F426243

General Info

Members Datasets Scaffolds Average Seq Length
373 190 746 255

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100001725|Ga0070690_1000017257
Length 280
Sequence VSILGRLFSSFWGGTFFYAMQKTNHYTFACMLSTKKSLGQHFLKDENVCKKIVASLQQCSFEQLLEIGPGGGALTKYLVKIPGIDFKAVELDSEKVDYLIINFPGLKEKIIHNDFLDIKRPFEGKFTIVGNFPYNISTQILFKILEWKNDVECAVGMFQKEVAQRIAAKEGSKVYGITSVLTQAFFNIEYLFEVSEHSFQPPPKVKSAVIRLKPKTEYAAMRSEESFFKLVKAAFNQRRKTLRNAVRDLFDSTILKDDLFNKRAEQLSVQEFTELTFAMK

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
127 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
165 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
168 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
169 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
170 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
171 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
174 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
189 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
190 2904467357 Chitinophaga sancti 3198 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 0.8
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 12.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100001725 3300005330 Bacteria 11547
2 rootH1_10139775 3300003316 Bacteria 1250
3 rootL2_10125278 3300003322 Unclassified 1267
4 rootL2_10126356 3300003322 Bacteria 1269
5 rootH1_10107461 3300003323 Bacteria 12071
6 Ga0055531_10000867 3300003794 Bacteria 24797
7 Ga0065715_10005416 3300005293 Bacteria 4227
8 Ga0065707_10095210 3300005295 Bacteria 3404
9 Ga0065707_10172581 3300005295 Unclassified 1474
10 Ga0070676_10003227 3300005328 Bacteria 8452
11 Ga0070676_10016157 3300005328 Bacteria 4124
12 Ga0070676_10072173 3300005328 Bacteria 2075
13 Ga0070683_100000733 3300005329 Bacteria 23985
14 Ga0070683_100006637 3300005329 Bacteria 9717
15 Ga0070690_100014235 3300005330 Bacteria 4716
16 Ga0070670_100101536 3300005331 Bacteria 2477
17 Ga0070670_100128242 3300005331 Bacteria 2190
18 Ga0070670_100230560 3300005331 Bacteria 1611
19 Ga0070677_10019673 3300005333 Bacteria 2449
20 Ga0068869_100015931 3300005334 Bacteria 5058
21 Ga0068869_100027293 3300005334 Bacteria 3980
22 Ga0068869_100044458 3300005334 Unclassified 3194
23 Ga0068869_100076488 3300005334 Bacteria 2488
24 Ga0068869_100088154 3300005334 Bacteria 2329
25 Ga0068869_100132484 3300005334 Bacteria 1917
26 Ga0068869_100136252 3300005334 Bacteria 1892
27 Ga0070666_10001320 3300005335 Bacteria 15031
28 Ga0070666_10091691 3300005335 Unclassified 2088
29 Ga0068868_100008668 3300005338 Bacteria 7282
30 Ga0068868_100084355 3300005338 Unclassified 2551
31 Ga0068868_100108330 3300005338 Bacteria 2255
32 Ga0068868_100117774 3300005338 Unclassified 2164
33 Ga0070689_100031981 3300005340 Bacteria 4000
34 Ga0070689_100048739 3300005340 Bacteria 3268
35 Ga0070689_100063099 3300005340 Bacteria 2884
36 Ga0070661_100005772 3300005344 Bacteria 8515
37 Ga0070661_100011593 3300005344 Bacteria 6145
38 Ga0070661_100033412 3300005344 Bacteria 3726
39 Ga0070668_100091413 3300005347 Bacteria 2399
40 Ga0070669_100036333 3300005353 Bacteria 3569
41 Ga0070669_100052104 3300005353 Bacteria 2993
42 Ga0070669_100249063 3300005353 Bacteria 1414
43 Ga0070675_100011957 3300005354 Bacteria 6802
44 Ga0070675_100059079 3300005354 Bacteria 3163
45 Ga0070675_100305512 3300005354 Unclassified 1402
46 Ga0070671_100509243 3300005355 Bacteria 1036
47 Ga0070673_100008682 3300005364 Bacteria 6774
48 Ga0070673_100015131 3300005364 Bacteria 5405
49 Ga0070673_100170704 3300005364 Bacteria 1856
50 Ga0070673_100536562 3300005364 Bacteria 1061
51 Ga0070688_100067522 3300005365 Bacteria 2278
52 Ga0070688_100151743 3300005365 Bacteria 1584
