F426034

General Info

Members Datasets Scaffolds Average Seq Length
372 199 744 220

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11206493|Ga0114129_112064931
Length 240
Sequence MSGIDDNRQRDGARRDRNRRWRWATFDCYGTLVDWNRGLRDELARLFGAQARDPALARYHQLEREIQARDPAAPYREVLAQALGDVAGSLGEELPAGERDALGRSLPRWPVFDEVPASLTELRRRGWRLVILSNTDRDFIDASMERIGVPFELAIVASEIGSYKPAPGHWRKFLRVTGADPARHVHVAASLFHDIEPSHELGIPCVWINREGEAARGAPVAELPDLRELPDTLDRLVPAT

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
120 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
121 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
122 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 2.15
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_11206493 3300009147 Bacteria 942
2 Ga0070658_10113209 3300005327 Bacteria 2249
3 Ga0070690_100140203 3300005330 Bacteria 1640
4 Ga0068869_100291593 3300005334 Bacteria 1315
5 Ga0070660_100337101 3300005339 Bacteria 1240
6 Ga0070689_100104102 3300005340 Bacteria 2250
7 Ga0070675_100029849 3300005354 Bacteria 4399
8 Ga0070674_100065659 3300005356 Bacteria 2547
9 Ga0070714_100001730 3300005435 Bacteria 15912
10 Ga0070714_100215166 3300005435 Bacteria 1763
11 Ga0070714_100381538 3300005435 Bacteria 1329
12 Ga0070714_100522658 3300005435 Bacteria 1134
13 Ga0070713_100113583 3300005436 Bacteria 2365
14 Ga0070713_100305881 3300005436 Bacteria 1465
15 Ga0070700_100047961 3300005441 Bacteria 2645
16 Ga0070700_100159402 3300005441 Bacteria 1552
17 Ga0070694_100114540 3300005444 Bacteria 1925
18 Ga0070663_100793590 3300005455 Bacteria 811
19 Ga0070662_100727243 3300005457 Unclassified 841
20 Ga0070681_10105988 3300005458 Bacteria 2753
21 Ga0068867_100204362 3300005459 Bacteria 1583
22 Ga0070706_100007978 3300005467 Bacteria 9877
23 Ga0070707_100001128 3300005468 Bacteria 26352
24 Ga0070707_100086279 3300005468 Bacteria 3035
25 Ga0070707_100164840 3300005468 Bacteria 2160
26 Ga0070698_100043679 3300005471 Bacteria 4594
27 Ga0070698_100068436 3300005471 Bacteria 3568
28 Ga0070699_100009078 3300005518 Bacteria 8620
29 Ga0070699_100233378 3300005518 Bacteria 1641
30 Ga0070679_100106238 3300005530 Bacteria 2793
31 Ga0070684_100041518 3300005535 Bacteria 3966
32 Ga0070672_100646780 3300005543 Bacteria 923
33 Ga0070695_100149867 3300005545 Bacteria 1627
34 Ga0070696_100088122 3300005546 Bacteria 2205
35 Ga0070693_100386251 3300005547 Bacteria 967
36 Ga0068855_100017296 3300005563 Bacteria 8676
37 Ga0070664_100001508 3300005564 Bacteria 18552
38 Ga0068857_100069957 3300005577 Bacteria 3125
39 Ga0068859_100748895 3300005617 Bacteria 1066
40 Ga0068864_100029523 3300005618 Bacteria 4646
41 Ga0068870_10000109 3300005840 Bacteria 28042
42 Ga0068870_10214847 3300005840 Bacteria 1174
43 Ga0068863_100020090 3300005841 Bacteria 6389
44 Ga0068860_100151398 3300005843 Bacteria 2234
45 Ga0081455_10120143 3300005937 Bacteria 2071
46 Ga0081538_10000338 3300005981 Bacteria 53185
47 Ga0081538_10068178 3300005981 Bacteria 1980
48 Ga0081539_10041618 3300005985 Bacteria 2683
49 Ga0075365_10000816 3300006038 Bacteria 12843
50 Ga0075365_10001060 3300006038 Bacteria 11881
51 Ga0075365_10029252 3300006038 Bacteria 3519
52 Ga0075364_10005047 3300006051 Bacteria 7651
53 Ga0075364_10005988 3300006051 Bacteria 7106
54 Ga0070712_100773328 3300006175 Archaea 823
55 Ga0075428_100022036 3300006844 Bacteria 7053
56 Ga0075428_100065647 3300006844 Bacteria 3975
57 Ga0075428_100065837 3300006844 Bacteria 3968
58 Ga0075428_100315439 3300006844 Bacteria 1680
59 Ga0075430_100619911 3300006846 Bacteria 892
