F425945

General Info

Members Datasets Scaffolds Average Seq Length
372 250 308 409

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100019711|Ga0068869_1000197114
Length 455
Sequence MTPAMILTALMGMQFNNTNMLIAAKEMFSSINKFPLAAIPFFILAGNLMETGGISRRLVEFAKSLVGGVQGGLPMTCVLTCMIFAAVSGSSVATTFAIGTILIPALIRHGYPVNYAAALQATSAELGVIIPPSIPMILYGVSAEVSIGELFIAGFGPGFLIGGALMLFVFLWCRWKGWGKQDGEGRLSVATAAIDVAFIAGFMVAVVVGRRLTDSPMGHLALPALYLALCLALPQLRRFATAHAGLALLMPVIILGGIYGGIFTPTEASAVAVFYALVVGCLVYRDIGVRDLYTILRKSVISSAVIMFIIANAGLFAFLITRAGIPDLIGQWLKEVLRTPTLFLLGVNAALFVIGMFIETSASIIVLAPILAPVALHFGVDPVHFGIIMVVNLALGMITPPFGVNLFAACTVARISLDRIIGQLLPFVLVVLGCLMVITYVPGISLALRDLVYAK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2643221569 Achromobacter sp. Root565 Isolate Unclassified
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2643221734 Bosea sp. Root670 Isolate Unclassified
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738543019 Variovorax sp. GV040 Isolate Unclassified
21 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
22 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
23 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
24 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
25 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
26 2842677519 Variovorax sp. R-72495 Isolate Unclassified
27 2842747753 Variovorax sp. R-72060 Isolate Unclassified
28 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
29 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
30 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
31 2858950400 Achromobacter sp. K91 Isolate Unclassified
32 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
33 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
34 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
35 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
36 2885198086 Variovorax sp. 679 Isolate Unclassified
37 2885211737 Variovorax sp. 553 Isolate Unclassified
38 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
39 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
40 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
41 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
42 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
43 2904456579 Variovorax sp. 2002 Isolate Unclassified
44 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
45 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
46 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
47 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
48 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
49 2929520902 Variovorax beijingensis 502 Isolate Unclassified
50 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
51 2941479691
52 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
53 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
54 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
55 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
56 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
57 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
58 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
59 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
60 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
61 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
64 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
65 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
66 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
67 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
68 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
69 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
70 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
81 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
91 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
92 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
93 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
197 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
247 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
248 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
249 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
250 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.8
Metatranscriptomes 0
Isolates 17.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.76
Nodule 1.08
Rhizoplane 1.61
Rhizosphere 49.19
Stem 0
Stem Tuber 0
Unclassified 19.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003145 3300001976 Bacteria 2178
2 JGI24740J21852_10023233 3300001979 Bacteria 2121
3 JGI25155J39150_1000090 3300002704 Bacteria 51836
4 JGI25156J39149_1000148 3300002705 Bacteria 51890
5 JGI25154J39366_1000155 3300002738 Bacteria 52889
6 JGI25157J39369_1000183 3300002741 Bacteria 52889
7 JGI25152J39213_1003568 3300002773 Bacteria 5266
8 JGI25150J39212_1009474 3300002774 Bacteria 1850
9 JGI25159J45721_1005016 3300002987 Bacteria 4233
10 JGI25159J45721_1007514 3300002987 Bacteria 3116
11 JGI25151J46595_10004229 3300003187 Bacteria 7637
12 JGI25151J46595_10016629 3300003187 Bacteria 3212
13 JGI25153J46596_10014853 3300003215 Bacteria 3212
14 Ga0055538_1000696 3300003751 Bacteria 10257
15 Ga0055526_1003224 3300003771 Bacteria 10518
16 Ga0055526_1007263 3300003771 Bacteria 5806
17 Ga0055537_1000067 3300003773 Bacteria 75689
18 Ga0055537_1000086 3300003773 Bacteria 67416