53 Ga0070688_100228215 3300005365 Bacteria 1316
54 Ga0070659_100012282 3300005366 Bacteria 6350
55 Ga0070667_100016965 3300005367 Bacteria 6028
56 Ga0070667_100074349 3300005367 Bacteria 2899
57 Ga0070667_100083737 3300005367 Unclassified 2733
58 Ga0070700_100308691 3300005441 Bacteria 1158
59 Ga0070678_100001724 3300005456 Bacteria 11742
60 Ga0070662_100010955 3300005457 Bacteria 5974
61 Ga0068867_100058807 3300005459 Bacteria 2848
62 Ga0068867_100249102 3300005459 Bacteria 1444
63 Ga0068867_100282330 3300005459 Bacteria 1362
64 Ga0068867_100587658 3300005459 Bacteria 969
65 Ga0070685_10027101 3300005466 Bacteria 3164
66 Ga0070685_10244832 3300005466 Bacteria 1185
67 Ga0070698_100030039 3300005471 Bacteria 5639
68 Ga0070684_100006473 3300005535 Bacteria 9067
69 Ga0070684_100009789 3300005535 Bacteria 7569
70 Ga0070684_100109661 3300005535 Bacteria 2474
71 Ga0070684_100173020 3300005535 Bacteria 1961
72 Ga0068853_100000970 3300005539 Bacteria 20177
73 Ga0068853_100008969 3300005539 Bacteria 8057
74 Ga0068853_100121773 3300005539 Bacteria 2328
75 Ga0068853_100122565 3300005539 Bacteria 2321
76 Ga0068853_100543540 3300005539 Bacteria 1100
77 Ga0070672_100020997 3300005543 Bacteria 4774
78 Ga0070672_100029642 3300005543 Bacteria 4105
79 Ga0070686_100154399 3300005544 Bacteria 1610
80 Ga0070686_100169272 3300005544 Bacteria 1544
81 Ga0070665_100008455 3300005548 Bacteria 10411
82 Ga0070704_100180229 3300005549 Bacteria 1689
83 Ga0070664_100013215 3300005564 Bacteria 6723
84 Ga0070664_100017017 3300005564 Bacteria 5968
85 Ga0070664_100018485 3300005564 Bacteria 5727
86 Ga0070664_100047924 3300005564 Bacteria 3611
87 Ga0070664_100195679 3300005564 Bacteria 1802
88 Ga0070664_100236459 3300005564 Bacteria 1639
89 Ga0068857_100002170 3300005577 Bacteria 15950
90 Ga0068857_100065009 3300005577 Bacteria 3243
91 Ga0068854_100047498 3300005578 Unclassified 3060
92 Ga0068854_100153832 3300005578 Bacteria 1776
93 Ga0070702_100598282 3300005615 Bacteria 826
94 Ga0068852_100058398 3300005616 Bacteria 3342
95 Ga0068852_100113672 3300005616 Bacteria 2466
96 Ga0068852_100269879 3300005616 Bacteria 1637
97 Ga0068852_100324793 3300005616 Bacteria 1495
98 Ga0068859_100029189 3300005617 Bacteria 5535
99 Ga0068859_100054282 3300005617 Bacteria 4029
100 Ga0068859_100072318 3300005617 Unclassified 3485
101 Ga0068859_100080412 3300005617 Bacteria 3300
102 Ga0068859_100181940 3300005617 Bacteria 2185
103 Ga0068859_100393472 3300005617 Bacteria 1482
104 Ga0068864_100053057 3300005618 Bacteria 3496
105 Ga0068864_100168236 3300005618 Bacteria 1997
106 Ga0068864_100330308 3300005618 Unclassified 1434
107 Ga0068861_100029611 3300005719 Unclassified 4006
108 Ga0068870_10017082 3300005840 Unclassified 3482
109 Ga0068870_10038589 3300005840 Bacteria 2467
110 Ga0068870_10261584 3300005840 Bacteria 1077
111 Ga0068863_100009805 3300005841 Bacteria 9334
112 Ga0068863_100022440 3300005841 Bacteria 6028
113 Ga0068858_100013819 3300005842 Bacteria 7620
114 Ga0068860_100206624 3300005843 Bacteria 1904
115 Ga0068860_100229800 3300005843 Bacteria 1803
116 Ga0068862_100093890 3300005844 Bacteria 2616
117 Ga0068862_100096811 3300005844 Bacteria 2576
118 Ga0068862_100159633 3300005844 Unclassified 2012
119 Ga0068862_100323077 3300005844 Unclassified 1425
120 Ga0075366_10009706 3300006195 Bacteria 5380
121 Ga0075366_10022768 3300006195 Bacteria 3647
122 Ga0097621_100000129 3300006237 Bacteria 44253
123 Ga0097621_100006881 3300006237 Bacteria 8088
124 Ga0097621_100104030 3300006237 Bacteria 2392
125 Ga0068871_100000075 3300006358 Bacteria 55346
126 Ga0068871_100053871 3300006358 Bacteria 3262
127 Ga0068871_100156078 3300006358 Bacteria 1949