60 Ga0075431_100002236 3300006847 Bacteria 18540
61 Ga0075431_100428393 3300006847 Bacteria 1321
62 Ga0075431_100658170 3300006847 Bacteria 1027
63 Ga0075433_10005239 3300006852 Bacteria 10166
64 Ga0075433_10008880 3300006852 Bacteria 8019
65 Ga0075433_10047546 3300006852 Bacteria 3732
66 Ga0075434_100001608 3300006871 Bacteria 19188
67 Ga0075434_100069872 3300006871 Bacteria 3501
68 Ga0075434_100073823 3300006871 Bacteria 3404
69 Ga0075434_100161451 3300006871 Bacteria 2261
70 Ga0075429_100000031 3300006880 Bacteria 65247
71 Ga0075429_100115135 3300006880 Bacteria 2350
72 Ga0075429_100499552 3300006880 Bacteria 1066
73 Ga0075436_100014801 3300006914 Bacteria 5345
74 Ga0075436_100396762 3300006914 Unclassified 999
75 Ga0097620_100748902 3300006931 Bacteria 1066
76 Ga0075435_100000610 3300007076 Bacteria 21959
77 Ga0075435_100067860 3300007076 Bacteria 2904
78 Ga0105251_10015570 3300009011 Bacteria 4148
79 Ga0111539_10044650 3300009094 Bacteria 5308
80 Ga0111539_10109187 3300009094 Bacteria 3246
81 Ga0111539_10407306 3300009094 Bacteria 1584
82 Ga0111539_10427710 3300009094 Bacteria 1542
83 Ga0105245_10040820 3300009098 Bacteria 4135
84 Ga0114129_10010962 3300009147 Bacteria 12912
85 Ga0114129_10044015 3300009147 Bacteria 6281
86 Ga0114129_10119352 3300009147 Bacteria 3632
87 Ga0114129_10144056 3300009147 Bacteria 3265
88 Ga0114129_10586822 3300009147 Bacteria 1445
89 Ga0105243_11135783 3300009148 Unclassified 791
90 Ga0105242_10172670 3300009176 Bacteria 1901
91 Ga0105242_10318869 3300009176 Bacteria 1425
92 Ga0105237_10333741 3300009545 Bacteria 1520
93 Ga0105249_10341276 3300009553 Bacteria 1515
94 Ga0105249_10593494 3300009553 Bacteria 1162
95 Ga0105246_10026258 3300011119 Bacteria 3802
96 Ga0105246_10295242 3300011119 Bacteria 1306
97 Ga0157378_11283973 3300013297 Bacteria 773
98 Ga0163163_10009904 3300014325 Bacteria 8543
99 Ga0163163_10209058 3300014325 Bacteria 2000
100 Ga0157380_10015882 3300014326 Bacteria 5540
101 Ga0157380_10084797 3300014326 Bacteria 2598
102 Ga0157380_10262024 3300014326 Bacteria 1571
103 Ga0157377_10270519 3300014745 Bacteria 1109
104 Ga0157379_10649360 3300014968 Bacteria 988
105 Ga0157376_10071894 3300014969 Bacteria 2941
106 Ga0163161_10176022 3300017792 Bacteria 1638
107 Ga0207653_10000002 3300025885 Bacteria 270513
108 Ga0207688_10023371 3300025901 Bacteria 3385
109 Ga0207643_10000165 3300025908 Bacteria 45606
110 Ga0207643_10122519 3300025908 Bacteria 1541
111 Ga0207643_10137425 3300025908 Bacteria 1458
112 Ga0207684_10004572 3300025910 Bacteria 13003
113 Ga0207684_10201136 3300025910 Bacteria 1718
114 Ga0207662_10073000 3300025918 Bacteria 2081
115 Ga0207649_10031599 3300025920 Bacteria 3148
116 Ga0207646_10148961 3300025922 Bacteria 2110
117 Ga0207646_10155748 3300025922 Bacteria 2061
118 Ga0207681_10662704 3300025923 Unclassified 866
119 Ga0207650_10000934 3300025925 Bacteria 22001
120 Ga0207700_10072637 3300025928 Bacteria 2654
121 Ga0207664_10358187 3300025929 Bacteria 1292
122 Ga0207664_10401677 3300025929 Bacteria 1219
123 Ga0207706_10021573 3300025933 Bacteria 5782
124 Ga0207706_10124039 3300025933 Bacteria 2272
125 Ga0207670_10028701 3300025936 Bacteria 3537
126 Ga0207669_10159623 3300025937 Bacteria 1591
127 Ga0207665_10358362 3300025939 Bacteria 1102
128 Ga0207711_10468210 3300025941 Unclassified 1174
129 Ga0207679_10098477 3300025945 Bacteria 2280
130 Ga0207667_10187303 3300025949 Bacteria 2124
131 Ga0207712_10043640 3300025961 Bacteria 3094
132 Ga0207658_10611557 3300025986 Bacteria 980
133 Ga0207678_10015607 3300026067 Bacteria 6678
