F426022

General Info

Members Datasets Scaffolds Average Seq Length
372 235 744 167

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10051550|Ga0099794_100515502
Length 197
Sequence MELEAADVQQAVVHGGDRISLTPGVPFATRASMANPLVGIIMGSKTDLEVLNGAVEVLKEFGVAHEVRVLSAHRTPEQVLEWSATAESRGLEVLIAGAGGAAHLPGVVAAKTVLPVLGVPVPSTTLGGADALLSIVQMPKGIPVGTLAIGKPGAANAALLAIAILAAKRPELREKLRAWRKSRAEEVIKTDKSVSGS

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.27
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 6.99
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10051550 3300007265 Bacteria 1981
2 CNBas_1001622 3300000531 Bacteria 1199
3 JGI24735J21928_10076836 3300002067 Bacteria 956
4 Ga0070683_100028081 3300005329 Bacteria 5081
5 Ga0070690_100133146 3300005330 Bacteria 1681
6 Ga0070670_100041096 3300005331 Bacteria 3974
7 Ga0070666_10001276 3300005335 Bacteria 15248
8 Ga0070680_100038810 3300005336 Bacteria 3852
9 Ga0070680_100043321 3300005336 Bacteria 3656
10 Ga0070680_100094464 3300005336 Bacteria 2479
11 Ga0068868_100029091 3300005338 Bacteria 4231
12 Ga0070668_100028295 3300005347 Bacteria 4255
13 Ga0070668_100068340 3300005347 Bacteria 2762
14 Ga0070675_100236229 3300005354 Bacteria 1596
15 Ga0070671_100003159 3300005355 Bacteria 12840
16 Ga0070671_100010170 3300005355 Bacteria 7551
17 Ga0070674_100017197 3300005356 Bacteria 4544
18 Ga0070674_100062204 3300005356 Bacteria 2608
19 Ga0070674_101376882 3300005356 Bacteria 631
20 Ga0070688_100037156 3300005365 Bacteria 2966
21 Ga0070688_100283189 3300005365 Bacteria 1192
22 Ga0070667_100007800 3300005367 Bacteria 8875
23 Ga0070667_100266473 3300005367 Bacteria 1535
24 Ga0070709_10273363 3300005434 Bacteria 1225
25 Ga0070714_100019970 3300005435 Bacteria 5466
26 Ga0070714_100035047 3300005435 Bacteria 4204
27 Ga0070714_100067489 3300005435 Bacteria 3084
28 Ga0070714_100122686 3300005435 Bacteria 2313
29 Ga0070714_100184566 3300005435 Bacteria 1900
30 Ga0070713_100000635 3300005436 Bacteria 22421
31 Ga0070713_100776939 3300005436 Viruses 917
32 Ga0070710_10002289 3300005437 Bacteria 9055
33 Ga0070711_100001699 3300005439 Bacteria 12200
34 Ga0070708_100002132 3300005445 Bacteria 15288
35 Ga0070708_100136568 3300005445 Bacteria 2272
36 Ga0070708_100423264 3300005445 Bacteria 1256
37 Ga0070663_100099508 3300005455 Bacteria 2168
38 Ga0070678_100015153 3300005456 Bacteria 4890
39 Ga0070662_100027616 3300005457 Bacteria 3942
40 Ga0070662_100225119 3300005457 Bacteria 1498
41 Ga0070681_10007685 3300005458 Bacteria 10540
42 Ga0070681_10012127 3300005458 Bacteria 8549
43 Ga0070681_10068555 3300005458 Bacteria 3513
44 Ga0070681_10077628 3300005458 Bacteria 3278
45 Ga0070681_10230748 3300005458 Bacteria 1765
46 Ga0068867_100290516 3300005459 Bacteria 1344
47 Ga0068867_100654614 3300005459 Bacteria 922
48 Ga0070706_100115084 3300005467 Bacteria 2504
49 Ga0070706_100166966 3300005467 Bacteria 2055
50 Ga0070699_100030298 3300005518 Bacteria 4669
51 Ga0070699_100085319 3300005518 Bacteria 2756
52 Ga0070679_100003017 3300005530 Bacteria 15370
53 Ga0070679_100014619 3300005530 Bacteria 7544
54 Ga0070679_100272210 3300005530 Bacteria 1647
55 Ga0070679_101489669 3300005530 Bacteria 623
56 Ga0070684_100508882 3300005535 Bacteria 1116
57 Ga0070697_100003653 3300005536 Bacteria 11826
58 Ga0070697_100110682 3300005536 Bacteria 2288
59 Ga0070697_100306884 3300005536 Bacteria 1365
60 Ga0068853_100008355 3300005539 Bacteria 8311
61 Ga0070672_100020064 3300005543 Bacteria 4869
62 Ga0070672_100396648 3300005543 Bacteria 1182
63 Ga0070686_100816605 3300005544 Bacteria 753