128 Ga0068871_100496173 3300006358 Bacteria 1100
129 Ga0075428_100160972 3300006844 Unclassified 2436
130 Ga0075429_100006828 3300006880 Bacteria 9905
131 Ga0068865_100012383 3300006881 Bacteria 5367
132 Ga0097620_100029188 3300006931 Bacteria 5535
133 Ga0097620_100054282 3300006931 Bacteria 4029
134 Ga0097620_100072328 3300006931 Unclassified 3485
135 Ga0097620_100080415 3300006931 Bacteria 3300
136 Ga0097620_100181941 3300006931 Bacteria 2185
137 Ga0097620_100393477 3300006931 Bacteria 1482
138 Ga0075435_100372132 3300007076 Bacteria 1227
139 Ga0111539_10194315 3300009094 Bacteria 2367
140 Ga0114129_10097801 3300009147 Bacteria 4063
141 Ga0114129_10388167 3300009147 Bacteria 1842
142 Ga0105242_10035443 3300009176 Bacteria 4001
143 Ga0105242_10064794 3300009176 Bacteria 3013
144 Ga0105242_10096865 3300009176 Bacteria 2493
145 Ga0105242_10152235 3300009176 Bacteria 2018
146 Ga0105242_10319362 3300009176 Bacteria 1424
147 Ga0105248_10041190 3300009177 Bacteria 5178
148 Ga0105248_10384426 3300009177 Bacteria 1580
149 Ga0105237_10004660 3300009545 Bacteria 15793
150 Ga0105249_10358493 3300009553 Bacteria 1479
151 Ga0105249_10479985 3300009553 Bacteria 1286
152 Ga0105239_10012454 3300010375 Bacteria 9472
153 Ga0105239_10072149 3300010375 Bacteria 3795
154 Ga0105239_10573037 3300010375 Bacteria 1286
155 Ga0105246_10139087 3300011119 Unclassified 1824
156 Ga0105246_10204749 3300011119 Bacteria 1537
157 Ga0105246_10631540 3300011119 Unclassified 930
158 Ga0157373_10014222 3300013100 Bacteria 5837
159 Ga0157371_10041762 3300013102 Bacteria 3272
160 Ga0157371_10225273 3300013102 Bacteria 1347
161 Ga0157374_10001889 3300013296 Bacteria 17565
162 Ga0157374_10002204 3300013296 Bacteria 16428
163 Ga0157374_10052990 3300013296 Bacteria 3781
164 Ga0157378_10110884 3300013297 Bacteria 2515
165 Ga0157378_10169372 3300013297 Bacteria 2047
166 Ga0157378_10222089 3300013297 Bacteria 1796
167 Ga0157378_10257729 3300013297 Bacteria 1672
168 Ga0157378_10263578 3300013297 Bacteria 1654
169 Ga0163162_10001415 3300013306 Bacteria 22313
170 Ga0163162_10011885 3300013306 Bacteria 8493
171 Ga0163162_10054814 3300013306 Bacteria 4011
172 Ga0163162_10091906 3300013306 Bacteria 3118
173 Ga0163162_10166930 3300013306 Bacteria 2325
174 Ga0163162_10486490 3300013306 Bacteria 1365
175 Ga0157372_10035417 3300013307 Bacteria 5496
176 Ga0157375_10000327 3300013308 Bacteria 42691
177 Ga0157375_10030893 3300013308 Bacteria 5056
178 Ga0157375_10043395 3300013308 Bacteria 4361
179 Ga0157375_10071994 3300013308 Bacteria 3472
180 Ga0157375_10080869 3300013308 Bacteria 3288
181 Ga0157375_10406397 3300013308 Bacteria 1528
182 Ga0163163_10000057 3300014325 Bacteria 124939
183 Ga0163163_10014658 3300014325 Bacteria 7208
184 Ga0157380_10091602 3300014326 Bacteria 2510
185 Ga0157380_10916230 3300014326 Bacteria 904
186 Ga0157377_10021102 3300014745 Unclassified 3421
187 Ga0157377_10034485 3300014745 Bacteria 2769
188 Ga0157377_10134919 3300014745 Unclassified 1511
189 Ga0157379_10234062 3300014968 Bacteria 1665
190 Ga0157379_10421121 3300014968 Bacteria 1230
191 Ga0157379_10627087 3300014968 Bacteria 1005
192 Ga0157376_10023941 3300014969 Bacteria 4789
193 Ga0157376_10205250 3300014969 Bacteria 1816
194 Ga0157376_10227646 3300014969 Bacteria 1730
195 Ga0157376_10910233 3300014969 Bacteria 898
196 Ga0163161_10001316 3300017792 Bacteria 18501
197 Ga0163161_10013372 3300017792 Bacteria 5711
198 Ga0163161_10039832 3300017792 Bacteria 3374
199 Ga0163161_10150981 3300017792 Bacteria 1766
200 Ga0209436_104263 3300025208 Bacteria 3566
201 Ga0207426_1001926 3300025302 Bacteria 14948
202 Ga0209257_1000128 3300025304 Bacteria 214268