134 Ga0207678_10169677 3300026067 Bacteria 1863
135 Ga0207708_10010865 3300026075 Bacteria 6772
136 Ga0207708_10029708 3300026075 Bacteria 4143
137 Ga0207648_10032600 3300026089 Bacteria 4598
138 Ga0207648_10034094 3300026089 Bacteria 4489
139 Ga0207648_10045485 3300026089 Bacteria 3850
140 Ga0207676_10000819 3300026095 Bacteria 24244
141 Ga0207674_10003473 3300026116 Bacteria 19278
142 Ga0207675_100194953 3300026118 Bacteria 1944
143 Ga0207675_100262522 3300026118 Bacteria 1674
144 Ga0209999_1027626 3300027543 Bacteria 1051
145 Ga0210002_1003606 3300027617 Bacteria 2288
146 Ga0209998_10005967 3300027717 Bacteria 2534
147 Ga0209974_10031158 3300027876 Bacteria 1766
148 Ga0207428_10016710 3300027907 Bacteria 6311
149 Ga0207428_10022578 3300027907 Bacteria 5306
150 Ga0207428_10341861 3300027907 Bacteria 1102
151 Ga0268265_10128695 3300028380 Bacteria 2100
152 Ga0268265_10419470 3300028380 Bacteria 1242
153 Ga0268264_10077315 3300028381 Bacteria 2835
154 Ga0265338_10252121 3300028800 Bacteria 1301
155 Ga0265338_10441626 3300028800 Bacteria 922
156 Ga0265324_10108381 3300029957 Bacteria 943
157 Ga0265316_10340453 3300031344 Bacteria 1087
158 Ga0307405_10011754 3300031731 Bacteria 4606
159 Ga0307413_10004935 3300031824 Bacteria 5878
160 Ga0307410_10001118 3300031852 Bacteria 11729
161 Ga0307407_10002155 3300031903 Bacteria 7575
162 Ga0307412_10032780 3300031911 Bacteria 3296
163 Ga0307409_100027456 3300031995 Bacteria 4034
164 Ga0307416_100002705 3300032002 Bacteria 10270
165 Ga0307416_100083438 3300032002 Bacteria 2711
166 Ga0307416_101183554 3300032002 Unclassified 870
167 Ga0307414_10003514 3300032004 Bacteria 8380
168 Ga0307411_10002907 3300032005 Bacteria 7756
169 Ga0307415_100051320 3300032126 Bacteria 2798
170 Ga0373943_0002704 3300035170 Bacteria 8056
171 Ga0395899_0002017 3300037312 Bacteria 16723
172 Ga0395899_0042535 3300037312 Bacteria 3392
173 Ga0395900_0002810 3300037418 Bacteria 19009
174 Ga0395900_0094194 3300037418 Bacteria 3076
175 Ga0395900_0346639 3300037418 Bacteria 1459
176 Ga0395900_0378080 3300037418 Bacteria 1385
177 Ga0395898_0020012 3300037466 Bacteria 6803
178 Ga0395898_0127098 3300037466 Bacteria 2442
179 Ga0395898_0364223 3300037466 Bacteria 1378
180 Ga0395905_0018300 3300037471 Bacteria 6650
181 Ga0395905_0175674 3300037471 Bacteria 2011
182 Ga0395905_0441972 3300037471 Bacteria 1198
183 Ga0395905_0459382 3300037471 Unclassified 1172
184 Ga0395901_0001453 3300038443 Bacteria 24679
185 Ga0395901_0105825 3300038443 Bacteria 2953
186 Ga0395901_0132469 3300038443 Bacteria 2619
187 Ga0395901_0246836 3300038443 Bacteria 1861
188 Ga0395901_0546706 3300038443 Bacteria 1174
189 Ga0439466_0042366 3300041411 Bacteria 1516
190 Ga0439465_0103794 3300041413 Bacteria 983
191 Ga0439465_0139224 3300041413 Bacteria 861
192 Ga0439451_049707 3300042009 Unclassified 840
193 Ga0450920_019349 3300042122 Bacteria 1308
194 Ga0450923_011649 3300042125 Bacteria 1585
195 Ga0450907_007669 3300042146 Bacteria 1799
196 Ga0466969_0004821 3300044656 Bacteria 7183
197 Ga0466966_0030990 3300044684 Bacteria 3469
198 Ga0466961_0098290 3300044693 Bacteria 1845
199 Ga0466963_0002189 3300044694 Bacteria 10808
200 Ga0466963_0004175 3300044694 Bacteria 8362
201 Ga0466963_0015040 3300044694 Bacteria 4784
202 Ga0466964_0009186 3300044706 Bacteria 3719
203 Ga0466964_0082144 3300044706 Bacteria 1385
204 Ga0466968_0006759 3300044735 Bacteria 4337
205 Ga0466970_0000806 3300044765 Bacteria 15112
206 Ga0466957_0013317 3300044842 Bacteria 4771
207 Ga0466957_0051123 3300044842 Bacteria 2515
208 Ga0466960_0010734 3300044901 Bacteria 3812