64 Ga0070695_100540304 3300005545 Bacteria 907
65 Ga0070693_100011965 3300005547 Bacteria 4380
66 Ga0070693_100059145 3300005547 Bacteria 2220
67 Ga0070665_100009634 3300005548 Bacteria 9770
68 Ga0070704_100226662 3300005549 Bacteria 1522
69 Ga0068855_100013537 3300005563 Bacteria 9837
70 Ga0068854_100838604 3300005578 Bacteria 804
71 Ga0068856_100043832 3300005614 Bacteria 4401
72 Ga0068856_100301988 3300005614 Bacteria 1619
73 Ga0068852_100055927 3300005616 Bacteria 3407
74 Ga0068852_101773914 3300005616 Bacteria 639
75 Ga0068852_101885936 3300005616 Bacteria 620
76 Ga0068866_10004329 3300005718 Bacteria 5832
77 Ga0068851_10050233 3300005834 Bacteria 2117
78 Ga0068851_10177534 3300005834 Unclassified 1178
79 Ga0068863_100003149 3300005841 Bacteria 16287
80 Ga0068863_100022478 3300005841 Bacteria 6022
81 Ga0068858_100024395 3300005842 Bacteria 5635
82 Ga0068858_100124356 3300005842 Bacteria 2414
83 Ga0068858_100875683 3300005842 Bacteria 878
84 Ga0068860_100044695 3300005843 Bacteria 4221
85 Ga0068862_100042469 3300005844 Bacteria 3873
86 Ga0081539_10000059 3300005985 Bacteria 254888
87 Ga0070717_10947740 3300006028 Bacteria 784
88 Ga0070715_10000744 3300006163 Bacteria 8785
89 Ga0070716_100007500 3300006173 Bacteria 5375
90 Ga0070716_100024869 3300006173 Bacteria 3189
91 Ga0070716_100683921 3300006173 Bacteria 782
92 Ga0070712_100002312 3300006175 Bacteria 11742
93 Ga0070712_100809282 3300006175 Bacteria 804
94 Ga0070712_101247171 3300006175 Bacteria 647
95 Ga0097621_100001749 3300006237 Bacteria 14875
96 Ga0068871_100009936 3300006358 Bacteria 6911
97 Ga0068871_100422367 3300006358 Bacteria 1191
98 Ga0075428_100156167 3300006844 Bacteria 2478
99 Ga0075434_100695836 3300006871 Bacteria 1034
100 Ga0075429_100492513 3300006880 Bacteria 1074
101 Ga0068865_100007959 3300006881 Bacteria 6545
102 Ga0075436_100014674 3300006914 Bacteria 5371
103 Ga0075436_100026831 3300006914 Bacteria 3966
104 Ga0075436_100058118 3300006914 Bacteria 2671
105 Ga0099794_10012557 3300007265 Bacteria 3659
106 Ga0105251_10368080 3300009011 Bacteria 657
107 Ga0105240_10555364 3300009093 Bacteria 1270
108 Ga0111539_10186901 3300009094 Bacteria 2419
109 Ga0111539_10935081 3300009094 Unclassified 1008
110 Ga0105245_10088733 3300009098 Bacteria 2841
111 Ga0105245_10699902 3300009098 Bacteria 1046
112 Ga0114129_10422561 3300009147 Bacteria 1753
113 Ga0114129_10747097 3300009147 Bacteria 1253
114 Ga0105243_10590005 3300009148 Bacteria 1068
115 Ga0105242_10025115 3300009176 Bacteria 4711
116 Ga0105242_11918844 3300009176 Bacteria 633
117 Ga0105248_10014619 3300009177 Bacteria 8637
118 Ga0105248_10056875 3300009177 Bacteria 4389
119 Ga0105248_11424217 3300009177 Bacteria 784
120 Ga0105237_10100205 3300009545 Bacteria 2888
121 Ga0105238_10766787 3300009551 Bacteria 979
122 Ga0105249_10587930 3300009553 Bacteria 1167
123 Ga0099796_10155688 3300010159 Bacteria 902
124 Ga0099796_10312561 3300010159 Bacteria 668
125 Ga0105239_10062160 3300010375 Bacteria 4099
126 Ga0157370_10061168 3300013104 Bacteria 3574
127 Ga0157370_10239953 3300013104 Bacteria 1677
128 Ga0157370_10681597 3300013104 Bacteria 939
129 Ga0157374_10001720 3300013296 Bacteria 18374
130 Ga0157374_11258688 3300013296 Bacteria 761
131 Ga0157378_10003340 3300013297 Bacteria 14274
132 Ga0157378_10902288 3300013297 Bacteria 914
133 Ga0163162_10039381 3300013306 Bacteria 4722
134 Ga0163162_10275566 3300013306 Bacteria 1814
135 Ga0163162_10495959 3300013306 Bacteria 1352
136 Ga0157372_10082654 3300013307 Bacteria 3637
137 Ga0157372_10354698 3300013307 Bacteria 1709