19 Ga0055524_1000279 3300003775 Bacteria 50624
20 Ga0055536_1001302 3300003781 Bacteria 15354
21 Ga0055536_1005425 3300003781 Bacteria 6237
22 Ga0055536_1009975 3300003781 Bacteria 3841
23 Ga0055534_1000079 3300003784 Bacteria 75689
24 Ga0055534_1002371 3300003784 Bacteria 6573
25 Ga0055528_1001037 3300003790 Bacteria 18378
26 Ga0055528_1005743 3300003790 Bacteria 5716
27 Ga0055528_1013543 3300003790 Bacteria 3082
28 Ga0055530_10000730 3300003791 Bacteria 27505
29 Ga0055530_10001255 3300003791 Bacteria 19265
30 Ga0055530_10002701 3300003791 Bacteria 11037
31 Ga0055530_10006113 3300003791 Bacteria 5473
32 Ga0055540_1000553 3300003792 Bacteria 27912
33 Ga0055540_1001982 3300003792 Bacteria 11450
34 Ga0055540_1006694 3300003792 Bacteria 4517
35 Ga0055540_1008030 3300003792 Bacteria 3861
36 Ga0055540_1015457 3300003792 Bacteria 2221
37 Ga0055531_10000269 3300003794 Bacteria 53905
38 Ga0055531_10000726 3300003794 Bacteria 27911
39 Ga0055531_10000873 3300003794 Bacteria 24722
40 Ga0055531_10021958 3300003794 Bacteria 2452
41 Ga0065165_1017048 3300005262 Bacteria 2692
42 Ga0065165_1037361 3300005262 Bacteria 1472
43 Ga0065704_10101719 3300005289 Bacteria 2228
44 Ga0070658_10264806 3300005327 Bacteria 1460
45 Ga0068869_100019711 3300005334 Bacteria 4614
46 Ga0070666_10035821 3300005335 Bacteria 3291
47 Ga0068868_100007098 3300005338 Bacteria 7964
48 Ga0068868_100174807 3300005338 Bacteria 1779
49 Ga0070669_100060671 3300005353 Bacteria 2778
50 Ga0070675_100030142 3300005354 Bacteria 4378
51 Ga0070675_100072252 3300005354 Bacteria 2864
52 Ga0070671_100008962 3300005355 Bacteria 8028
53 Ga0070671_100020401 3300005355 Bacteria 5405
54 Ga0070667_100041161 3300005367 Bacteria 3876
55 Ga0070709_10184216 3300005434 Bacteria 1468
56 Ga0070714_100032836 3300005435 Bacteria 4335
57 Ga0070710_10044593 3300005437 Bacteria 2461
58 Ga0070711_100023449 3300005439 Bacteria 4014
59 Ga0070662_100005845 3300005457 Bacteria 7895
60 Ga0070681_10119815 3300005458 Bacteria 2567
61 Ga0068867_100014481 3300005459 Bacteria 5589
62 Ga0068867_100016876 3300005459 Bacteria 5189
63 Ga0068853_100008771 3300005539 Bacteria 8133
64 Ga0070672_100003001 3300005543 Bacteria 10877
65 Ga0070672_100008963 3300005543 Bacteria 6876
66 Ga0070672_100109451 3300005543 Bacteria 2250
67 Ga0070696_100001208 3300005546 Bacteria 16776
68 Ga0070665_100030788 3300005548 Bacteria 5400
69 Ga0070665_100045803 3300005548 Bacteria 4393
70 Ga0070665_100155907 3300005548 Bacteria 2285
71 Ga0068861_100010403 3300005719 Bacteria 6455
72 Ga0068851_10006728 3300005834 Bacteria 5258
73 Ga0068870_10006765 3300005840 Bacteria 5079
74 Ga0068860_100212497 3300005843 Bacteria 1877
75 Ga0068862_100030325 3300005844 Bacteria 4557
76 Ga0075365_10011447 3300006038 Bacteria 5216
77 Ga0075368_10007677 3300006042 Bacteria 3813
78 Ga0075363_100017606 3300006048 Bacteria 3546
79 Ga0075364_10070465 3300006051 Bacteria 2302
80 Ga0070712_100155778 3300006175 Bacteria 1759
81 Ga0075367_10021333 3300006178 Bacteria 3618
82 Ga0075366_10014610 3300006195 Bacteria 4486
83 Ga0097621_100078122 3300006237 Bacteria 2749
84 Ga0075370_10000356 3300006353 Bacteria 16689
85 Ga0075370_10000594 3300006353 Bacteria 13976
86 Ga0075370_10006193 3300006353 Bacteria 6003
87 Ga0068871_100020569 3300006358 Bacteria 5058
88 Ga0075430_100071251 3300006846 Bacteria 2916
89 Ga0075431_100126214 3300006847 Bacteria 2640
90 Ga0097620_100180598 3300006931 Bacteria 2193
91 Ga0099826_10023668 3300006948 Bacteria 4572
92 Ga0105244_10007302 3300009036 Bacteria 7030
93 Ga0105243_10001470 3300009148 Bacteria 20672
94 Ga0105243_10047232 3300009148 Bacteria 3388
95 Ga0105248_10021049 3300009177 Bacteria 7226
96 Ga0105248_10353814 3300009177 Bacteria 1654
97 Ga0105237_10071049 3300009545 Bacteria 3476
98 Ga0105238_10289350 3300009551 Bacteria 1620
99 Ga0105238_10308570 3300009551 Bacteria 1567
100 Ga0105246_10010775 3300011119 Bacteria 5667
101 Ga0105246_10115166 3300011119 Bacteria 1982
102 Ga0157370_10013135 3300013104 Bacteria 8543
103 Ga0157369_10095160 3300013105 Bacteria 3179
104 Ga0157375_10069884 3300013308 Bacteria 3519
105 Ga0157375_10140524 3300013308 Bacteria 2542
106 Ga0182008_10000330 3300014497 Bacteria 37364
107 Ga0182008_10002376 3300014497 Bacteria 11835
108 Ga0182008_10003615 3300014497 Bacteria 9255
109 Ga0157376_10026717 3300014969 Bacteria 4565
110 Ga0182006_1001221 3300015261 Bacteria 16037
111 Ga0182007_10003876 3300015262 Bacteria 6937
112 Ga0182007_10014003 3300015262 Bacteria 3039
113 Ga0163161_10080119 3300017792 Bacteria 2403
114 Ga0209435_100014 3300025206 Bacteria 322129
115 Ga0209784_100072 3300025224 Bacteria 149587
116 Ga0207425_1004043 3300025245 Bacteria 4498
117 Ga0207425_1005751 3300025245 Bacteria 3490
118 Ga0209646_1000001 3300025246 Bacteria 3092932
119 Ga0209026_1000137 3300025250 Bacteria 116282
120 Ga0209759_1000013 3300025256 Bacteria 399300
121 Ga0209129_1004105 3300025258 Bacteria 5923
122 Ga0209129_1011509 3300025258 Bacteria 2105
123 Ga0209565_1000028 3300025263 Bacteria 348536
124 Ga0209565_1000040 3300025263 Bacteria 266543
125 Ga0209673_1000035 3300025273 Bacteria 328411
126 Ga0209673_1000109 3300025273 Bacteria 183000
127 Ga0209673_1016224 3300025273 Bacteria 2795
128 Ga0209673_1025579 3300025273 Bacteria 1959