209 Ga0466959_0176624 3300045049 Bacteria 1495
210 Ga0466958_0001062 3300045836 Bacteria 12591
211 Ga0466958_0151317 3300045836 Unclassified 1464
212 Ga0466967_0012633 3300045976 Bacteria 6476
213 Ga0495629_0032857 3300046459 Bacteria 3671
214 Ga0495582_0291237 3300046473 Bacteria 938
215 Ga0495584_0297895 3300046491 Unclassified 819
216 Ga0495607_0079294 3300046501 Bacteria 1809
217 Ga0495630_0303535 3300046517 Bacteria 1220
218 Ga0495644_0033031 3300046523 Bacteria 1955
219 Ga0495644_0132861 3300046523 Bacteria 949
220 Ga0495642_0078867 3300046528 Bacteria 1384
221 Ga0495642_0083441 3300046528 Bacteria 1348
222 Ga0495654_0224458 3300046530 Unclassified 793
223 Ga0495609_0140421 3300046538 Bacteria 1031
224 Ga0495597_0037961 3300046542 Bacteria 2161
225 Ga0495633_0126942 3300046558 Bacteria 1180
226 Ga0495633_0149087 3300046558 Bacteria 1081
227 Ga0495656_0101920 3300046615 Bacteria 1329
228 Ga0495589_0088882 3300046794 Bacteria 1500
229 Ga0495589_0194068 3300046794 Bacteria 960
230 Ga0495660_0036396 3300046810 Bacteria 2746
231 Ga0495626_0158596 3300048091 Unclassified 950
232 Ga0496101_0023602 3300048904 Bacteria 4251
233 Ga0496101_0030432 3300048904 Bacteria 3785
234 Ga0496103_0141480 3300048906 Bacteria 1539
235 Ga0496105_0200568 3300048908 Unclassified 1629
236 Ga0496107_0105779 3300048910 Bacteria 2066
237 Ga0496109_0016752 3300048912 Bacteria 6413
238 Ga0496109_0052243 3300048912 Bacteria 3724
239 Ga0496114_0059304 3300048917 Bacteria 3197
240 Ga0501031_0002985 3300049568 Bacteria 10829
241 Ga0501031_0015731 3300049568 Bacteria 4910
242 Ga0501031_0291414 3300049568 Bacteria 1058
243 Ga0501032_0061418 3300049569 Bacteria 2519
244 Ga0501032_0064349 3300049569 Bacteria 2455
245 Ga0501032_0113131 3300049569 Bacteria 1795
246 Ga0501033_0013749 3300049570 Bacteria 6156
247 Ga0501033_0094913 3300049570 Bacteria 2180
248 Ga0501033_0518597 3300049570 Unclassified 823
249 Ga0501034_0094468 3300049571 Bacteria 2987
250 Ga0501034_0152507 3300049571 Bacteria 2286
251 Ga0501036_0005126 3300049572 Bacteria 10584
252 Ga0501036_0198628 3300049572 Bacteria 1687
253 Ga0501036_0256996 3300049572 Bacteria 1463
254 Ga0501036_0260542 3300049572 Bacteria 1452
255 Ga0501037_0003569 3300049573 Bacteria 11284
256 Ga0501037_0038643 3300049573 Bacteria 3516
257 Ga0501037_0043501 3300049573 Bacteria 3300
258 Ga0501038_0016532 3300049574 Bacteria 6687
259 Ga0501038_0021456 3300049574 Bacteria 5796
260 Ga0501038_0072963 3300049574 Bacteria 2907
261 Ga0501039_0060912 3300049575 Bacteria 2922
262 Ga0501039_0153434 3300049575 Bacteria 1809
263 Ga0501039_0198479 3300049575 Bacteria 1577
264 Ga0501039_0257946 3300049575 Bacteria 1370
265 Ga0501040_0006444 3300049576 Bacteria 7621
266 Ga0501040_0021154 3300049576 Bacteria 4339
267 Ga0501040_0133526 3300049576 Bacteria 1746
268 Ga0501040_0137516 3300049576 Bacteria 1720
269 Ga0501040_0423042 3300049576 Bacteria 957
270 Ga0501041_0124675 3300049577 Bacteria 1602
271 Ga0501041_0147817 3300049577 Bacteria 1466
272 Ga0501041_0277359 3300049577 Bacteria 1055
273 Ga0501042_0035333 3300049578 Bacteria 3545
274 Ga0501042_0160390 3300049578 Bacteria 1622
275 Ga0501042_0320679 3300049578 Bacteria 1119
276 Ga0501043_0004360 3300049579 Bacteria 11514
277 Ga0501043_0092535 3300049579 Bacteria 2377
278 Ga0501043_0580926 3300049579 Bacteria 829
279 Ga0501046_0040629 3300049580 Bacteria 3715
280 Ga0501048_0050456 3300049582 Bacteria 2963
281 Ga0501048_0168167 3300049582 Bacteria 1552
282 Ga0501048_0409556 3300049582 Bacteria 969