138 Ga0157372_10854734 3300013307 Bacteria 1056
139 Ga0157372_11051401 3300013307 Bacteria 942
140 Ga0157372_11167383 3300013307 Bacteria 890
141 Ga0157375_10078772 3300013308 Bacteria 3329
142 Ga0157375_10272283 3300013308 Bacteria 1855
143 Ga0157375_10653651 3300013308 Bacteria 1207
144 Ga0157375_10870546 3300013308 Bacteria 1046
145 Ga0157375_11084095 3300013308 Unclassified 937
146 Ga0163163_10211430 3300014325 Bacteria 1989
147 Ga0157377_10316346 3300014745 Bacteria 1035
148 Ga0157379_10020021 3300014968 Bacteria 5913
149 Ga0157376_10018740 3300014969 Bacteria 5317
150 Ga0157376_10727657 3300014969 Bacteria 999
151 Ga0206356_10233177 3300020070 Bacteria 2712
152 Ga0207656_10171709 3300025321 Bacteria 1037
153 Ga0207692_10061618 3300025898 Bacteria 1945
154 Ga0207692_10270009 3300025898 Bacteria 1025
155 Ga0207642_10103641 3300025899 Bacteria 1434
156 Ga0207685_10001064 3300025905 Bacteria 5398
157 Ga0207699_10028225 3300025906 Bacteria 3117
158 Ga0207699_10237463 3300025906 Bacteria 1251
159 Ga0207645_10666203 3300025907 Bacteria 707
160 Ga0207705_10000770 3300025909 Bacteria 26381
161 Ga0207705_10213052 3300025909 Bacteria 1466
162 Ga0207705_11158137 3300025909 Bacteria 594
163 Ga0207684_10136127 3300025910 Bacteria 2109
164 Ga0207707_10015444 3300025912 Bacteria 6652
165 Ga0207707_10041419 3300025912 Bacteria 4022
166 Ga0207707_10124694 3300025912 Bacteria 2252
167 Ga0207707_10234738 3300025912 Bacteria 1595
168 Ga0207707_10318433 3300025912 Bacteria 1343
169 Ga0207707_10536992 3300025912 Bacteria 995
170 Ga0207695_10014979 3300025913 Bacteria 9150
171 Ga0207671_10060944 3300025914 Bacteria 2799
172 Ga0207693_10000503 3300025915 Bacteria 35359
173 Ga0207663_10007591 3300025916 Bacteria 5631
174 Ga0207660_10008926 3300025917 Bacteria 6486
175 Ga0207660_10075460 3300025917 Bacteria 2463
176 Ga0207662_10093184 3300025918 Bacteria 1856
177 Ga0207662_10129412 3300025918 Bacteria 1590
178 Ga0207657_10006291 3300025919 Bacteria 12341
179 Ga0207657_10216725 3300025919 Bacteria 1535
180 Ga0207652_10006595 3300025921 Bacteria 9358
181 Ga0207652_10305655 3300025921 Bacteria 1435
182 Ga0207652_10424694 3300025921 Bacteria 1199
183 Ga0207652_11315191 3300025921 Bacteria 626
184 Ga0207694_10044111 3300025924 Bacteria 3443
185 Ga0207694_10638332 3300025924 Bacteria 897
186 Ga0207650_10163814 3300025925 Bacteria 1763
187 Ga0207659_10072727 3300025926 Bacteria 2515
188 Ga0207687_10056672 3300025927 Bacteria 2750
189 Ga0207687_10093664 3300025927 Bacteria 2197
190 Ga0207700_10021050 3300025928 Bacteria 4445
191 Ga0207700_10681892 3300025928 Viruses 917
192 Ga0207664_10015280 3300025929 Bacteria 5566
193 Ga0207664_10031584 3300025929 Bacteria 4053
194 Ga0207664_10118231 3300025929 Bacteria 2214
195 Ga0207664_10129638 3300025929 Bacteria 2122
196 Ga0207664_10394679 3300025929 Bacteria 1230
197 Ga0207644_10012228 3300025931 Bacteria 5697
198 Ga0207644_10076020 3300025931 Bacteria 2469
199 Ga0207644_10568326 3300025931 Bacteria 940
200 Ga0207706_10085114 3300025933 Bacteria 2780
201 Ga0207706_10087042 3300025933 Bacteria 2746
202 Ga0207706_10145876 3300025933 Bacteria 2082
203 Ga0207686_10121441 3300025934 Bacteria 1779
204 Ga0207669_10236274 3300025937 Bacteria 1352
205 Ga0207669_10633755 3300025937 Bacteria 872
206 Ga0207704_10016423 3300025938 Bacteria 3804
207 Ga0207665_10001006 3300025939 Bacteria 19021
208 Ga0207665_10046434 3300025939 Bacteria 2910
209 Ga0207665_10602529 3300025939 Bacteria 858
210 Ga0207691_10021767 3300025940 Bacteria 6052
211 Ga0207711_10031097 3300025941 Bacteria 4505