129 Ga0209130_1000759 3300025284 Bacteria 27970
130 Ga0209130_1008079 3300025284 Bacteria 3152
131 Ga0209675_1000024 3300025291 Bacteria 312615
132 Ga0209675_1000111 3300025291 Bacteria 114805
133 Ga0209675_1002085 3300025291 Bacteria 10625
134 Ga0209676_1000005 3300025292 Bacteria 1076001
135 Ga0209676_1000254 3300025292 Bacteria 113136
136 Ga0209676_1000634 3300025292 Bacteria 50573
137 Ga0209676_1014977 3300025292 Bacteria 2881
138 Ga0209025_1001864 3300025294 Bacteria 24710
139 Ga0209025_1006211 3300025294 Bacteria 9376
140 Ga0209025_1007844 3300025294 Bacteria 7837
141 Ga0209025_1012212 3300025294 Bacteria 5536
142 Ga0209025_1023144 3300025294 Bacteria 3261
143 Ga0209025_1030314 3300025294 Bacteria 2592
144 Ga0209564_1000531 3300025295 Bacteria 62085
145 Ga0209564_1000714 3300025295 Bacteria 48032
146 Ga0209564_1006417 3300025295 Bacteria 6350
147 Ga0209758_1019515 3300025297 Bacteria 3264
148 Ga0209050_1000007 3300025298 Bacteria 1187891
149 Ga0209050_1000023 3300025298 Bacteria 537172
150 Ga0209050_1000497 3300025298 Bacteria 66982
151 Ga0209050_1001842 3300025298 Bacteria 20545
152 Ga0209050_1011144 3300025298 Bacteria 4307
153 Ga0209050_1021478 3300025298 Bacteria 2351
154 Ga0209256_1000003 3300025299 Bacteria 1661127
155 Ga0209256_1000262 3300025299 Bacteria 93226
156 Ga0207426_1007615 3300025302 Bacteria 4505
157 Ga0207426_1011012 3300025302 Bacteria 3474
158 Ga0209051_1000009 3300025303 Bacteria 706778
159 Ga0209051_1000017 3300025303 Bacteria 537172
160 Ga0209051_1000073 3300025303 Bacteria 208874
161 Ga0209051_1000136 3300025303 Bacteria 138015
162 Ga0209051_1000262 3300025303 Bacteria 87898
163 Ga0209257_1000011 3300025304 Bacteria 1112630
164 Ga0209257_1000041 3300025304 Bacteria 537172
165 Ga0209257_1000055 3300025304 Bacteria 415534
166 Ga0209257_1000139 3300025304 Bacteria 202285
167 Ga0207655_1005174 3300025728 Bacteria 8973
168 Ga0207699_10011256 3300025906 Bacteria 4510
169 Ga0207671_10255189 3300025914 Bacteria 1379
170 Ga0207681_10023812 3300025923 Bacteria 3921
171 Ga0207659_10095802 3300025926 Bacteria 2226
172 Ga0207687_10069268 3300025927 Bacteria 2515
173 Ga0207664_10019464 3300025929 Bacteria 5018
174 Ga0207644_10008876 3300025931 Bacteria 6585
175 Ga0207706_10021250 3300025933 Bacteria 5830
176 Ga0207709_10012378 3300025935 Bacteria 4701
177 Ga0207709_10098779 3300025935 Bacteria 1926
178 Ga0207691_10003024 3300025940 Bacteria 16412
179 Ga0207691_10007242 3300025940 Bacteria 10702
180 Ga0207691_10013730 3300025940 Bacteria 7738
181 Ga0207711_10168800 3300025941 Bacteria 1984
182 Ga0207689_10013046 3300025942 Bacteria 7096
183 Ga0207667_10050331 3300025949 Bacteria 4396
184 Ga0207640_10054019 3300025981 Bacteria 2625
185 Ga0207658_10006313 3300025986 Bacteria 8095
186 Ga0207677_10024740 3300026023 Bacteria 3735
187 Ga0207639_10024060 3300026041 Bacteria 4403
188 Ga0207648_10005567 3300026089 Bacteria 12673
189 Ga0207674_10016785 3300026116 Bacteria 8003
190 Ga0207674_10036688 3300026116 Bacteria 5104
191 Ga0209973_1001030 3300027252 Bacteria 2304
192 Ga0268266_10032977 3300028379 Bacteria 4402
193 Ga0268266_10055409 3300028379 Bacteria 3408
194 Ga0268266_10076498 3300028379 Bacteria 2909
195 Ga0268264_10109578 3300028381 Bacteria 2416
196 Ga0307515_10000459 3300028794 Bacteria 97482
197 Ga0268256_1018069 3300030500 Bacteria 1970
198 Ga0316182_1304162 3300030745 Bacteria 2476
199 Ga0316182_1330174 3300030745 Bacteria 2988
200 Ga0265327_10010954 3300031251 Bacteria 6309
201 Ga0307513_10000006 3300031456 Bacteria 470848
202 Ga0307513_10000011 3300031456 Bacteria 354929
203 Ga0307513_10177870 3300031456 Bacteria 1995
204 Ga0307408_100000048 3300031548 Bacteria 165579
205 Ga0307408_100008225 3300031548 Bacteria 6884
206 Ga0307408_100015366 3300031548 Bacteria 5095
207 Ga0307408_100173430 3300031548 Bacteria 1723
208 Ga0307408_100202555 3300031548 Bacteria 1607
209 Ga0307514_10009341 3300031649 Bacteria 8255
210 Ga0307516_10029170 3300031730 Bacteria 5579
211 Ga0307516_10035762 3300031730 Bacteria 4979
212 Ga0307405_10018328 3300031731 Bacteria 3859
213 Ga0307406_10000230 3300031901 Bacteria 34225
214 Ga0307406_10002497 3300031901 Bacteria 10022
215 Ga0307406_10007292 3300031901 Bacteria 6125
216 Ga0307412_10003193 3300031911 Bacteria 9106
217 Ga0307416_100003033 3300032002 Bacteria 9815
218 Ga0307416_100058229 3300032002 Bacteria 3131
219 Ga0307414_10033311 3300032004 Bacteria 3404
220 Ga0307414_10071895 3300032004 Bacteria 2497
221 Ga0307414_10225540 3300032004 Bacteria 1541
222 Ga0373955_0028383 3300035172 Bacteria 2900
223 Ga0373937_0049104 3300036401 Bacteria 3864
224 Ga0395899_0090032 3300037312 Bacteria 2225
225 Ga0395900_0029291 3300037418 Bacteria 5649
226 Ga0395900_0040371 3300037418 Bacteria 4810
227 Ga0395900_0112019 3300037418 Bacteria 2802
228 Ga0395905_0000712 3300037471 Bacteria 43953
229 Ga0395905_0015534 3300037471 Bacteria 7235
230 Ga0395905_0061771 3300037471 Bacteria 3504
231 Ga0395901_0251092 3300038443 Bacteria 1843
232 Ga0439439_0006453 3300041406 Bacteria 2713
233 Ga0439466_0005061 3300041411 Bacteria 5054
234 Ga0451791_0804086 3300041451 Bacteria 2020
235 Ga0439433_0005453 3300041999 Bacteria 2731
236 Ga0439445_0011851 3300042004 Bacteria 2085
237 Ga0439432_005920 3300042006 Bacteria 4390
238 Ga0439432_010077 3300042006 Bacteria 3284