203 Ga0207682_10005076 3300025893 Bacteria 5394
204 Ga0207642_10202106 3300025899 Bacteria 1098
205 Ga0207688_10016077 3300025901 Bacteria 4057
206 Ga0207688_10196402 3300025901 Bacteria 1208
207 Ga0207680_10090115 3300025903 Unclassified 1948
208 Ga0207645_10002261 3300025907 Bacteria 15307
209 Ga0207645_10009902 3300025907 Bacteria 6567
210 Ga0207645_10094072 3300025907 Bacteria 1929
211 Ga0207645_10115422 3300025907 Bacteria 1741
212 Ga0207643_10002755 3300025908 Bacteria 9505
213 Ga0207671_10255253 3300025914 Bacteria 1379
214 Ga0207662_10014400 3300025918 Bacteria 4438
215 Ga0207662_10240643 3300025918 Bacteria 1185
216 Ga0207649_10012354 3300025920 Bacteria 4736
217 Ga0207649_10044922 3300025920 Bacteria 2706
218 Ga0207649_10151579 3300025920 Bacteria 1597
219 Ga0207681_10006540 3300025923 Bacteria 7149
220 Ga0207681_10266668 3300025923 Bacteria 1343
221 Ga0207650_10004483 3300025925 Bacteria 9545
222 Ga0207650_10237593 3300025925 Bacteria 1472
223 Ga0207650_10394205 3300025925 Unclassified 1145
224 Ga0207659_10029346 3300025926 Bacteria 3748
225 Ga0207659_10067521 3300025926 Bacteria 2597
226 Ga0207644_10026105 3300025931 Bacteria 4023
227 Ga0207644_10150917 3300025931 Unclassified 1798
228 Ga0207644_10524042 3300025931 Bacteria 979
229 Ga0207706_10012736 3300025933 Bacteria 7656
230 Ga0207706_10086220 3300025933 Bacteria 2760
231 Ga0207686_10006761 3300025934 Bacteria 6175
232 Ga0207686_10050786 3300025934 Bacteria 2580
233 Ga0207670_10005115 3300025936 Bacteria 7161
234 Ga0207670_10015096 3300025936 Bacteria 4605
235 Ga0207669_10016954 3300025937 Bacteria 3721
236 Ga0207704_10016253 3300025938 Unclassified 3820
237 Ga0207704_10029674 3300025938 Bacteria 3054
238 Ga0207691_10025870 3300025940 Bacteria 5507
239 Ga0207711_10055410 3300025941 Bacteria 3404
240 Ga0207711_10264089 3300025941 Unclassified 1583
241 Ga0207689_10003045 3300025942 Bacteria 15442
242 Ga0207689_10016808 3300025942 Bacteria 6193
243 Ga0207689_10017769 3300025942 Bacteria 6009
244 Ga0207689_10023973 3300025942 Bacteria 5119
245 Ga0207689_10025584 3300025942 Bacteria 4945
246 Ga0207689_10025733 3300025942 Bacteria 4930
247 Ga0207689_10033811 3300025942 Bacteria 4247
248 Ga0207661_10002059 3300025944 Bacteria 13845
249 Ga0207661_10006530 3300025944 Bacteria 8248
250 Ga0207679_10001314 3300025945 Bacteria 15698
251 Ga0207679_10012769 3300025945 Bacteria 5487
252 Ga0207679_10097282 3300025945 Bacteria 2292
253 Ga0207679_10804595 3300025945 Bacteria 857
254 Ga0207651_10082402 3300025960 Bacteria 2322
255 Ga0207712_10006646 3300025961 Bacteria 7297
256 Ga0207658_10011316 3300025986 Bacteria 6074
257 Ga0207677_10037566 3300026023 Bacteria 3167
258 Ga0207677_10072480 3300026023 Bacteria 2435
259 Ga0207703_10099420 3300026035 Bacteria 2462
260 Ga0207639_10022845 3300026041 Bacteria 4510
261 Ga0207639_10069088 3300026041 Bacteria 2755
262 Ga0207678_10052769 3300026067 Bacteria 3506
263 Ga0207678_10552136 3300026067 Unclassified 1007
264 Ga0207708_10062227 3300026075 Bacteria 2851
265 Ga0207641_10006774 3300026088 Bacteria 9601
266 Ga0207641_10015749 3300026088 Bacteria 6195
267 Ga0207641_10023835 3300026088 Bacteria 5044
268 Ga0207641_10083997 3300026088 Bacteria 2771
269 Ga0207641_10181577 3300026088 Unclassified 1928
270 Ga0207648_10000860 3300026089 Bacteria 34249
271 Ga0207648_10034570 3300026089 Bacteria 4454
272 Ga0207648_10304601 3300026089 Bacteria 1430
273 Ga0207648_10507659 3300026089 Bacteria 1104
274 Ga0207676_10012047 3300026095 Bacteria 6187
275 Ga0207676_10162584 3300026095 Bacteria 1936
276 Ga0207676_10283018 3300026095 Bacteria 1506
277 Ga0207674_10017417 3300026116 Bacteria 7840
278 Ga0207674_10044233 3300026116 Bacteria 4586