212 Ga0207711_10097964 3300025941 Bacteria 2590
213 Ga0207711_10133425 3300025941 Bacteria 2228
214 Ga0207661_10026611 3300025944 Bacteria 4410
215 Ga0207661_10057978 3300025944 Bacteria 3116
216 Ga0207661_10250498 3300025944 Bacteria 1574
217 Ga0207667_10332618 3300025949 Bacteria 1551
218 Ga0207667_10396048 3300025949 Bacteria 1406
219 Ga0207667_10508360 3300025949 Bacteria 1221
220 Ga0207667_10876028 3300025949 Bacteria 891
221 Ga0207651_10355976 3300025960 Bacteria 1234
222 Ga0207712_10000190 3300025961 Bacteria 63029
223 Ga0207712_10314496 3300025961 Bacteria 1290
224 Ga0207677_10049487 3300026023 Bacteria 2836
225 Ga0207703_10009142 3300026035 Bacteria 7800
226 Ga0207639_10052291 3300026041 Bacteria 3112
227 Ga0207639_10539466 3300026041 Bacteria 1070
228 Ga0207678_10021557 3300026067 Bacteria 5650
229 Ga0207708_10128183 3300026075 Bacteria 1982
230 Ga0207708_10201204 3300026075 Bacteria 1589
231 Ga0207708_10236127 3300026075 Bacteria 1469
232 Ga0207702_10081335 3300026078 Bacteria 2813
233 Ga0207702_10242449 3300026078 Bacteria 1689
234 Ga0207641_10000693 3300026088 Bacteria 36308
235 Ga0207641_10090025 3300026088 Bacteria 2682
236 Ga0207648_10264874 3300026089 Bacteria 1534
237 Ga0207675_100515479 3300026118 Bacteria 1192
238 Ga0207683_10004435 3300026121 Bacteria 12129
239 Ga0207683_10349944 3300026121 Bacteria 1356
240 Ga0207698_10258889 3300026142 Bacteria 1597
241 Ga0207698_10312044 3300026142 Bacteria 1469
242 Ga0209588_1006511 3300027671 Bacteria 3398
243 Ga0207428_10032403 3300027907 Bacteria 4299
244 Ga0268265_10054766 3300028380 Bacteria 3028
245 Ga0268264_10074138 3300028381 Bacteria 2890
246 Ga0265337_1049545 3300028556 Bacteria 1186
247 Ga0265319_1077907 3300028563 Bacteria 1055
248 Ga0265318_10000728 3300028577 Bacteria 22064
249 Ga0265325_10002986 3300031241 Bacteria 11225
250 Ga0265329_10044941 3300031242 Bacteria 1412
251 Ga0265316_10000955 3300031344 Bacteria 31522
252 Ga0265313_10000972 3300031595 Bacteria 28338
253 Ga0307412_10013803 3300031911 Bacteria 4747
254 Ga0307412_10755201 3300031911 Bacteria 840
255 Ga0307409_100038451 3300031995 Bacteria 3540
256 Ga0307416_100483236 3300032002 Bacteria 1299
257 Ga0307414_10649350 3300032004 Bacteria 951
258 Ga0307411_10145306 3300032005 Bacteria 1755
259 Ga0307415_100234519 3300032126 Bacteria 1480
260 Ga0373923_0075340 3300035111 Bacteria 1456
261 Ga0373954_0036801 3300035118 Bacteria 2273
262 Ga0373946_0495293 3300035171 Bacteria 626
263 Ga0373955_0217069 3300035172 Bacteria 1141
264 Ga0373931_0300996 3300035691 Bacteria 990
265 Ga0373935_0318558 3300035692 Bacteria 1103
266 Ga0373927_0025628 3300035695 Bacteria 3855
267 Ga0373933_0012834 3300035724 Bacteria 4633
268 Ga0373947_0046170 3300035725 Bacteria 2608
269 Ga0373937_0100433 3300036401 Bacteria 2685
270 Ga0373937_0138590 3300036401 Bacteria 2275
271 Ga0373937_0458060 3300036401 Bacteria 1211
272 Ga0373925_0008391 3300037068 Bacteria 7521
273 Ga0395905_0186870 3300037471 Bacteria 1945
274 Ga0436361_0171911 3300039447 Bacteria 989
275 Ga0436363_0938579 3300039450 Bacteria 979
276 Ga0436363_1485297 3300039450 Bacteria 3364
277 Ga0436363_1685855 3300039450 Bacteria 2464
278 Ga0436363_1711656 3300039450 Bacteria 1126
279 Ga0436362_0176120 3300039453 Bacteria 1111
280 Ga0439439_0004034 3300041406 Bacteria 3280
281 Ga0451807_0723961 3300041486 Bacteria 615
282 Ga0439446_0123835 3300042156 Bacteria 834
283 Ga0451577_0529898 3300042876 Bacteria 1070
284 Ga0466966_0089030 3300044684 Bacteria 1918
285 Ga0466963_0110895 3300044694 Bacteria 1883