239 Ga0439449_0005184 3300042007 Bacteria 5000
240 Ga0439449_0006270 3300042007 Bacteria 4547
241 Ga0439452_001220 3300042010 Bacteria 10956
242 Ga0450918_000576 3300042531 Bacteria 7808
243 Ga0451577_0005817 3300042876 Bacteria 12484
244 Ga0453683_0002555 3300044673 Bacteria 14028
245 Ga0451576_0000647 3300045051 Bacteria 71894
246 Ga0451576_0106333 3300045051 Bacteria 2920
247 Ga0495606_0002586 3300046507 Bacteria 20710
248 Ga0495656_0000146 3300046615 Bacteria 26151
249 Ga0495687_034556 3300047443 Bacteria 2283
250 Ga0496102_0002798 3300048905 Bacteria 14877
251 Ga0496104_0017582 3300048907 Bacteria 6515
252 Ga0496105_0309799 3300048908 Bacteria 1268
253 Ga0496111_0033038 3300048914 Bacteria 3690
254 Ga0496117_0069370 3300048920 Bacteria 2374
255 Ga0496117_0084692 3300048920 Bacteria 2067
256 Ga0496118_0012844 3300048921 Bacteria 7989
257 Ga0496118_0072911 3300048921 Bacteria 2463
258 Ga0496119_0002124 3300048922 Bacteria 22306
259 Ga0496121_0004468 3300048924 Bacteria 18789
260 Ga0496121_0091756 3300048924 Bacteria 2370
261 Ga0496121_0098322 3300048924 Bacteria 2265
262 Ga0496122_0000584 3300048925 Bacteria 74681
263 Ga0496122_0001381 3300048925 Bacteria 39387
264 Ga0496123_0000308 3300048926 Bacteria 94712
265 Ga0496123_0000411 3300048926 Bacteria 78453
266 Ga0496123_0020434 3300048926 Bacteria 5179
267 Ga0496124_0047036 3300048927 Bacteria 3692
268 Ga0496125_0000011 3300048928 Bacteria 655895
269 Ga0496125_0038753 3300048928 Bacteria 4116
270 Ga0496125_0084167 3300048928 Bacteria 2416
271 Ga0496126_0135864 3300048929 Bacteria 2121
272 Ga0501032_0000816 3300049569 Bacteria 25276
273 Ga0501033_0001967 3300049570 Bacteria 17892
274 Ga0501034_0010232 3300049571 Bacteria 9783
275 Ga0501034_0060330 3300049571 Bacteria 3810
276 Ga0501034_0142113 3300049571 Bacteria 2379
277 Ga0501036_0010724 3300049572 Bacteria 7575
278 Ga0501037_0001800 3300049573 Bacteria 15566
279 Ga0501038_0001840 3300049574 Bacteria 19624
280 Ga0501038_0204250 3300049574 Bacteria 1584
281 Ga0501043_0001690 3300049579 Bacteria 19153
282 Ga0501043_0001751 3300049579 Bacteria 18712
283 Ga0501046_0008135 3300049580 Bacteria 9161
284 Ga0501046_0022258 3300049580 Bacteria 5222
285 Ga0501046_0045145 3300049580 Bacteria 3502
286 Ga0501046_0202122 3300049580 Bacteria 1478
287 Ga0501047_0000546 3300049581 Bacteria 40630
288 Ga0501047_0020111 3300049581 Bacteria 6409
289 Ga0501048_0201844 3300049582 Bacteria 1409
290 Ga0501072_0000680 3300049588 Bacteria 24530
291 Ga0501225_0001856 3300049705 Bacteria 6635
292 Ga0501035_0000874 3300049822 Bacteria 32016
293 Ga0501035_0133202 3300049822 Bacteria 2165
294 Ga0501044_0001518 3300049823 Bacteria 27224
295 Ga0501044_0073607 3300049823 Bacteria 3472
296 nmdc:mga06z11_5176_c1 3300050494 Bacteria 5207
297 nmdc:mga06z11_73409_c1 3300050494 Bacteria 1816
298 nmdc:mga07m45_103_c1 3300050496 Bacteria 33229
299 nmdc:mga07m45_37969_c1 3300050496 Bacteria 2686
300 nmdc:mga07m45_7933_c1 3300050496 Bacteria 5437
301 Ga0500651_0000738 3300053093 Bacteria 15959
302 Ga0500642_0000257 3300053130 Bacteria 19917
303 Ga0500658_0002871 3300053134 Bacteria 6610
304 Ga0500568_0002685 3300053139 Bacteria 10312
305 Ga0500616_0038155 3300053153 Bacteria 2596
306 Ga0500616_0067329 3300053153 Bacteria 1837
307 Ga0500645_000320 3300053730 Bacteria 34158
308 Ga0500645_010338 3300053730 Bacteria 3091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2945972063 2945976665 338
2 3300049582 Ga0501048_0201844 Ga0501048_0201844_348_1397 349
3 3300048908 Ga0496105_0309799 Ga0496105_0309799_11_1090 353
4 3300042006 Ga0439432_005920 Ga0439432_005920_3212_4378 357
5 3300047443 Ga0495687_034556 Ga0495687_034556_860_2137 357
6 3300013105 Ga0157369_10095160 Ga0157369_100951602 369
7 3300031548 Ga0307408_100173430 Ga0307408_1001734302 371
8 3300031731 Ga0307405_10018328 Ga0307405_100183282 371
9 3300031911 Ga0307412_10003193 Ga0307412_100031933 371
10 3300032002 Ga0307416_100003033 Ga0307416_1000030337 371
11 3300005543 Ga0070672_100008963 Ga0070672_1000089634 373
12 3300005548 Ga0070665_100030788 Ga0070665_1000307884 373
13 3300006237 Ga0097621_100078122 Ga0097621_1000781222 373
14 3300014969 Ga0157376_10026717 Ga0157376_100267173 373
15 3300025940 Ga0207691_10013730 Ga0207691_100137305 373
16 3300025986 Ga0207658_10006313 Ga0207658_100063132 373
17 3300028379 Ga0268266_10055409 Ga0268266_100554095 373
18 3300041406 Ga0439439_0006453 Ga0439439_0006453_877_2154 377
19 3300041999 Ga0439433_0005453 Ga0439433_0005453_1042_2319 379
20 3300046507 Ga0495606_0002586 Ga0495606_0002586_18095_19372 379
21 3300014497 Ga0182008_10003615 Ga0182008_100036154 381
22 3300015262 Ga0182007_10003876 Ga0182007_100038763 381
23 3300035172 Ga0373955_0028383 Ga0373955_0028383_1191_2474 382
24 3300036401 Ga0373937_0049104 Ga0373937_0049104_74_1357 382
25 3300011119 Ga0105246_10115166 Ga0105246_101151662 383
26 3300048905 Ga0496102_0002798 Ga0496102_0002798_3485_4762 383
27 3300048907 Ga0496104_0017582 Ga0496104_0017582_86_1363 383
28 3300048914 Ga0496111_0033038 Ga0496111_0033038_141_1418 383
29 3300053130 Ga0500642_0000257 Ga0500642_0000257_3832_5106 383
30 3300037471 Ga0395905_0061771 Ga0395905_0061771_2097_3374 385
31 3300042007 Ga0439449_0006270 Ga0439449_0006270_12_1265 385
32 3300017792 Ga0163161_10080119 Ga0163161_100801191 386