283 Ga0501067_0010138 3300049583 Bacteria 5211
284 Ga0501067_0023006 3300049583 Bacteria 3451
285 Ga0501068_0003054 3300049584 Bacteria 8935
286 Ga0501068_0006503 3300049584 Bacteria 6447
287 Ga0501069_0042474 3300049585 Bacteria 2515
288 Ga0501069_0054688 3300049585 Bacteria 2222
289 Ga0501070_0078139 3300049586 Bacteria 2739
290 Ga0501070_0133217 3300049586 Bacteria 2052
291 Ga0501070_0173627 3300049586 Bacteria 1775
292 Ga0501071_0077217 3300049587 Bacteria 2432
293 Ga0501071_0112733 3300049587 Bacteria 2011
294 Ga0501071_0147235 3300049587 Bacteria 1755
295 Ga0501071_0226049 3300049587 Bacteria 1409
296 Ga0501072_0004018 3300049588 Bacteria 11129
297 Ga0501072_0045058 3300049588 Bacteria 3467
298 Ga0501072_0298012 3300049588 Bacteria 1282
299 Ga0501072_0342382 3300049588 Bacteria 1187
300 Ga0501072_0586156 3300049588 Archaea 879
301 Ga0501073_0001568 3300049589 Bacteria 16944
302 Ga0501073_0051037 3300049589 Bacteria 2898
303 Ga0501073_0128520 3300049589 Unclassified 1756
304 Ga0501074_0015182 3300049590 Bacteria 5599
305 Ga0501074_0159014 3300049590 Bacteria 1613
306 Ga0501075_0023592 3300049591 Bacteria 4506
307 Ga0501075_0173135 3300049591 Bacteria 1647
308 Ga0501075_0353165 3300049591 Bacteria 1120
309 Ga0501075_0536416 3300049591 Unclassified 893
310 Ga0501075_0638374 3300049591 Bacteria 812
311 Ga0501076_0008741 3300049592 Bacteria 7439
312 Ga0501076_0215986 3300049592 Bacteria 1567
313 Ga0501076_0238757 3300049592 Bacteria 1486
314 Ga0501076_0291263 3300049592 Bacteria 1337
315 Ga0501076_0357802 3300049592 Bacteria 1199
316 Ga0501077_0020316 3300049593 Bacteria 4203
317 Ga0501077_0028662 3300049593 Bacteria 3539
318 Ga0501077_0158969 3300049593 Bacteria 1434
319 Ga0501077_0196188 3300049593 Bacteria 1282
320 Ga0501079_0036553 3300049741 Bacteria 3783
321 Ga0501079_0113019 3300049741 Bacteria 2111
322 Ga0501079_0191599 3300049741 Bacteria 1596
323 Ga0501080_0004954 3300049742 Bacteria 11863
324 Ga0501081_0004679 3300049743 Bacteria 8796
325 Ga0501081_0008906 3300049743 Bacteria 6519
326 Ga0501081_0136252 3300049743 Bacteria 1757
327 Ga0501081_0161683 3300049743 Bacteria 1614
328 Ga0501081_0356842 3300049743 Unclassified 1078
329 Ga0501083_0022959 3300049744 Bacteria 4329
330 Ga0501083_0034497 3300049744 Bacteria 3460
331 Ga0501035_0230783 3300049822 Bacteria 1577
332 Ga0501035_0620226 3300049822 Archaea 879
333 Ga0501044_0174607 3300049823 Bacteria 2118
334 nmdc:mga0yw44_561_c1 3300050492 Bacteria 13429
335 nmdc:mga0yw44_564_c1 3300050492 Bacteria 10112
336 nmdc:mga05p37_1028346_c1 3300050507 Bacteria 872
337 nmdc:mga05p37_1125275_c1 3300050507 Bacteria 820
338 nmdc:mga05p37_27237_c1 3300050507 Bacteria 6959
339 nmdc:mga05p37_28744_c1 3300050507 Bacteria 6782
340 nmdc:mga09592_123_c1 3300050508 Bacteria 49420
341 nmdc:mga09592_39036_c1 3300050508 Bacteria 3988
342 nmdc:mga0qj67_18491_c1 3300050509 Bacteria 5311
343 nmdc:mga0qj67_53753_c1 3300050509 Bacteria 3189
344 nmdc:mga06r32_22690_c1 3300050510 Bacteria 5805
345 nmdc:mga06r32_2931_c1 3300050510 Bacteria 15301
346 nmdc:mga0n895_242121_c1 3300050512 Bacteria 1831
347 nmdc:mga0n895_294498_c1 3300050512 Bacteria 1645
348 nmdc:mga0n895_297195_c1 3300050512 Bacteria 1637
349 nmdc:mga0n895_65392_c1 3300050512 Bacteria 3600
350 nmdc:mga0n895_8302_c1 3300050512 Bacteria 8983
351 nmdc:mga0rr50_3964_c1 3300050513 Bacteria 8615
352 nmdc:mga08x19_306039_c1 3300050514 Bacteria 1104
353 nmdc:mga08x19_46442_c1 3300050514 Bacteria 2777
354 nmdc:mga0a205_242862_c1 3300050515 Bacteria 1682
355 nmdc:mga0a205_257_c1 3300050515 Bacteria 38119