286 Ga0466963_0230391 3300044694 Bacteria 1298
287 Ga0453684_1328730 3300044712 Bacteria 749
288 Ga0466957_0278256 3300044842 Bacteria 1119
289 Ga0466957_0822200 3300044842 Bacteria 661
290 Ga0466959_0039140 3300045049 Bacteria 3504
291 Ga0466959_0454237 3300045049 Bacteria 868
292 Ga0451576_0033420 3300045051 Bacteria 5467
293 Ga0466958_0154028 3300045836 Bacteria 1450
294 Ga0466967_0107291 3300045976 Bacteria 2561
295 Ga0466967_0454359 3300045976 Bacteria 1252
296 Ga0495592_0266792 3300046454 Bacteria 1125
297 Ga0495651_0683151 3300046462 Bacteria 641
298 Ga0495580_0003962 3300046472 Bacteria 12497
299 Ga0495630_0068656 3300046517 Bacteria 2666
300 Ga0495586_0181634 3300046535 Bacteria 1190
301 Ga0495587_0177981 3300046536 Bacteria 1207
302 Ga0495668_0030659 3300046616 Bacteria 3035
303 Ga0495599_0312889 3300046678 Bacteria 946
304 Ga0495613_0002037 3300046689 Bacteria 15348
305 Ga0495600_0035244 3300046809 Bacteria 3249
306 Ga0495581_0081308 3300047315 Bacteria 1876
307 Ga0495675_0079441 3300047444 Bacteria 2066
308 Ga0495684_0400210 3300047471 Bacteria 964
309 Ga0496100_0009655 3300048903 Bacteria 5426
310 Ga0496101_0002441 3300048904 Bacteria 11422
311 Ga0496101_0517325 3300048904 Bacteria 943
312 Ga0496102_0017355 3300048905 Bacteria 6305
313 Ga0496103_0016236 3300048906 Bacteria 4444
314 Ga0496104_0035260 3300048907 Bacteria 4671
315 Ga0496104_0339215 3300048907 Bacteria 1416
316 Ga0496104_0989147 3300048907 Bacteria 745
317 Ga0496105_0019491 3300048908 Bacteria 5471
318 Ga0496106_0006238 3300048909 Bacteria 8822
319 Ga0496107_0012587 3300048910 Bacteria 5907
320 Ga0496108_0001827 3300048911 Bacteria 17004
321 Ga0496108_0003171 3300048911 Bacteria 13233
322 Ga0496109_0002877 3300048912 Bacteria 14402
323 Ga0496109_0396713 3300048912 Bacteria 1303
324 Ga0496109_0863789 3300048912 Bacteria 843
325 Ga0496110_0032882 3300048913 Bacteria 4483
326 Ga0496110_0076241 3300048913 Bacteria 2981
327 Ga0496110_0142560 3300048913 Bacteria 2166
328 Ga0496111_0001612 3300048914 Bacteria 13057
329 Ga0496111_0108465 3300048914 Bacteria 2044
330 Ga0496112_0017056 3300048915 Bacteria 6818
331 Ga0496114_0083304 3300048917 Bacteria 2705
332 Ga0496114_0483402 3300048917 Bacteria 1096
333 Ga0496115_0061047 3300048918 Bacteria 3038
334 Ga0496124_0017067 3300048927 Bacteria 6864
335 Ga0501031_0116085 3300049568 Bacteria 1749
336 Ga0501033_0100137 3300049570 Bacteria 2115
337 Ga0501036_0450037 3300049572 Bacteria 1073
338 Ga0501037_0159107 3300049573 Bacteria 1611
339 Ga0501040_0187168 3300049576 Bacteria 1468
340 Ga0501041_0013036 3300049577 Bacteria 4926
341 Ga0501042_0052183 3300049578 Bacteria 2917
342 Ga0501042_0877045 3300049578 Bacteria 653
343 Ga0501046_0059663 3300049580 Bacteria 2988
344 Ga0501048_1135471 3300049582 Bacteria 562
345 Ga0501071_0057373 3300049587 Bacteria 2814
346 Ga0501072_0172348 3300049588 Bacteria 1727
347 Ga0501074_0315188 3300049590 Bacteria 1111
348 Ga0501075_0685922 3300049591 Bacteria 780
349 Ga0501076_0422220 3300049592 Bacteria 1097
350 Ga0501077_0193273 3300049593 Bacteria 1293
351 Ga0501079_0216284 3300049741 Bacteria 1497
352 Ga0501081_0047177 3300049743 Bacteria 2964
353 Ga0501081_0051014 3300049743 Bacteria 2852
354 Ga0501083_0050245 3300049744 Bacteria 2807
355 Ga0501083_0176495 3300049744 Bacteria 1396
356 Ga0501045_0204986 3300049824 Bacteria 1469
357 Ga0501045_0732079 3300049824 Bacteria 729
358 nmdc:mga05p37_89210_c1 3300050507 Bacteria 3800
359 nmdc:mga09592_326726_c1 3300050508 Bacteria 1328
360 nmdc:mga09592_426188_c1 3300050508 Bacteria 1145
361 nmdc:mga08y16_172855_c1 3300050511 Bacteria 2244