33 3300030745 Ga0316182_1330174 Ga0316182_13301742 386
34 3300031730 Ga0307516_10035762 Ga0307516_100357624 387
35 3300042531 Ga0450918_000576 Ga0450918_000576_4591_5868 387
36 3300049705 Ga0501225_0001856 Ga0501225_0001856_3404_4681 387
37 3300009551 Ga0105238_10289350 Ga0105238_102893502 389
38 3300049588 Ga0501072_0000680 Ga0501072_0000680_13584_14894 389
39 3300005335 Ga0070666_10035821 Ga0070666_100358212 390
40 3300005355 Ga0070671_100020401 Ga0070671_1000204013 390
41 3300005539 Ga0068853_100008771 Ga0068853_1000087716 390
42 3300005548 Ga0070665_100045803 Ga0070665_1000458035 390
43 3300006358 Ga0068871_100020569 Ga0068871_1000205692 390
44 3300009177 Ga0105248_10021049 Ga0105248_100210496 390
45 3300025941 Ga0207711_10168800 Ga0207711_101688001 390
46 3300026041 Ga0207639_10024060 Ga0207639_100240604 390
47 3300028379 Ga0268266_10076498 Ga0268266_100764982 390
48 3300005353 Ga0070669_100060671 Ga0070669_1000606712 391
49 3300005354 Ga0070675_100072252 Ga0070675_1000722522 391
50 3300005459 Ga0068867_100014481 Ga0068867_1000144813 391
51 3300005543 Ga0070672_100109451 Ga0070672_1001094513 391
52 3300005840 Ga0068870_10006765 Ga0068870_100067654 391
53 3300005843 Ga0068860_100212497 Ga0068860_1002124972 391
54 3300006931 Ga0097620_100180598 Ga0097620_1001805981 391
55 3300013308 Ga0157375_10069884 Ga0157375_100698842 391
56 3300025923 Ga0207681_10023812 Ga0207681_100238122 391
57 3300025926 Ga0207659_10095802 Ga0207659_100958022 391
58 3300028381 Ga0268264_10109578 Ga0268264_101095782 391
59 3300031251 Ga0265327_10010954 Ga0265327_100109545 391
60 3300041411 Ga0439466_0005061 Ga0439466_0005061_1708_2973 391
61 3300042004 Ga0439445_0011851 Ga0439445_0011851_513_1778 391
62 3300042006 Ga0439432_010077 Ga0439432_010077_44_1309 391
63 3300042007 Ga0439449_0005184 Ga0439449_0005184_1738_3003 391
64 3300042010 Ga0439452_001220 Ga0439452_001220_3943_5208 391
65 3300048924 Ga0496121_0091756 Ga0496121_0091756_206_1483 391
66 3300006178 Ga0075367_10021333 Ga0075367_100213334 392
67 3300050494 nmdc:mga06z11_73409_c1 nmdc:mga06z11_73409_c1_267_1544 392
68 3300001979 JGI24740J21852_10023233 JGI24740J21852_100232331 393
69 3300046615 Ga0495656_0000146 Ga0495656_0000146_17558_18835 394
70 3300005434 Ga0070709_10184216 Ga0070709_101842161 395
71 3300005435 Ga0070714_100032836 Ga0070714_1000328362 395
72 3300005437 Ga0070710_10044593 Ga0070710_100445932 395
73 3300005439 Ga0070711_100023449 Ga0070711_1000234493 395
74 3300005458 Ga0070681_10119815 Ga0070681_101198152 395
75 3300005546 Ga0070696_100001208 Ga0070696_1000012084 395
76 3300013104 Ga0157370_10013135 Ga0157370_100131353 395
77 3300025906 Ga0207699_10011256 Ga0207699_100112562 395
78 3300025929 Ga0207664_10019464 Ga0207664_100194643 395
79 3300025940 Ga0207691_10003024 Ga0207691_100030242 396
80 3300028794 Ga0307515_10000459 Ga0307515_1000045936 396
81 3300031649 Ga0307514_10009341 Ga0307514_100093414 396
82 3300042876 Ga0451577_0005817 Ga0451577_0005817_10670_11950 396
83 3300044673 Ga0453683_0002555 Ga0453683_0002555_6832_8109 396
84 3300045051 Ga0451576_0106333 Ga0451576_0106333_842_2119 396
85 3300053139 Ga0500568_0002685 Ga0500568_0002685_2235_3509 396
86 3300005834 Ga0068851_10006728 Ga0068851_100067286 397
87 3300037471 Ga0395905_0000712 Ga0395905_0000712_42221_43498 397
88 3300049580 Ga0501046_0202122 Ga0501046_0202122_13_1209 397
89 3300006847 Ga0075431_100126214 Ga0075431_1001262141 398
90 3300005327 Ga0070658_10264806 Ga0070658_102648061 400
91 3300006195 Ga0075366_10014610 Ga0075366_100146104 400
92 3300006353 Ga0075370_10006193 Ga0075370_100061934 400
93 3300025292 Ga0209676_1014977 Ga0209676_10149773 400
94 3300025295 Ga0209564_1006417 Ga0209564_10064175 400
95 3300050496 nmdc:mga07m45_7933_c1 nmdc:mga07m45_7933_c1_850_2127 400
96 3300002774 JGI25150J39212_1009474 JGI25150J39212_10094742 401
97 3300002987 JGI25159J45721_1005016 JGI25159J45721_10050164 401
98 3300003187 JGI25151J46595_10004229 JGI25151J46595_100042296 401
99 3300003771 Ga0055526_1003224 Ga0055526_10032247 401
100 3300003773 Ga0055537_1000086 Ga0055537_100008663 401
101 3300003775 Ga0055524_1000279 Ga0055524_100027920 401
102 3300003781 Ga0055536_1001302 Ga0055536_10013027 401
103 3300003784 Ga0055534_1002371 Ga0055534_10023715 401
104 3300003790 Ga0055528_1001037 Ga0055528_100103717 401
105 3300003791 Ga0055530_10001255 Ga0055530_1000125512 401
106 3300003792 Ga0055540_1000553 Ga0055540_10005537 401
107 3300003794 Ga0055531_10000726 Ga0055531_1000072620 401
108 3300025245 Ga0207425_1004043 Ga0207425_10040434 401
109 3300025263 Ga0209565_1000028 Ga0209565_100002878 401
110 3300025273 Ga0209673_1000035 Ga0209673_1000035257 401
111 3300025284 Ga0209130_1000759 Ga0209130_100075920 401
112 3300025291 Ga0209675_1000111 Ga0209675_100011114 401
113 3300025292 Ga0209676_1000634 Ga0209676_100063443 401
114 3300025294 Ga0209025_1001864 Ga0209025_100186411 401
115 3300025295 Ga0209564_1000714 Ga0209564_100071417 401
116 3300025298 Ga0209050_1000023 Ga0209050_1000023524 401
117 3300025299 Ga0209256_1000003 Ga0209256_10000031274 401
118 3300025302 Ga0207426_1007615 Ga0207426_10076153 401
119 3300025303 Ga0209051_1000017 Ga0209051_1000017524 401
120 3300025304 Ga0209257_1000041 Ga0209257_1000041524 401