356 nmdc:mga0a205_28758_c1 3300050515 Bacteria 5316
357 Ga0495595_0100379 3300053084 Bacteria 1396
358 Ga0501084_0068593 3300054114 Bacteria 2968
359 Ga0501084_0106400 3300054114 Bacteria 2357
360 Ga0501084_0114248 3300054114 Bacteria 2270
361 Ga0501082_0005849 3300060353 Bacteria 10677
362 Ga0501082_0027993 3300060353 Bacteria 4854
363 Ga0501082_0063465 3300060353 Bacteria 3180
364 Ga0501082_0289732 3300060353 Bacteria 1425
365 Ga0501082_0407907 3300060353 Unclassified 1186
366 Ga0530510_0000674 3300061734 Bacteria 21978
367 Ga0530510_0011756 3300061734 Bacteria 6142
368 Ga0530510_0091249 3300061734 Bacteria 2222
369 Ga0530510_0240530 3300061734 Bacteria 1347
370 Ga0530510_0406548 3300061734 Unclassified 1027
371 Ga0530510_0429863 3300061734 Unclassified 997
372 Ga0530510_0492739 3300061734 Bacteria 929
373 Ga0114129_11206493
374 Ga0070658_10113209
375 Ga0070690_100140203
376 Ga0068869_100291593
377 Ga0070660_100337101
378 Ga0070689_100104102
379 Ga0070675_100029849
380 Ga0070674_100065659
381 Ga0070714_100001730
382 Ga0070714_100215166
383 Ga0070714_100381538
384 Ga0070714_100522658
385 Ga0070713_100113583
386 Ga0070713_100305881
387 Ga0070700_100047961
388 Ga0070700_100159402
389 Ga0070694_100114540
390 Ga0070663_100793590
391 Ga0070662_100727243
392 Ga0070681_10105988
393 Ga0068867_100204362
394 Ga0070706_100007978
395 Ga0070707_100001128
396 Ga0070707_100086279
397 Ga0070707_100164840
398 Ga0070698_100043679
399 Ga0070698_100068436
400 Ga0070699_100009078
401 Ga0070699_100233378
402 Ga0070679_100106238
403 Ga0070684_100041518
404 Ga0070672_100646780
405 Ga0070695_100149867
406 Ga0070696_100088122
407 Ga0070693_100386251
408 Ga0068855_100017296
409 Ga0070664_100001508
410 Ga0068857_100069957
411 Ga0068859_100748895
412 Ga0068864_100029523
413 Ga0068870_10000109
414 Ga0068870_10214847
415 Ga0068863_100020090
416 Ga0068860_100151398
417 Ga0081455_10120143
418 Ga0081538_10000338
419 Ga0081538_10068178
420 Ga0081539_10041618
421 Ga0075365_10000816
422 Ga0075365_10001060
423 Ga0075365_10029252
424 Ga0075364_10005047
425 Ga0075364_10005988
426 Ga0070712_100773328
427 Ga0075428_100022036
428 Ga0075428_100065647
429 Ga0075428_100065837
430 Ga0075428_100315439
431 Ga0075430_100619911
432 Ga0075431_100002236
433 Ga0075431_100428393
434 Ga0075431_100658170
435 Ga0075433_10005239
436 Ga0075433_10008880
437 Ga0075433_10047546
438 Ga0075434_100001608
439 Ga0075434_100069872
440 Ga0075434_100073823
441 Ga0075434_100161451
442 Ga0075429_100000031
443 Ga0075429_100115135
444 Ga0075429_100499552
445 Ga0075436_100014801
446 Ga0075436_100396762
447 Ga0097620_100748902
448 Ga0075435_100000610
449 Ga0075435_100067860
450 Ga0105251_10015570
451 Ga0111539_10044650
452 Ga0111539_10109187
453 Ga0111539_10407306
454 Ga0111539_10427710
455 Ga0105245_10040820
456 Ga0114129_10010962
457 Ga0114129_10044015
458 Ga0114129_10119352
459 Ga0114129_10144056
460 Ga0114129_10586822
461 Ga0105243_11135783
462 Ga0105242_10172670
463 Ga0105242_10318869
464 Ga0105237_10333741
465 Ga0105249_10341276
466 Ga0105249_10593494
467 Ga0105246_10026258
468 Ga0105246_10295242
469 Ga0157378_11283973
470 Ga0163163_10009904
471 Ga0163163_10209058
472 Ga0157380_10015882
473 Ga0157380_10084797
474 Ga0157380_10262024
475 Ga0157377_10270519
476 Ga0157379_10649360
477 Ga0157376_10071894
478 Ga0163161_10176022
479 Ga0207653_10000002
480 Ga0207688_10023371
481 Ga0207643_10000165
482 Ga0207643_10122519
483 Ga0207643_10137425
484 Ga0207684_10004572
485 Ga0207684_10201136
486 Ga0207662_10073000
487 Ga0207649_10031599
488 Ga0207646_10148961