362 nmdc:mga0n895_655686_c1 3300050512 Bacteria 1048
363 nmdc:mga0rr50_321164_c1 3300050513 Bacteria 1298
364 nmdc:mga08x19_20545_c1 3300050514 Bacteria 4066
365 Ga0495612_0328242 3300053078 Bacteria 689
366 Ga0500641_0116732 3300053096 Bacteria 1149
367 Ga0500555_028590 3300053103 Bacteria 1586
368 Ga0501084_0050903 3300054114 Bacteria 3466
369 Ga0501084_0634800 3300054114 Bacteria 902
370 Ga0466962_0092834 3300061719 Bacteria 1447
371 Ga0530510_0047442 3300061734 Bacteria 3104
372 2819588713 2818991444 Bacteria 6968812
373 Ga0099794_10051550
374 CNBas_1001622
375 JGI24735J21928_10076836
376 Ga0070683_100028081
377 Ga0070690_100133146
378 Ga0070670_100041096
379 Ga0070666_10001276
380 Ga0070680_100038810
381 Ga0070680_100043321
382 Ga0070680_100094464
383 Ga0068868_100029091
384 Ga0070668_100028295
385 Ga0070668_100068340
386 Ga0070675_100236229
387 Ga0070671_100003159
388 Ga0070671_100010170
389 Ga0070674_100017197
390 Ga0070674_100062204
391 Ga0070674_101376882
392 Ga0070688_100037156
393 Ga0070688_100283189
394 Ga0070667_100007800
395 Ga0070667_100266473
396 Ga0070709_10273363
397 Ga0070714_100019970
398 Ga0070714_100035047
399 Ga0070714_100067489
400 Ga0070714_100122686
401 Ga0070714_100184566
402 Ga0070713_100000635
403 Ga0070713_100776939
404 Ga0070710_10002289
405 Ga0070711_100001699
406 Ga0070708_100002132
407 Ga0070708_100136568
408 Ga0070708_100423264
409 Ga0070663_100099508
410 Ga0070678_100015153
411 Ga0070662_100027616
412 Ga0070662_100225119
413 Ga0070681_10007685
414 Ga0070681_10012127
415 Ga0070681_10068555
416 Ga0070681_10077628
417 Ga0070681_10230748
418 Ga0068867_100290516
419 Ga0068867_100654614
420 Ga0070706_100115084
421 Ga0070706_100166966
422 Ga0070699_100030298
423 Ga0070699_100085319
424 Ga0070679_100003017
425 Ga0070679_100014619
426 Ga0070679_100272210
427 Ga0070679_101489669
428 Ga0070684_100508882
429 Ga0070697_100003653
430 Ga0070697_100110682
431 Ga0070697_100306884
432 Ga0068853_100008355
433 Ga0070672_100020064
434 Ga0070672_100396648
435 Ga0070686_100816605
436 Ga0070695_100540304
437 Ga0070693_100011965
438 Ga0070693_100059145
439 Ga0070665_100009634
440 Ga0070704_100226662
441 Ga0068855_100013537
442 Ga0068854_100838604
443 Ga0068856_100043832
444 Ga0068856_100301988
445 Ga0068852_100055927
446 Ga0068852_101773914
447 Ga0068852_101885936
448 Ga0068866_10004329
449 Ga0068851_10050233
450 Ga0068851_10177534
451 Ga0068863_100003149
452 Ga0068863_100022478
453 Ga0068858_100024395
454 Ga0068858_100124356
455 Ga0068858_100875683
456 Ga0068860_100044695
457 Ga0068862_100042469
458 Ga0081539_10000059
459 Ga0070717_10947740
460 Ga0070715_10000744
461 Ga0070716_100007500
462 Ga0070716_100024869
463 Ga0070716_100683921
464 Ga0070712_100002312
465 Ga0070712_100809282
466 Ga0070712_101247171
467 Ga0097621_100001749
468 Ga0068871_100009936
469 Ga0068871_100422367
470 Ga0075428_100156167
471 Ga0075434_100695836
472 Ga0075429_100492513
473 Ga0068865_100007959
474 Ga0075436_100014674
475 Ga0075436_100026831
476 Ga0075436_100058118
477 Ga0099794_10012557
478 Ga0105251_10368080
479 Ga0105240_10555364
480 Ga0111539_10186901
481 Ga0111539_10935081
482 Ga0105245_10088733
483 Ga0105245_10699902
484 Ga0114129_10422561
485 Ga0114129_10747097
486 Ga0105243_10590005
487 Ga0105242_10025115
488 Ga0105242_11918844
489 Ga0105248_10014619
490 Ga0105248_10056875
491 Ga0105248_11424217
492 Ga0105237_10100205
493 Ga0105238_10766787
494 Ga0105249_10587930
495 Ga0099796_10155688
496 Ga0099796_10312561
497 Ga0105239_10062160
498 Ga0157370_10061168
499 Ga0157370_10239953