279 Ga0207674_10066063 3300026116 Unclassified 3644
280 Ga0207675_100015768 3300026118 Bacteria 7046
281 Ga0207675_100025757 3300026118 Bacteria 5474
282 Ga0207675_100331227 3300026118 Bacteria 1488
283 Ga0207675_100532530 3300026118 Unclassified 1172
284 Ga0207675_100559426 3300026118 Bacteria 1143
285 Ga0207683_10009873 3300026121 Bacteria 8142
286 Ga0207683_10028696 3300026121 Bacteria 4813
287 Ga0207683_10039088 3300026121 Bacteria 4138
288 Ga0207698_10029115 3300026142 Unclassified 3950
289 Ga0207698_10065092 3300026142 Bacteria 2861
290 Ga0207698_10148283 3300026142 Unclassified 2032
291 Ga0207698_10854847 3300026142 Bacteria 915
292 Ga0209999_1033912 3300027543 Bacteria 950
293 Ga0207428_10150111 3300027907 Bacteria 1774
294 Ga0268264_10096065 3300028381 Bacteria 2566
295 Ga0268264_10163700 3300028381 Bacteria 2006
296 Ga0265327_10002921 3300031251 Bacteria 17111
297 Ga0373937_0118851 3300036401 Unclassified 2462
298 Ga0451853_3792783 3300041512 Unclassified 1125
299 Ga0439441_008007 3300042001 Unclassified 1718
300 Ga0450894_008251 3300042131 Bacteria 1346
301 Ga0453684_0449835 3300044712 Unclassified 1434
302 Ga0466957_0002398 3300044842 Bacteria 10057
303 Ga0495627_042404 3300046453 Bacteria 1394
304 Ga0495653_0115910 3300046463 Unclassified 1917
305 Ga0495628_0240587 3300046516 Bacteria 1354
306 Ga0495630_0116622 3300046517 Unclassified 2024
307 Ga0495643_0066090 3300046522 Bacteria 1908
308 Ga0495640_0155358 3300046533 Bacteria 1469
309 Ga0495633_0000153 3300046558 Bacteria 90972
310 Ga0495634_0137634 3300046642 Bacteria 1553
311 Ga0495657_0148228 3300046675 Unclassified 1459
312 Ga0495613_0276532 3300046689 Bacteria 1167
313 Ga0495686_0010687 3300047472 Bacteria 6517
314 Ga0495686_0032121 3300047472 Bacteria 3400
315 Ga0495686_0121136 3300047472 Bacteria 1559
316 Ga0496101_0051501 3300048904 Bacteria 2967
317 Ga0496110_0008705 3300048913 Bacteria 8173
318 Ga0496114_0364649 3300048917 Bacteria 1278
319 Ga0496124_0020356 3300048927 Bacteria 6135
320 Ga0496126_0013991 3300048929 Bacteria 8133
321 Ga0501298_000116 3300049521 Bacteria 9513
322 Ga0501032_0001924 3300049569 Bacteria 16361
323 Ga0501034_0009891 3300049571 Bacteria 9969
324 Ga0501034_0019453 3300049571 Bacteria 6946
325 Ga0501034_0189281 3300049571 Unclassified 2020
326 Ga0501034_0246763 3300049571 Bacteria 1730
327 Ga0501036_0011100 3300049572 Bacteria 7450
328 Ga0501037_0033950 3300049573 Bacteria 3767
329 Ga0501038_0100331 3300049574 Bacteria 2412
330 Ga0501039_0015954 3300049575 Bacteria 5752
331 Ga0501039_0180603 3300049575 Bacteria 1659
332 Ga0501043_0003670 3300049579 Bacteria 12607
333 Ga0501046_0086968 3300049580 Bacteria 2409
334 Ga0501047_0088868 3300049581 Bacteria 2967
335 Ga0501048_0143001 3300049582 Unclassified 1691
336 Ga0501070_0017032 3300049586 Bacteria 6099
337 Ga0501198_000204 3300049649 Bacteria 7734
338 Ga0501202_000055 3300049652 Bacteria 11589
339 Ga0501206_000318 3300049653 Bacteria 5655
340 Ga0501207_000139 3300049654 Bacteria 6541
341 Ga0501216_006394 3300049660 Unclassified 1806
342 Ga0501217_000109 3300049661 Bacteria 10551
343 Ga0501222_000354 3300049662 Bacteria 7198
344 Ga0501227_013876 3300049665 Unclassified 1781
345 Ga0501233_000291 3300049668 Bacteria 7735
346 Ga0501240_000191 3300049673 Bacteria 4421
347 Ga0501243_000022 3300049675 Bacteria 13556
348 Ga0501252_000491 3300049682 Bacteria 3050
349 Ga0501259_000353 3300049688 Bacteria 7194
350 Ga0501221_003484 3300049704 Unclassified 2590
351 Ga0501225_0001611 3300049705 Bacteria 7062
352 Ga0501234_000126 3300049707 Bacteria 9996
353 Ga0501245_002039 3300049708 Bacteria 2677
354 Ga0501080_0440708 3300049742 Bacteria 1169