121 3300026023 Ga0207677_10024740 Ga0207677_100247403 401
122 3300049571 Ga0501034_0060330 Ga0501034_0060330_481_1758 401
123 3300049574 Ga0501038_0204250 Ga0501038_0204250_116_1393 401
124 3300049580 Ga0501046_0045145 Ga0501046_0045145_1137_2414 401
125 3300049822 Ga0501035_0133202 Ga0501035_0133202_79_1356 401
126 3300049823 Ga0501044_0073607 Ga0501044_0073607_1459_2736 401
127 3300005289 Ga0065704_10101719 Ga0065704_101017192 403
128 3300025294 Ga0209025_1012212 Ga0209025_10122124 403
129 3300003773 Ga0055537_1000067 Ga0055537_100006718 404
130 3300003784 Ga0055534_1000079 Ga0055534_100007950 404
131 3300003790 Ga0055528_1005743 Ga0055528_10057433 404
132 3300003790 Ga0055528_1013543 Ga0055528_10135432 404
133 3300003792 Ga0055540_1001982 Ga0055540_10019828 404
134 3300006048 Ga0075363_100017606 Ga0075363_1000176063 404
135 3300006051 Ga0075364_10070465 Ga0075364_100704652 404
136 3300006353 Ga0075370_10000356 Ga0075370_1000035610 404
137 3300006846 Ga0075430_100071251 Ga0075430_1000712512 404
138 3300006948 Ga0099826_10023668 Ga0099826_100236683 404
139 3300025263 Ga0209565_1000040 Ga0209565_100004011 404
140 3300025273 Ga0209673_1000109 Ga0209673_1000109152 404
141 3300025273 Ga0209673_1016224 Ga0209673_10162243 404
142 3300025291 Ga0209675_1000024 Ga0209675_1000024257 404
143 3300025294 Ga0209025_1007844 Ga0209025_10078444 404
144 3300025299 Ga0209256_1000262 Ga0209256_100026273 404
145 3300025303 Ga0209051_1000262 Ga0209051_100026271 404
146 3300032004 Ga0307414_10033311 Ga0307414_100333112 404
147 3300003781 Ga0055536_1009975 Ga0055536_10099754 405
148 3300003791 Ga0055530_10006113 Ga0055530_100061136 405
149 3300003792 Ga0055540_1008030 Ga0055540_10080303 405
150 3300003794 Ga0055531_10000873 Ga0055531_100008733 405
151 3300005457 Ga0070662_100005845 Ga0070662_1000058455 405
152 3300006353 Ga0075370_10000594 Ga0075370_100005944 405
153 3300009036 Ga0105244_10007302 Ga0105244_100073024 405
154 3300009148 Ga0105243_10001470 Ga0105243_100014704 405
155 3300011119 Ga0105246_10010775 Ga0105246_100107755 405
156 3300014497 Ga0182008_10002376 Ga0182008_100023762 405
157 3300015261 Ga0182006_1001221 Ga0182006_10012216 405
158 3300015262 Ga0182007_10014003 Ga0182007_100140033 405
159 3300025291 Ga0209675_1002085 Ga0209675_10020852 405
160 3300025292 Ga0209676_1000254 Ga0209676_100025464 405
161 3300025298 Ga0209050_1000497 Ga0209050_100049718 405
162 3300025298 Ga0209050_1021478 Ga0209050_10214782 405
163 3300025303 Ga0209051_1000073 Ga0209051_1000073154 405
164 3300025304 Ga0209257_1000139 Ga0209257_1000139111 405
165 3300025728 Ga0207655_1005174 Ga0207655_10051749 405
166 3300025933 Ga0207706_10021250 Ga0207706_100212502 405
167 3300025935 Ga0207709_10012378 Ga0207709_100123784 405
168 3300025981 Ga0207640_10054019 Ga0207640_100540192 405
169 3300026116 Ga0207674_10036688 Ga0207674_100366886 405
170 3300030745 Ga0316182_1304162 Ga0316182_13041623 405
171 3300031456 Ga0307513_10000006 Ga0307513_10000006400 405
172 3300032004 Ga0307414_10225540 Ga0307414_102255402 405
173 3300005334 Ga0068869_100019711 Ga0068869_1000197114 406
174 3300005338 Ga0068868_100007098 Ga0068868_1000070982 406
175 3300005354 Ga0070675_100030142 Ga0070675_1000301423 406
176 3300005355 Ga0070671_100008962 Ga0070671_1000089628 406
177 3300005367 Ga0070667_100041161 Ga0070667_1000411612 406
178 3300005459 Ga0068867_100016876 Ga0068867_1000168763 406
179 3300005543 Ga0070672_100003001 Ga0070672_1000030013 406
180 3300009148 Ga0105243_10047232 Ga0105243_100472324 406
181 3300009177 Ga0105248_10353814 Ga0105248_103538142 406
182 3300013308 Ga0157375_10140524 Ga0157375_101405243 406
183 3300025927 Ga0207687_10069268 Ga0207687_100692681 406
184 3300025931 Ga0207644_10008876 Ga0207644_100088764 406
185 3300025935 Ga0207709_10098779 Ga0207709_100987792 406
186 3300025940 Ga0207691_10007242 Ga0207691_100072423 406
187 3300025942 Ga0207689_10013046 Ga0207689_100130463 406
188 3300026089 Ga0207648_10005567 Ga0207648_100055679 406
189 3300026116 Ga0207674_10016785 Ga0207674_100167857 406
190 3300031548 Ga0307408_100000048 Ga0307408_10000004826 406
191 3300031901 Ga0307406_10000230 Ga0307406_1000023013 406
192 3300031548 Ga0307408_100008225 Ga0307408_1000082252 407
193 3300031901 Ga0307406_10007292 Ga0307406_100072925 407
194 3300037471 Ga0395905_0015534 Ga0395905_0015534_431_1738 407
195 3300003771 Ga0055526_1007263 Ga0055526_10072633 408
196 3300005262 Ga0065165_1017048 Ga0065165_10170482 408
197 3300014497 Ga0182008_10000330 Ga0182008_100003303 408
198 3300025258 Ga0209129_1011509 Ga0209129_10115092 408
199 3300025294 Ga0209025_1006211 Ga0209025_10062114 408
200 3300025294 Ga0209025_1030314 Ga0209025_10303142 408
201 3300025295 Ga0209564_1000531 Ga0209564_100053115 408
202 3300025298 Ga0209050_1011144 Ga0209050_10111444 408
203 3300048920 Ga0496117_0069370 Ga0496117_0069370_694_1959 408
204 3300048920 Ga0496117_0084692 Ga0496117_0084692_660_1925 408
205 3300048921 Ga0496118_0012844 Ga0496118_0012844_6509_7774 408
206 3300048921 Ga0496118_0072911 Ga0496118_0072911_1085_2350 408
207 3300048922 Ga0496119_0002124 Ga0496119_0002124_1407_2672 408
208 3300048924 Ga0496121_0004468 Ga0496121_0004468_286_1551 408
209 3300048924 Ga0496121_0098322 Ga0496121_0098322_136_1401 408
210 3300048925 Ga0496122_0001381 Ga0496122_0001381_913_2178 408