500 Ga0157370_10681597
501 Ga0157374_10001720
502 Ga0157374_11258688
503 Ga0157378_10003340
504 Ga0157378_10902288
505 Ga0163162_10039381
506 Ga0163162_10275566
507 Ga0163162_10495959
508 Ga0157372_10082654
509 Ga0157372_10354698
510 Ga0157372_10854734
511 Ga0157372_11051401
512 Ga0157372_11167383
513 Ga0157375_10078772
514 Ga0157375_10272283
515 Ga0157375_10653651
516 Ga0157375_10870546
517 Ga0157375_11084095
518 Ga0163163_10211430
519 Ga0157377_10316346
520 Ga0157379_10020021
521 Ga0157376_10018740
522 Ga0157376_10727657
523 Ga0206356_10233177
524 Ga0207656_10171709
525 Ga0207692_10061618
526 Ga0207692_10270009
527 Ga0207642_10103641
528 Ga0207685_10001064
529 Ga0207699_10028225
530 Ga0207699_10237463
531 Ga0207645_10666203
532 Ga0207705_10000770
533 Ga0207705_10213052
534 Ga0207705_11158137
535 Ga0207684_10136127
536 Ga0207707_10015444
537 Ga0207707_10041419
538 Ga0207707_10124694
539 Ga0207707_10234738
540 Ga0207707_10318433
541 Ga0207707_10536992
542 Ga0207695_10014979
543 Ga0207671_10060944
544 Ga0207693_10000503
545 Ga0207663_10007591
546 Ga0207660_10008926
547 Ga0207660_10075460
548 Ga0207662_10093184
549 Ga0207662_10129412
550 Ga0207657_10006291
551 Ga0207657_10216725
552 Ga0207652_10006595
553 Ga0207652_10305655
554 Ga0207652_10424694
555 Ga0207652_11315191
556 Ga0207694_10044111
557 Ga0207694_10638332
558 Ga0207650_10163814
559 Ga0207659_10072727
560 Ga0207687_10056672
561 Ga0207687_10093664
562 Ga0207700_10021050
563 Ga0207700_10681892
564 Ga0207664_10015280
565 Ga0207664_10031584
566 Ga0207664_10118231
567 Ga0207664_10129638
568 Ga0207664_10394679
569 Ga0207644_10012228
570 Ga0207644_10076020
571 Ga0207644_10568326
572 Ga0207706_10085114
573 Ga0207706_10087042
574 Ga0207706_10145876
575 Ga0207686_10121441
576 Ga0207669_10236274
577 Ga0207669_10633755
578 Ga0207704_10016423
579 Ga0207665_10001006
580 Ga0207665_10046434
581 Ga0207665_10602529
582 Ga0207691_10021767
583 Ga0207711_10031097
584 Ga0207711_10097964
585 Ga0207711_10133425
586 Ga0207661_10026611
587 Ga0207661_10057978
588 Ga0207661_10250498
589 Ga0207667_10332618
590 Ga0207667_10396048
591 Ga0207667_10508360
592 Ga0207667_10876028
593 Ga0207651_10355976
594 Ga0207712_10000190
595 Ga0207712_10314496
596 Ga0207677_10049487
597 Ga0207703_10009142
598 Ga0207639_10052291
599 Ga0207639_10539466
600 Ga0207678_10021557
601 Ga0207708_10128183
602 Ga0207708_10201204
603 Ga0207708_10236127
604 Ga0207702_10081335
605 Ga0207702_10242449
606 Ga0207641_10000693
607 Ga0207641_10090025
608 Ga0207648_10264874
609 Ga0207675_100515479
610 Ga0207683_10004435
611 Ga0207683_10349944
612 Ga0207698_10258889
613 Ga0207698_10312044
614 Ga0209588_1006511
615 Ga0207428_10032403
616 Ga0268265_10054766
617 Ga0268264_10074138
618 Ga0265337_1049545
619 Ga0265319_1077907
620 Ga0265318_10000728
621 Ga0265325_10002986
622 Ga0265329_10044941
623 Ga0265316_10000955
624 Ga0265313_10000972
625 Ga0307412_10013803
626 Ga0307412_10755201
627 Ga0307409_100038451
628 Ga0307416_100483236
629 Ga0307414_10649350
630 Ga0307411_10145306
631 Ga0307415_100234519
632 Ga0373923_0075340
633 Ga0373954_0036801
634 Ga0373946_0495293
635 Ga0373955_0217069
636 Ga0373931_0300996
637 Ga0373935_0318558
638 Ga0373927_0025628
639 Ga0373933_0012834
640 Ga0373947_0046170
641 Ga0373937_0100433
642 Ga0373937_0138590
643 Ga0373937_0458060
644 Ga0373925_0008391
645 Ga0395905_0186870
646 Ga0436361_0171911
647 Ga0436363_0938579
648 Ga0436363_1485297
649 Ga0436363_1685855
650 Ga0436363_1711656
651 Ga0436362_0176120
652 Ga0439439_0004034
653 Ga0451807_0723961
654 Ga0439446_0123835