355 Ga0501080_0697878 3300049742 Bacteria 895
356 Ga0501083_0008472 3300049744 Bacteria 7266
357 Ga0501280_013364 3300049776 Unclassified 1160
358 Ga0501035_0003392 3300049822 Bacteria 15239
359 Ga0501035_0092457 3300049822 Bacteria 2662
360 Ga0501044_0047103 3300049823 Bacteria 4460
361 Ga0501044_0087766 3300049823 Bacteria 3141
362 Ga0501044_0292048 3300049823 Bacteria 1561
363 nmdc:mga0k408_394175_c1 3300050493 Unclassified 824
364 nmdc:mga05p37_320995_c1 3300050507 Bacteria 1833
365 nmdc:mga09592_95663_c1 3300050508 Bacteria 2541
366 nmdc:mga08y16_94009_c1 3300050511 Bacteria 3123
367 nmdc:mga0rr50_430389_c1 3300050513 Bacteria 1117
368 Ga0500622_0000109 3300053156 Bacteria 83962
369 Ga0501084_0078562 3300054114 Bacteria 2766
370 Ga0466962_0160447 3300061719 Bacteria 1093
371 2819577247 2818991442 Bacteria 8318214
372 2821140550 2821136567 Bacteria 8080116
373 2904472969 2904467357 Bacteria 8057758
374 Ga0070690_100001725
375 rootH1_10139775
376 rootL2_10125278
377 rootL2_10126356
378 rootH1_10107461
379 Ga0055531_10000867
380 Ga0065715_10005416
381 Ga0065707_10095210
382 Ga0065707_10172581
383 Ga0070676_10003227
384 Ga0070676_10016157
385 Ga0070676_10072173
386 Ga0070683_100000733
387 Ga0070683_100006637
388 Ga0070690_100014235
389 Ga0070670_100101536
390 Ga0070670_100128242
391 Ga0070670_100230560
392 Ga0070677_10019673
393 Ga0068869_100015931
394 Ga0068869_100027293
395 Ga0068869_100044458
396 Ga0068869_100076488
397 Ga0068869_100088154
398 Ga0068869_100132484
399 Ga0068869_100136252
400 Ga0070666_10001320
401 Ga0070666_10091691
402 Ga0068868_100008668
403 Ga0068868_100084355
404 Ga0068868_100108330
405 Ga0068868_100117774
406 Ga0070689_100031981
407 Ga0070689_100048739
408 Ga0070689_100063099
409 Ga0070661_100005772
410 Ga0070661_100011593
411 Ga0070661_100033412
412 Ga0070668_100091413
413 Ga0070669_100036333
414 Ga0070669_100052104
415 Ga0070669_100249063
416 Ga0070675_100011957
417 Ga0070675_100059079
418 Ga0070675_100305512
419 Ga0070671_100509243
420 Ga0070673_100008682
421 Ga0070673_100015131
422 Ga0070673_100170704
423 Ga0070673_100536562
424 Ga0070688_100067522
425 Ga0070688_100151743
426 Ga0070688_100228215
427 Ga0070659_100012282
428 Ga0070667_100016965
429 Ga0070667_100074349
430 Ga0070667_100083737
431 Ga0070700_100308691
432 Ga0070678_100001724
433 Ga0070662_100010955
434 Ga0068867_100058807
435 Ga0068867_100249102
436 Ga0068867_100282330
437 Ga0068867_100587658
438 Ga0070685_10027101
439 Ga0070685_10244832
440 Ga0070698_100030039
441 Ga0070684_100006473
442 Ga0070684_100009789
443 Ga0070684_100109661
444 Ga0070684_100173020
445 Ga0068853_100000970
446 Ga0068853_100008969
447 Ga0068853_100121773
448 Ga0068853_100122565
449 Ga0068853_100543540
450 Ga0070672_100020997
451 Ga0070672_100029642
452 Ga0070686_100154399
453 Ga0070686_100169272
454 Ga0070665_100008455
455 Ga0070704_100180229
456 Ga0070664_100013215
457 Ga0070664_100017017
458 Ga0070664_100018485
459 Ga0070664_100047924
460 Ga0070664_100195679
461 Ga0070664_100236459
462 Ga0068857_100002170
463 Ga0068857_100065009
464 Ga0068854_100047498
465 Ga0068854_100153832
466 Ga0070702_100598282
467 Ga0068852_100058398
468 Ga0068852_100113672
469 Ga0068852_100269879
470 Ga0068852_100324793
471 Ga0068859_100029189
472 Ga0068859_100054282
473 Ga0068859_100072318
474 Ga0068859_100080412
475 Ga0068859_100181940
476 Ga0068859_100393472
477 Ga0068864_100053057
478 Ga0068864_100168236
479 Ga0068864_100330308
480 Ga0068861_100029611
481 Ga0068870_10017082
482 Ga0068870_10038589
483 Ga0068870_10261584
484 Ga0068863_100009805
485 Ga0068863_100022440
486 Ga0068858_100013819
487 Ga0068860_100206624
488 Ga0068860_100229800
489 Ga0068862_100093890