211 3300048926 Ga0496123_0000411 Ga0496123_0000411_15195_16460 408
212 3300048926 Ga0496123_0020434 Ga0496123_0020434_3884_5149 408
213 3300048927 Ga0496124_0047036 Ga0496124_0047036_1118_2383 408
214 3300048928 Ga0496125_0000011 Ga0496125_0000011_601615_602880 408
215 3300048928 Ga0496125_0038753 Ga0496125_0038753_1803_3068 408
216 3300048928 Ga0496125_0084167 Ga0496125_0084167_778_2043 408
217 3300048929 Ga0496126_0135864 Ga0496126_0135864_721_1986 408
218 3300050496 nmdc:mga07m45_103_c1 nmdc:mga07m45_103_c1_31728_32993 408
219 3300006038 Ga0075365_10011447 Ga0075365_100114474 409
220 3300009551 Ga0105238_10308570 Ga0105238_103085701 409
221 3300031548 Ga0307408_100015366 Ga0307408_1000153665 409
222 3300031548 Ga0307408_100202555 Ga0307408_1002025551 409
223 3300031901 Ga0307406_10002497 Ga0307406_100024978 409
224 3300032002 Ga0307416_100058229 Ga0307416_1000582292 409
225 3300041451 Ga0451791_0804086 Ga0451791_0804086_450_1727 409
226 3300053093 Ga0500651_0000738 Ga0500651_0000738_991_2268 409
227 3300053134 Ga0500658_0002871 Ga0500658_0002871_3796_5073 409
228 3300053153 Ga0500616_0067329 Ga0500616_0067329_335_1612 409
229 3300003781 Ga0055536_1005425 Ga0055536_10054253 410
230 3300003791 Ga0055530_10000730 Ga0055530_1000073028 410
231 3300003791 Ga0055530_10002701 Ga0055530_1000270110 410
232 3300003792 Ga0055540_1015457 Ga0055540_10154573 410
233 3300003794 Ga0055531_10021958 Ga0055531_100219582 410
234 3300005338 Ga0068868_100174807 Ga0068868_1001748072 410
235 3300005548 Ga0070665_100155907 Ga0070665_1001559072 410
236 3300025245 Ga0207425_1005751 Ga0207425_10057512 410
237 3300025258 Ga0209129_1004105 Ga0209129_10041055 410
238 3300025284 Ga0209130_1008079 Ga0209130_10080795 410
239 3300025292 Ga0209676_1000005 Ga0209676_1000005237 410
240 3300025294 Ga0209025_1023144 Ga0209025_10231442 410
241 3300025297 Ga0209758_1019515 Ga0209758_10195152 410
242 3300025298 Ga0209050_1000007 Ga0209050_1000007860 410
243 3300025302 Ga0207426_1011012 Ga0207426_10110125 410
244 3300025303 Ga0209051_1000009 Ga0209051_1000009237 410
245 3300025304 Ga0209257_1000011 Ga0209257_1000011211 410
246 3300028379 Ga0268266_10032977 Ga0268266_100329774 410
247 3300037418 Ga0395900_0112019 Ga0395900_0112019_37_1314 410
248 3300038443 Ga0395901_0251092 Ga0395901_0251092_357_1634 410
249 3300003792 Ga0055540_1006694 Ga0055540_10066942 411
250 3300003794 Ga0055531_10000269 Ga0055531_1000026928 411
251 3300006175 Ga0070712_100155778 Ga0070712_1001557782 411
252 3300025206 Ga0209435_100014 Ga0209435_100014222 411
253 3300025246 Ga0209646_1000001 Ga0209646_1000001222 411
254 3300025250 Ga0209026_1000137 Ga0209026_100013768 411
255 3300025256 Ga0209759_1000013 Ga0209759_1000013222 411
256 3300025273 Ga0209673_1025579 Ga0209673_10255791 411
257 3300025303 Ga0209051_1000136 Ga0209051_10001363 411
258 3300025304 Ga0209257_1000055 Ga0209257_1000055186 411
259 3300025298 Ga0209050_1001842 Ga0209050_10018422 412
260 3300030500 Ga0268256_1018069 Ga0268256_10180692 412
261 3300002773 JGI25152J39213_1003568 JGI25152J39213_10035684 413
262 3300002987 JGI25159J45721_1007514 JGI25159J45721_10075142 413
263 3300003187 JGI25151J46595_10016629 JGI25151J46595_100166292 413
264 3300003215 JGI25153J46596_10014853 JGI25153J46596_100148532 413
265 3300005262 Ga0065165_1037361 Ga0065165_10373611 413
266 3300037312 Ga0395899_0090032 Ga0395899_0090032_206_1483 414
267 3300037418 Ga0395900_0029291 Ga0395900_0029291_4127_5404 414
268 3300049579 Ga0501043_0001751 Ga0501043_0001751_17103_18452 415
269 3300049580 Ga0501046_0008135 Ga0501046_0008135_7552_8901 415
270 3300049581 Ga0501047_0000546 Ga0501047_0000546_39021_40370 415
271 3300037418 Ga0395900_0040371 Ga0395900_0040371_1831_3084 416
272 iso_pu_bacteria 2643221734 2644736450 416
273 iso_pu_bacteria 2885192300 2885196292 416
274 iso_pu_bacteria 2891048133 2891050328 416
275 iso_pu_bacteria 2990710928 2990712185 416
276 iso_pu_bacteria 2995392953 2995392963 416
277 3300003751 Ga0055538_1000696 Ga0055538_10006968 417
278 3300025224 Ga0209784_100072 Ga0209784_100072140 417
279 3300048925 Ga0496122_0000584 Ga0496122_0000584_37936_39213 417
280 3300048926 Ga0496123_0000308 Ga0496123_0000308_85237_86514 417
281 iso_pu_bacteria 2508501050 2508732217 417
282 iso_pu_bacteria 2899275550 2899277710 417
283 iso_pu_bacteria 8048746797 8048747491 417
284 iso_pu_bacteria 2857609550 2857613026 418
285 iso_pu_bacteria 2990275345 2990278212 418
286 iso_pu_bacteria 3001892409 3001896602 418
287 iso_pu_bacteria 8057632132 8057634679 418
288 3300002704 JGI25155J39150_1000090 JGI25155J39150_100009016 419
289 3300002705 JGI25156J39149_1000148 JGI25156J39149_100014816 419
290 3300002738 JGI25154J39366_1000155 JGI25154J39366_100015517 419
291 3300002741 JGI25157J39369_1000183 JGI25157J39369_100018331 419
292 3300031456 Ga0307513_10000011 Ga0307513_1000001171 419
293 3300031456 Ga0307513_10177870 Ga0307513_101778702 419
294 3300053730 Ga0500645_000320 Ga0500645_000320_58_1335 419
295 3300053730 Ga0500645_010338 Ga0500645_010338_835_2112 419
296 iso_pu_bacteria 2837678835 2837679671 419
297 iso_pu_bacteria 2842333319 2842337126 419
298 iso_pu_bacteria 2857576091 2857578486 419
299 iso_pu_bacteria 2932422444 2932425705 419
300 3300027252 Ga0209973_1001030 Ga0209973_10010303 420
