F425886

General Info

Members Datasets Scaffolds Average Seq Length
371 260 742 100

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_040863|Ga0500645_040863_94_705
Length 114
Sequence MSVSIRLARGGAKKRPYYRVVVSDVRAPRDGKYLEQIGTYNPVLAKDDPARVKINEDRARYWLSVGAQPSDRVARFFDAAGIQERKARNNPNKAEPGDKAKERAEEKVEEKAEG

Samples

Sample ID Description Type Environment
1 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
179 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
220 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
237 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
252 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
253 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
254 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
255 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
256 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
257 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
258 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
259 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
260 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 3.77
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.63
Nodule 0
Rhizoplane 4.58
Rhizosphere 79.78
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500645_040863 3300053730 Bacteria 1371
2 JGI24749J21850_1000037 3300002076 Bacteria 24773
3 JGI24034J26672_10053669 3300002239 Bacteria 697
4 JGI24751J29686_10000052 3300002459 Bacteria 65492
5 JGI25159J45721_1024475 3300002987 Bacteria 1074
6 JGI25160J50197_1008201 3300003354 Bacteria 4000
7 Ga0065707_10093279 3300005295 Bacteria 3649
8 Ga0070670_100000024 3300005331 Bacteria 189811
9 Ga0068869_101274532 3300005334 Bacteria 648
10 Ga0070666_10190468 3300005335 Bacteria 1441
11 Ga0070666_10524588 3300005335 Bacteria 860
12 Ga0070666_11438872 3300005335 Bacteria 515
13 Ga0070680_101384845 3300005336 Bacteria 609
14 Ga0070689_100861553 3300005340 Bacteria 800
15 Ga0070687_100969903 3300005343 Bacteria 614
16 Ga0070668_100900082 3300005347 Bacteria 791
17 Ga0070669_100000047 3300005353 Bacteria 118892
18 Ga0070669_100376196 3300005353 Bacteria 1157
19 Ga0070669_101908306 3300005353 Bacteria 519
20 Ga0070671_101780738 3300005355 Bacteria 547
21 Ga0070674_100641765 3300005356 Bacteria 902
22 Ga0070673_100650510 3300005364 Bacteria 965
23 Ga0070667_100000261 3300005367 Bacteria 60134
24 Ga0070667_100000480 3300005367 Bacteria 40910
25 Ga0070667_100265751 3300005367 Bacteria 1537
26 Ga0070705_101390206 3300005440 Bacteria 585
27 Ga0068867_101281472 3300005459 Bacteria 676
28 Ga0070685_10677678 3300005466 Bacteria 750
29 Ga0068853_100045118 3300005539 Bacteria 3775
30 Ga0070704_100785616 3300005549 Bacteria 850
31 Ga0068855_100147617 3300005563 Bacteria 2676
32 Ga0068855_100827128 3300005563 Bacteria 983
33 Ga0068855_101155034 3300005563 Bacteria 807
34 Ga0068854_100530442 3300005578 Bacteria 996
35 Ga0068854_100895132 3300005578 Bacteria 780
36 Ga0068859_100023713 3300005617 Bacteria 6158
37 Ga0068864_100000036 3300005618 Bacteria 189811
38 Ga0068861_100006300 3300005719 Bacteria 8076
39 Ga0068870_10359707 3300005840 Bacteria 936
40 Ga0068863_100020734 3300005841 Bacteria 6277
41 Ga0068860_100155149 3300005843 Bacteria 2206
42 Ga0068860_100257857 3300005843 Bacteria 1699
43 Ga0068860_101074743 3300005843 Bacteria 824
44 Ga0068860_101297400 3300005843 Bacteria 749