490 Ga0068862_100096811
491 Ga0068862_100159633
492 Ga0068862_100323077
493 Ga0075366_10009706
494 Ga0075366_10022768
495 Ga0097621_100000129
496 Ga0097621_100006881
497 Ga0097621_100104030
498 Ga0068871_100000075
499 Ga0068871_100053871
500 Ga0068871_100156078
501 Ga0068871_100496173
502 Ga0075428_100160972
503 Ga0075429_100006828
504 Ga0068865_100012383
505 Ga0097620_100029188
506 Ga0097620_100054282
507 Ga0097620_100072328
508 Ga0097620_100080415
509 Ga0097620_100181941
510 Ga0097620_100393477
511 Ga0075435_100372132
512 Ga0111539_10194315
513 Ga0114129_10097801
514 Ga0114129_10388167
515 Ga0105242_10035443
516 Ga0105242_10064794
517 Ga0105242_10096865
518 Ga0105242_10152235
519 Ga0105242_10319362
520 Ga0105248_10041190
521 Ga0105248_10384426
522 Ga0105237_10004660
523 Ga0105249_10358493
524 Ga0105249_10479985
525 Ga0105239_10012454
526 Ga0105239_10072149
527 Ga0105239_10573037
528 Ga0105246_10139087
529 Ga0105246_10204749
530 Ga0105246_10631540
531 Ga0157373_10014222
532 Ga0157371_10041762
533 Ga0157371_10225273
534 Ga0157374_10001889
535 Ga0157374_10002204
536 Ga0157374_10052990
537 Ga0157378_10110884
538 Ga0157378_10169372
539 Ga0157378_10222089
540 Ga0157378_10257729
541 Ga0157378_10263578
542 Ga0163162_10001415
543 Ga0163162_10011885
544 Ga0163162_10054814
545 Ga0163162_10091906
546 Ga0163162_10166930
547 Ga0163162_10486490
548 Ga0157372_10035417
549 Ga0157375_10000327
550 Ga0157375_10030893
551 Ga0157375_10043395
552 Ga0157375_10071994
553 Ga0157375_10080869
554 Ga0157375_10406397
555 Ga0163163_10000057
556 Ga0163163_10014658
557 Ga0157380_10091602
558 Ga0157380_10916230
559 Ga0157377_10021102
560 Ga0157377_10034485
561 Ga0157377_10134919
562 Ga0157379_10234062
563 Ga0157379_10421121
564 Ga0157379_10627087
565 Ga0157376_10023941
566 Ga0157376_10205250
567 Ga0157376_10227646
568 Ga0157376_10910233
569 Ga0163161_10001316
570 Ga0163161_10013372
571 Ga0163161_10039832
572 Ga0163161_10150981
573 Ga0209436_104263
574 Ga0207426_1001926
575 Ga0209257_1000128
576 Ga0207682_10005076
577 Ga0207642_10202106
578 Ga0207688_10016077
579 Ga0207688_10196402
580 Ga0207680_10090115
581 Ga0207645_10002261
582 Ga0207645_10009902
583 Ga0207645_10094072
584 Ga0207645_10115422
585 Ga0207643_10002755
586 Ga0207671_10255253
587 Ga0207662_10014400
588 Ga0207662_10240643
589 Ga0207649_10012354
590 Ga0207649_10044922
591 Ga0207649_10151579
592 Ga0207681_10006540
593 Ga0207681_10266668
594 Ga0207650_10004483
595 Ga0207650_10237593
596 Ga0207650_10394205
597 Ga0207659_10029346
598 Ga0207659_10067521
599 Ga0207644_10026105
600 Ga0207644_10150917
601 Ga0207644_10524042
602 Ga0207706_10012736
603 Ga0207706_10086220
604 Ga0207686_10006761
605 Ga0207686_10050786
606 Ga0207670_10005115
607 Ga0207670_10015096
608 Ga0207669_10016954
609 Ga0207704_10016253
610 Ga0207704_10029674
611 Ga0207691_10025870
612 Ga0207711_10055410
613 Ga0207711_10264089
614 Ga0207689_10003045
615 Ga0207689_10016808
616 Ga0207689_10017769
617 Ga0207689_10023973
618 Ga0207689_10025584
619 Ga0207689_10025733
620 Ga0207689_10033811
621 Ga0207661_10002059
622 Ga0207661_10006530
623 Ga0207679_10001314
624 Ga0207679_10012769
625 Ga0207679_10097282
626 Ga0207679_10804595
627 Ga0207651_10082402
628 Ga0207712_10006646
629 Ga0207658_10011316
630 Ga0207677_10037566
631 Ga0207677_10072480
632 Ga0207703_10099420
633 Ga0207639_10022845
634 Ga0207639_10069088
635 Ga0207678_10052769
636 Ga0207678_10552136
637 Ga0207708_10062227
638 Ga0207641_10006774
639 Ga0207641_10015749
640 Ga0207641_10023835
641 Ga0207641_10083997
642 Ga0207641_10181577
643 Ga0207648_10000860
644 Ga0207648_10034570
645 Ga0207648_10304601
646 Ga0207648_10507659
647 Ga0207676_10012047