655 Ga0451577_0529898
656 Ga0466966_0089030
657 Ga0466963_0110895
658 Ga0466963_0230391
659 Ga0453684_1328730
660 Ga0466957_0278256
661 Ga0466957_0822200
662 Ga0466959_0039140
663 Ga0466959_0454237
664 Ga0451576_0033420
665 Ga0466958_0154028
666 Ga0466967_0107291
667 Ga0466967_0454359
668 Ga0495592_0266792
669 Ga0495651_0683151
670 Ga0495580_0003962
671 Ga0495630_0068656
672 Ga0495586_0181634
673 Ga0495587_0177981
674 Ga0495668_0030659
675 Ga0495599_0312889
676 Ga0495613_0002037
677 Ga0495600_0035244
678 Ga0495581_0081308
679 Ga0495675_0079441
680 Ga0495684_0400210
681 Ga0496100_0009655
682 Ga0496101_0002441
683 Ga0496101_0517325
684 Ga0496102_0017355
685 Ga0496103_0016236
686 Ga0496104_0035260
687 Ga0496104_0339215
688 Ga0496104_0989147
689 Ga0496105_0019491
690 Ga0496106_0006238
691 Ga0496107_0012587
692 Ga0496108_0001827
693 Ga0496108_0003171
694 Ga0496109_0002877
695 Ga0496109_0396713
696 Ga0496109_0863789
697 Ga0496110_0032882
698 Ga0496110_0076241
699 Ga0496110_0142560
700 Ga0496111_0001612
701 Ga0496111_0108465
702 Ga0496112_0017056
703 Ga0496114_0083304
704 Ga0496114_0483402
705 Ga0496115_0061047
706 Ga0496124_0017067
707 Ga0501031_0116085
708 Ga0501033_0100137
709 Ga0501036_0450037
710 Ga0501037_0159107
711 Ga0501040_0187168
712 Ga0501041_0013036
713 Ga0501042_0052183
714 Ga0501042_0877045
715 Ga0501046_0059663
716 Ga0501048_1135471
717 Ga0501071_0057373
718 Ga0501072_0172348
719 Ga0501074_0315188
720 Ga0501075_0685922
721 Ga0501076_0422220
722 Ga0501077_0193273
723 Ga0501079_0216284
724 Ga0501081_0047177
725 Ga0501081_0051014
726 Ga0501083_0050245
727 Ga0501083_0176495
728 Ga0501045_0204986
729 Ga0501045_0732079
730 nmdc:mga05p37_89210_c1
731 nmdc:mga09592_326726_c1
732 nmdc:mga09592_426188_c1
733 nmdc:mga08y16_172855_c1
734 nmdc:mga0n895_655686_c1
735 nmdc:mga0rr50_321164_c1
736 nmdc:mga08x19_20545_c1
737 Ga0495612_0328242
738 Ga0500641_0116732
739 Ga0500555_028590
740 Ga0501084_0050903
741 Ga0501084_0634800
742 Ga0466962_0092834
743 Ga0530510_0047442
744 2819588713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

37

186

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oow-assembly1.cif.gz_D octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4. 0.9296 4 154
4zmb-assembly1.cif.gz_B structure of acetobacter aceti pure-s57v,y154f 0.9294 2 150
4zjy-assembly1.cif.gz_B structure of acetobacter aceti pure-s57n 0.9287 2 150
5clf-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, at ph 8.5 0.9285 2 150
2fwb-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9285 2 150
ID Description Score Start End Superfamily
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9319 1 169 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9215 1 169 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9175 2 150 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8997 10 170 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8936 6 162 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A5B8MV92-F1-model_v4 phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) 0.9449 2 165 GO:0004638
GO:0005524
GO:0006189
GO:0046872
AF-A0A2M7U021-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.943 1 163 GO:0006189
GO:0034023
AF-A0A3P6AJT5-F1-model_v4 phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) 0.9377 2 151 GO:0004638
GO:0005524
GO:0006189
GO:0009507
GO:0046872
AF-A0A2M7U021-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9374 1 163 GO:0006189
GO:0034023
AF-A0A2V1KCK0-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9365 4 161 GO:0006189
GO:0034023

Map