489 Ga0207646_10155748
490 Ga0207681_10662704
491 Ga0207650_10000934
492 Ga0207700_10072637
493 Ga0207664_10358187
494 Ga0207664_10401677
495 Ga0207706_10021573
496 Ga0207706_10124039
497 Ga0207670_10028701
498 Ga0207669_10159623
499 Ga0207665_10358362
500 Ga0207711_10468210
501 Ga0207679_10098477
502 Ga0207667_10187303
503 Ga0207712_10043640
504 Ga0207658_10611557
505 Ga0207678_10015607
506 Ga0207678_10169677
507 Ga0207708_10010865
508 Ga0207708_10029708
509 Ga0207648_10032600
510 Ga0207648_10034094
511 Ga0207648_10045485
512 Ga0207676_10000819
513 Ga0207674_10003473
514 Ga0207675_100194953
515 Ga0207675_100262522
516 Ga0209999_1027626
517 Ga0210002_1003606
518 Ga0209998_10005967
519 Ga0209974_10031158
520 Ga0207428_10016710
521 Ga0207428_10022578
522 Ga0207428_10341861
523 Ga0268265_10128695
524 Ga0268265_10419470
525 Ga0268264_10077315
526 Ga0265338_10252121
527 Ga0265338_10441626
528 Ga0265324_10108381
529 Ga0265316_10340453
530 Ga0307405_10011754
531 Ga0307413_10004935
532 Ga0307410_10001118
533 Ga0307407_10002155
534 Ga0307412_10032780
535 Ga0307409_100027456
536 Ga0307416_100002705
537 Ga0307416_100083438
538 Ga0307416_101183554
539 Ga0307414_10003514
540 Ga0307411_10002907
541 Ga0307415_100051320
542 Ga0373943_0002704
543 Ga0395899_0002017
544 Ga0395899_0042535
545 Ga0395900_0002810
546 Ga0395900_0094194
547 Ga0395900_0346639
548 Ga0395900_0378080
549 Ga0395898_0020012
550 Ga0395898_0127098
551 Ga0395898_0364223
552 Ga0395905_0018300
553 Ga0395905_0175674
554 Ga0395905_0441972
555 Ga0395905_0459382
556 Ga0395901_0001453
557 Ga0395901_0105825
558 Ga0395901_0132469
559 Ga0395901_0246836
560 Ga0395901_0546706
561 Ga0439466_0042366
562 Ga0439465_0103794
563 Ga0439465_0139224
564 Ga0439451_049707
565 Ga0450920_019349
566 Ga0450923_011649
567 Ga0450907_007669
568 Ga0466969_0004821
569 Ga0466966_0030990
570 Ga0466961_0098290
571 Ga0466963_0002189
572 Ga0466963_0004175
573 Ga0466963_0015040
574 Ga0466964_0009186
575 Ga0466964_0082144
576 Ga0466968_0006759
577 Ga0466970_0000806
578 Ga0466957_0013317
579 Ga0466957_0051123
580 Ga0466960_0010734
581 Ga0466959_0176624
582 Ga0466958_0001062
583 Ga0466958_0151317
584 Ga0466967_0012633
585 Ga0495629_0032857
586 Ga0495582_0291237
587 Ga0495584_0297895
588 Ga0495607_0079294
589 Ga0495630_0303535
590 Ga0495644_0033031
591 Ga0495644_0132861
592 Ga0495642_0078867
593 Ga0495642_0083441
594 Ga0495654_0224458
595 Ga0495609_0140421
596 Ga0495597_0037961
597 Ga0495633_0126942
598 Ga0495633_0149087
599 Ga0495656_0101920
600 Ga0495589_0088882
601 Ga0495589_0194068
602 Ga0495660_0036396
603 Ga0495626_0158596
604 Ga0496101_0023602
605 Ga0496101_0030432
606 Ga0496103_0141480
607 Ga0496105_0200568
608 Ga0496107_0105779
609 Ga0496109_0016752
610 Ga0496109_0052243
611 Ga0496114_0059304
612 Ga0501031_0002985
613 Ga0501031_0015731
614 Ga0501031_0291414
615 Ga0501032_0061418
616 Ga0501032_0064349
617 Ga0501032_0113131
618 Ga0501033_0013749
619 Ga0501033_0094913
620 Ga0501033_0518597
621 Ga0501034_0094468
622 Ga0501034_0152507
623 Ga0501036_0005126
624 Ga0501036_0198628
625 Ga0501036_0256996
626 Ga0501036_0260542
627 Ga0501037_0003569
628 Ga0501037_0038643
629 Ga0501037_0043501
630 Ga0501038_0016532
631 Ga0501038_0021456
632 Ga0501038_0072963
633 Ga0501039_0060912
634 Ga0501039_0153434
635 Ga0501039_0198479
636 Ga0501039_0257946
637 Ga0501040_0006444
638 Ga0501040_0021154
639 Ga0501040_0133526
640 Ga0501040_0137516
641 Ga0501040_0423042
642 Ga0501041_0124675
643 Ga0501041_0147817
644 Ga0501041_0277359
645 Ga0501042_0035333
646 Ga0501042_0160390
647 Ga0501042_0320679