648 Ga0207676_10162584
649 Ga0207676_10283018
650 Ga0207674_10017417
651 Ga0207674_10044233
652 Ga0207674_10066063
653 Ga0207675_100015768
654 Ga0207675_100025757
655 Ga0207675_100331227
656 Ga0207675_100532530
657 Ga0207675_100559426
658 Ga0207683_10009873
659 Ga0207683_10028696
660 Ga0207683_10039088
661 Ga0207698_10029115
662 Ga0207698_10065092
663 Ga0207698_10148283
664 Ga0207698_10854847
665 Ga0209999_1033912
666 Ga0207428_10150111
667 Ga0268264_10096065
668 Ga0268264_10163700
669 Ga0265327_10002921
670 Ga0373937_0118851
671 Ga0451853_3792783
672 Ga0439441_008007
673 Ga0450894_008251
674 Ga0453684_0449835
675 Ga0466957_0002398
676 Ga0495627_042404
677 Ga0495653_0115910
678 Ga0495628_0240587
679 Ga0495630_0116622
680 Ga0495643_0066090
681 Ga0495640_0155358
682 Ga0495633_0000153
683 Ga0495634_0137634
684 Ga0495657_0148228
685 Ga0495613_0276532
686 Ga0495686_0010687
687 Ga0495686_0032121
688 Ga0495686_0121136
689 Ga0496101_0051501
690 Ga0496110_0008705
691 Ga0496114_0364649
692 Ga0496124_0020356
693 Ga0496126_0013991
694 Ga0501298_000116
695 Ga0501032_0001924
696 Ga0501034_0009891
697 Ga0501034_0019453
698 Ga0501034_0189281
699 Ga0501034_0246763
700 Ga0501036_0011100
701 Ga0501037_0033950
702 Ga0501038_0100331
703 Ga0501039_0015954
704 Ga0501039_0180603
705 Ga0501043_0003670
706 Ga0501046_0086968
707 Ga0501047_0088868
708 Ga0501048_0143001
709 Ga0501070_0017032
710 Ga0501198_000204
711 Ga0501202_000055
712 Ga0501206_000318
713 Ga0501207_000139
714 Ga0501216_006394
715 Ga0501217_000109
716 Ga0501222_000354
717 Ga0501227_013876
718 Ga0501233_000291
719 Ga0501240_000191
720 Ga0501243_000022
721 Ga0501252_000491
722 Ga0501259_000353
723 Ga0501221_003484
724 Ga0501225_0001611
725 Ga0501234_000126
726 Ga0501245_002039
727 Ga0501080_0440708
728 Ga0501080_0697878
729 Ga0501083_0008472
730 Ga0501280_013364
731 Ga0501035_0003392
732 Ga0501035_0092457
733 Ga0501044_0047103
734 Ga0501044_0087766
735 Ga0501044_0292048
736 nmdc:mga0k408_394175_c1
737 nmdc:mga05p37_320995_c1
738 nmdc:mga09592_95663_c1
739 nmdc:mga08y16_94009_c1
740 nmdc:mga0rr50_430389_c1
741 Ga0500622_0000109
742 Ga0501084_0078562
743 Ga0466962_0160447
744 2819577247
745 2821140550
746 2904472969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

31

277

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.9262 10 246
6ifv-assembly1.cif.gz_A c-terminal truncated ksga from bacillus subtilis 168 0.913 10 184
6ifv-assembly2.cif.gz_B c-terminal truncated ksga from bacillus subtilis 168 0.9074 10 184
3tpz-assembly1.cif.gz_A 2.1 angstrom crystal structure of the l114p mutant of e. coli ksga 0.9026 9 245
3fte-assembly1.cif.gz_A crystal structure of a. aeolicus ksga in complex with rna 0.8972 16 241
ID Description Score Start End Superfamily
3fteA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9153 16 185 3.40.50.150
1qyrB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9017 10 187 3.40.50.150
3fteA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9 16 185 3.40.50.150
af_Q54QK7_28_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8984 4 184 3.40.50.150
af_A0A144A0V8_364_547_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8974 34 186 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q5UAJ8-F1-model_v4 deleted 0.9806 126 249
AF-A0A4Q5UAJ8-F1-model_v4 deleted 0.9653 126 249
AF-A0A832IFQ6-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) 0.9619 76 247 GO:0000179
GO:0003723
GO:0005829
AF-E6MS46-F1-model_v4 Ribosomal RNA adenine dimethylase family protein (EC 2.1.1.-) 0.9503 57 246 GO:0000179
GO:0003723
GO:0005829
AF-M7Y3W1-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9424 5 247 GO:0003723
GO:0005829
GO:0052908

Map