0373931_0017024_1643_2731 294
332 3300035691 Ga0373931_0175636 Ga0373931_0175636_47_1135 294
333 3300036647 Ga0316582_0000694 Ga0316582_0000694_452_1543 294
334 3300036647 Ga0316582_0006255 Ga0316582_0006255_2940_4031 294
335 3300036647 Ga0316582_0033267 Ga0316582_0033267_1618_2709 294
336 3300036647 Ga0316582_0034789 Ga0316582_0034789_1944_3056 294
337 3300036647 Ga0316582_0036144 Ga0316582_0036144_10_1101 294
338 3300036647 Ga0316582_0046122 Ga0316582_0046122_134_1225 294
339 3300036647 Ga0316582_0124663 Ga0316582_0124663_540_1631 294
340 3300036712 Ga0316584_0001884 Ga0316584_0001884_5126_6217 294
341 3300036712 Ga0316584_0002131 Ga0316584_0002131_9893_10984 294
342 3300036712 Ga0316584_0023849 Ga0316584_0023849_3232_4323 294
343 3300036712 Ga0316584_0030052 Ga0316584_0030052_2527_3618 294
344 3300036712 Ga0316584_0078838 Ga0316584_0078838_1142_2239 294
345 3300036712 Ga0316584_0116847 Ga0316584_0116847_774_1865 294
346 3300036712 Ga0316584_0141166 Ga0316584_0141166_471_1562 294
347 3300037418 Ga0395900_0000033 Ga0395900_0000033_245283_246374 294
348 3300037588 Ga0316581_0019325 Ga0316581_0019325_70_1161 294
349 3300037588 Ga0316581_0044424 Ga0316581_0044424_74_1165 294
350 3300038725 Ga0400484_25749 Ga0400484_25749_1764_2855 294
351 3300038742 Ga0400486_02321 Ga0400486_02321_2174_3265 294
352 3300039062 Ga0400483_103279 Ga0400483_103279_426_1517 294
353 3300039062 Ga0400483_140056 Ga0400483_140056_466_1557 294
354 3300039062 Ga0400483_182485 Ga0400483_182485_56_1147 294
355 3300039062 Ga0400483_223868 Ga0400483_223868_503_1594 294
356 3300039093 Ga0400489_50892 Ga0400489_50892_16472_17563 294
357 3300039110 Ga0400487_30323 Ga0400487_30323_1773_2864 294
358 3300041451 Ga0451791_1367609 Ga0451791_1367609_602_1693 294
359 3300041452 Ga0451793_0236231 Ga0451793_0236231_1531_2619 294
360 3300041494 Ga0451837_1566477 Ga0451837_1566477_825_1916 294
361 3300042001 Ga0439441_004455 Ga0439441_004455_88_1176 294
362 3300044712 Ga0453684_0104554 Ga0453684_0104554_258_1346 294
363 3300045051 Ga0451576_0233961 Ga0451576_0233961_166_1251 294
364 3300045976 Ga0466967_0177725 Ga0466967_0177725_759_1847 294
365 3300048908 Ga0496105_0193797 Ga0496105_0193797_176_1264 294
366 3300048911 Ga0496108_0039005 Ga0496108_0039005_1834_2931 294
367 3300048914 Ga0496111_0316977 Ga0496111_0316977_36_1118 294
368 3300048919 Ga0496116_0029774 Ga0496116_0029774_18_1043 294
369 3300049570 Ga0501033_0053102 Ga0501033_0053102_957_2048 294
370 3300049589 Ga0501073_0002738 Ga0501073_0002738_5281_6372 294
371 3300049744 Ga0501083_0062418 Ga0501083_0062418_592_1683 294
372 3300050512 nmdc:mga0n895_527368_c1 nmdc:mga0n895_527368_c1_47_1135 294
373 iso_pu_bacteria 8055225921 8055228966 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

144

388

0.98

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

53

126

0.95

PF13614

AAA_31

AAA domain

146

217

0.92

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

149

368

0.83

PF09140

MipZ

ATPase MipZ

147

321

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oby-assembly1.cif.gz_A the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus with co found by pixe. based on 3kb1. 0.8519 53 247
6g2g-assembly1.cif.gz_A fe-s assembly cfd1 0.8474 51 274
2ph1-assembly1.cif.gz_A crystal structure of nucleotide-binding protein af2382 from archaeoglobus fulgidus, northeast structural genomics target gr165 0.8448 53 259
6g2g-assembly1.cif.gz_B fe-s assembly cfd1 0.832 51 274
5aun-assembly1.cif.gz_B crystal structure of the hypab-ni complex 0.8125 53 269
ID Description Score Start End Superfamily
af_Q6DH61_70_326_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9426 50 275 3.40.50.300
af_A0A1D6KXI0_31_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9332 51 274 3.40.50.300
af_Q54NE0_229_496_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9237 53 274 3.40.50.300
af_Q57731_34_290_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9207 52 274 3.40.50.300
af_Q2FW86_86_295_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9152 56 235 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0R0AHM7-F1-model_v4 Iron-sulfur cluster carrier protein 0.9568 41 280 GO:0005524
GO:0005829
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663
AF-A0A377ZC90-F1-model_v4 Iron-sulfur cluster carrier protein 0.9561 56 274 GO:0005524
GO:0005829
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663
AF-A0A7Z0QS16-F1-model_v4 Iron-sulfur cluster carrier protein 0.9556 41 280 GO:0005524
GO:0005829
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663
AF-A0A1G1MIF3-F1-model_v4 Iron-sulfur cluster carrier protein 0.9508 54 274 GO:0005524
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663
AF-A0A2J6N1H4-F1-model_v4 ATP-binding protein 0.9508 179 274 GO:0005524
GO:0005829
GO:0016226
GO:0046872
GO:0051536
GO:0140663

Feature Viewer

pLDDT pTM Quality
86.42 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map