648 Ga0501043_0004360
649 Ga0501043_0092535
650 Ga0501043_0580926
651 Ga0501046_0040629
652 Ga0501048_0050456
653 Ga0501048_0168167
654 Ga0501048_0409556
655 Ga0501067_0010138
656 Ga0501067_0023006
657 Ga0501068_0003054
658 Ga0501068_0006503
659 Ga0501069_0042474
660 Ga0501069_0054688
661 Ga0501070_0078139
662 Ga0501070_0133217
663 Ga0501070_0173627
664 Ga0501071_0077217
665 Ga0501071_0112733
666 Ga0501071_0147235
667 Ga0501071_0226049
668 Ga0501072_0004018
669 Ga0501072_0045058
670 Ga0501072_0298012
671 Ga0501072_0342382
672 Ga0501072_0586156
673 Ga0501073_0001568
674 Ga0501073_0051037
675 Ga0501073_0128520
676 Ga0501074_0015182
677 Ga0501074_0159014
678 Ga0501075_0023592
679 Ga0501075_0173135
680 Ga0501075_0353165
681 Ga0501075_0536416
682 Ga0501075_0638374
683 Ga0501076_0008741
684 Ga0501076_0215986
685 Ga0501076_0238757
686 Ga0501076_0291263
687 Ga0501076_0357802
688 Ga0501077_0020316
689 Ga0501077_0028662
690 Ga0501077_0158969
691 Ga0501077_0196188
692 Ga0501079_0036553
693 Ga0501079_0113019
694 Ga0501079_0191599
695 Ga0501080_0004954
696 Ga0501081_0004679
697 Ga0501081_0008906
698 Ga0501081_0136252
699 Ga0501081_0161683
700 Ga0501081_0356842
701 Ga0501083_0022959
702 Ga0501083_0034497
703 Ga0501035_0230783
704 Ga0501035_0620226
705 Ga0501044_0174607
706 nmdc:mga0yw44_561_c1
707 nmdc:mga0yw44_564_c1
708 nmdc:mga05p37_1028346_c1
709 nmdc:mga05p37_1125275_c1
710 nmdc:mga05p37_27237_c1
711 nmdc:mga05p37_28744_c1
712 nmdc:mga09592_123_c1
713 nmdc:mga09592_39036_c1
714 nmdc:mga0qj67_18491_c1
715 nmdc:mga0qj67_53753_c1
716 nmdc:mga06r32_22690_c1
717 nmdc:mga06r32_2931_c1
718 nmdc:mga0n895_242121_c1
719 nmdc:mga0n895_294498_c1
720 nmdc:mga0n895_297195_c1
721 nmdc:mga0n895_65392_c1
722 nmdc:mga0n895_8302_c1
723 nmdc:mga0rr50_3964_c1
724 nmdc:mga08x19_306039_c1
725 nmdc:mga08x19_46442_c1
726 nmdc:mga0a205_242862_c1
727 nmdc:mga0a205_257_c1
728 nmdc:mga0a205_28758_c1
729 Ga0495595_0100379
730 Ga0501084_0068593
731 Ga0501084_0106400
732 Ga0501084_0114248
733 Ga0501082_0005849
734 Ga0501082_0027993
735 Ga0501082_0063465
736 Ga0501082_0289732
737 Ga0501082_0407907
738 Ga0530510_0000674
739 Ga0530510_0011756
740 Ga0530510_0091249
741 Ga0530510_0240530
742 Ga0530510_0406548
743 Ga0530510_0429863
744 Ga0530510_0492739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

101

208

0.96

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

21

233

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.8753 1 207
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.8746 1 207
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.8721 3 209
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.8692 3 207
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.863 2 207
ID Description Score Start End Superfamily
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8992 84 183 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.89 1 207 3.40.50.1000
3i76A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8872 92 209 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8861 83 204 3.40.50.1000
3vayB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8802 1 210 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A534RM55-F1-model_v4 HAD family hydrolase 0.9858 91 214 GO:0016787
AF-A0A7W1N5E1-F1-model_v4 HAD-IA family hydrolase 0.9845 1 214 GO:0016787
AF-A0A7Y5U6K6-F1-model_v4 HAD hydrolase-like protein 0.9825 1 161 GO:0016787
AF-A0A7W1N5E1-F1-model_v4 HAD-IA family hydrolase 0.98 1 214 GO:0016787
AF-A0A7V9DGQ6-F1-model_v4 GNAT family N-acetyltransferase 0.9774 2 214 GO:0016747

Map