301 iso_pu_bacteria 2511231002 2511244870 420
302 iso_pu_bacteria 2643221570 2643866627 420
303 iso_pu_bacteria 2643221596 2643991393 420
304 iso_pu_bacteria 2643221603 2644031416 420
305 iso_pu_bacteria 2643221609 2644062776 420
306 iso_pu_bacteria 2643221611 2644076729 420
307 iso_pu_bacteria 2643221628 2644162919 420
308 iso_pu_bacteria 2643221652 2644296318 420
309 iso_pu_bacteria 2643221658 2644329534 420
310 iso_pu_bacteria 2643221672 2644398302 420
311 iso_pu_bacteria 2643221683 2644465371 420
312 iso_pu_bacteria 2643221717 2644647721 420
313 iso_pu_bacteria 2738541277 2738722864 420
314 iso_pu_bacteria 2738543019 2739283435 420
315 iso_pu_bacteria 2739367655 2739611207 420
316 iso_pu_bacteria 2831265667 2831270400 420
317 iso_pu_bacteria 2842677519 2842680122 420
318 iso_pu_bacteria 2842747753 2842748127 420
319 iso_pu_bacteria 2881101125 2881101402 420
320 iso_pu_bacteria 2881927736 2881929963 420
321 iso_pu_bacteria 2883577096 2883577491 420
322 iso_pu_bacteria 2885198086 2885199762 420
323 iso_pu_bacteria 2885211737 2885213413 420
324 iso_pu_bacteria 2887375801 2887376340 420
325 iso_pu_bacteria 2894023352 2894025540 420
326 iso_pu_bacteria 2904449895 2904454712 420
327 iso_pu_bacteria 2904456579 2904460365 420
328 iso_pu_bacteria 2919462493 2919464172 420
329 iso_pu_bacteria 2928115317 2928120324 420
330 iso_pu_bacteria 2929199973 2929205158 420
331 iso_pu_bacteria 2929520902 2929524562 420
332 iso_pu_bacteria 2945945610 2945946988 420
333 iso_pu_bacteria 2954767861 2954771732 420
334 iso_pu_bacteria 8002392321 8002392454 420
335 iso_pu_bacteria 8048746797 8048747627 420
336 iso_pu_bacteria 8055909800 8055915153 420
337 iso_pu_bacteria 2599185292 2599906115 421
338 iso_pu_bacteria 2643221569 2643861899 421
339 iso_pu_bacteria 2643221594 2643979937 421
340 iso_pu_bacteria 2643221621 2644122532 421
341 iso_pu_bacteria 2808606395 2809031616 421
342 iso_pu_bacteria 2857537821 2857540854 421
343 iso_pu_bacteria 2858950400 2858956424 421
344 iso_pu_bacteria 2919704043 2919706493 421
345 iso_pu_bacteria 2941479691 2941485824 421
346 iso_pu_bacteria 2915650412 2915654302 422
347 iso_pu_bacteria 8054563764 8054566788 422
348 3300045051 Ga0451576_0000647 Ga0451576_0000647_31414_32694 423
349 3300053153 Ga0500616_0038155 Ga0500616_0038155_47_1321 423
350 3300005719 Ga0068861_100010403 Ga0068861_1000104036 424
351 3300005844 Ga0068862_100030325 Ga0068862_1000303254 424
352 3300006042 Ga0075368_10007677 Ga0075368_100076772 424
353 3300031730 Ga0307516_10029170 Ga0307516_100291702 424
354 3300032004 Ga0307414_10071895 Ga0307414_100718952 424
355 3300049569 Ga0501032_0000816 Ga0501032_0000816_11120_12397 424
356 3300049570 Ga0501033_0001967 Ga0501033_0001967_1703_2980 424
357 3300049571 Ga0501034_0010232 Ga0501034_0010232_4015_5292 424
358 3300049571 Ga0501034_0142113 Ga0501034_0142113_517_1794 424
359 3300049572 Ga0501036_0010724 Ga0501036_0010724_2284_3561 424
360 3300049573 Ga0501037_0001800 Ga0501037_0001800_14234_15511 424
361 3300049574 Ga0501038_0001840 Ga0501038_0001840_14837_16114 424
362 3300049579 Ga0501043_0001690 Ga0501043_0001690_3513_4790 424
363 3300049580 Ga0501046_0022258 Ga0501046_0022258_3285_4562 424
364 3300049581 Ga0501047_0020111 Ga0501047_0020111_5043_6320 424
365 3300049822 Ga0501035_0000874 Ga0501035_0000874_17952_19229 424
366 3300049823 Ga0501044_0001518 Ga0501044_0001518_14568_15845 424
367 3300050494 nmdc:mga06z11_5176_c1 nmdc:mga06z11_5176_c1_2739_4016 424
368 3300050496 nmdc:mga07m45_37969_c1 nmdc:mga07m45_37969_c1_748_2025 424
369 3300001976 JGI24752J21851_1003145 JGI24752J21851_10031452 427
370 3300009545 Ga0105237_10071049 Ga0105237_100710492 427
371 3300025914 Ga0207671_10255189 Ga0207671_102551891 427
372 3300025949 Ga0207667_10050331 Ga0207667_100503313 427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06808

DctM

Tripartite ATP-independent periplasmic transporter, DctM component

1

444

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.9112 5 426
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.8781 5 423
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.861 5 423
6okz-assembly2.cif.gz_A structure of vcindy bound to fumarate 0.7012 2 425
6okz-assembly2.cif.gz_A structure of vcindy bound to fumarate 0.6625 2 425
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7077 3 411 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6913 3 411 1.20.1530.20
af_A0A0P0XTE2_9_123_1.20.5.4130 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.3393 144 272 1.20.5.4130
af_A0A0P0XTE2_9_123_1.20.5.4130 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.3241 144 272 1.20.5.4130
2xm0A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.3105 124 253 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A3R7PPI7-F1-model_v4 TRAP transporter large permease 0.9779 1 427 GO:0005886
GO:0022857
AF-A0A6P1ZNI8-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.9778 1 427 GO:0005886
GO:0022857
AF-A0A3R7PPI7-F1-model_v4 TRAP transporter large permease 0.9756 1 427 GO:0005886
GO:0022857
AF-A0A6P1ZNI8-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.9755 1 427 GO:0005886
GO:0022857
AF-A0A6P1AQJ2-F1-model_v4 deleted 0.9729 3 423

Feature Viewer

pLDDT pTM Quality
90.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map