45 Ga0068862_100000033 3300005844 Bacteria 176515
46 Ga0081455_10059189 3300005937 Bacteria 3236
47 Ga0081539_10128058 3300005985 Bacteria 1251
48 Ga0075368_10000400 3300006042 Bacteria 12709
49 Ga0075363_100123628 3300006048 Bacteria 1447
50 Ga0075367_10176523 3300006178 Bacteria 1331
51 Ga0075370_10032435 3300006353 Bacteria 2921
52 Ga0097620_100023714 3300006931 Bacteria 6158
53 Ga0105251_10287374 3300009011 Bacteria 744
54 Ga0105240_10246940 3300009093 Bacteria 2066
55 Ga0111539_10256562 3300009094 Bacteria 2036
56 Ga0105245_11009508 3300009098 Bacteria 877
57 Ga0105247_10098733 3300009101 Bacteria 1864
58 Ga0114129_10129134 3300009147 Bacteria 3473
59 Ga0105248_10000091 3300009177 Bacteria 101191
60 Ga0105248_10662829 3300009177 Bacteria 1177
61 Ga0105237_10025095 3300009545 Bacteria 6098
62 Ga0105238_10543831 3300009551 Bacteria 1165
63 Ga0105238_12356821 3300009551 Bacteria 568
64 Ga0105249_10557772 3300009553 Bacteria 1197
65 Ga0105239_10060291 3300010375 Bacteria 4164
66 Ga0105239_10564942 3300010375 Bacteria 1296
67 Ga0105239_12029060 3300010375 Bacteria 668
68 Ga0157369_10091652 3300013105 Bacteria 3244
69 Ga0157378_10999849 3300013297 Bacteria 871
70 Ga0157375_11377352 3300013308 Bacteria 831
71 Ga0163163_10817789 3300014325 Bacteria 995
72 Ga0157380_10000217 3300014326 Bacteria 34251
73 Ga0157379_10415900 3300014968 Bacteria 1238
74 Ga0157379_10420818 3300014968 Bacteria 1230
75 Ga0163161_10080849 3300017792 Bacteria 2392
76 Ga0206354_10846945 3300020081 Bacteria 956
77 Ga0213872_10000095 3300021361 Bacteria 81971
78 Ga0213872_10000813 3300021361 Bacteria 22605
79 Ga0213871_10161175 3300021441 Bacteria 686
80 Ga0209130_1000325 3300025284 Bacteria 55752
81 Ga0207426_1000066 3300025302 Bacteria 351182
82 Ga0207710_10100242 3300025900 Bacteria 1365
83 Ga0207680_10911173 3300025903 Bacteria 630
84 Ga0207643_10715389 3300025908 Bacteria 647
85 Ga0207695_10063402 3300025913 Bacteria 3811
86 Ga0207671_10017519 3300025914 Bacteria 5519
87 Ga0207671_10184944 3300025914 Bacteria 1623
88 Ga0207662_10734400 3300025918 Bacteria 693
89 Ga0207649_11101654 3300025920 Bacteria 626
90 Ga0207681_10000014 3300025923 Bacteria 353422
91 Ga0207650_10000015 3300025925 Bacteria 369173
92 Ga0207687_10522684 3300025927 Bacteria 993
93 Ga0207664_10006501 3300025929 Bacteria 8045
94 Ga0207706_10299039 3300025933 Bacteria 1402
95 Ga0207669_11109306 3300025937 Bacteria 668
96 Ga0207711_10000252 3300025941 Bacteria 57840
97 Ga0207689_10597856 3300025942 Bacteria 928
98 Ga0207689_11023555 3300025942 Bacteria 697
99 Ga0207667_10881569 3300025949 Bacteria 888
100 Ga0207667_11562578 3300025949 Bacteria 629
101 Ga0207712_11665193 3300025961 Bacteria 572
102 Ga0207668_10932121 3300025972 Bacteria 774
103 Ga0207640_10007436 3300025981 Bacteria 6046
104 Ga0207640_10056926 3300025981 Bacteria 2569
105 Ga0207658_10000247 3300025986 Bacteria 56367
106 Ga0207658_10003592 3300025986 Bacteria 10960
107 Ga0207658_10409852 3300025986 Bacteria 1193
108 Ga0207658_11542628 3300025986 Bacteria 607
109 Ga0207639_10085475 3300026041 Bacteria 2509
110 Ga0207678_10580998 3300026067 Bacteria 981
111 Ga0207641_10039290 3300026088 Bacteria 3957
112 Ga0207641_10366850 3300026088 Bacteria 1376
113 Ga0207676_10000021 3300026095 Bacteria 296572
114 Ga0207675_100002066 3300026118 Bacteria 20003
115 Ga0207675_100265910 3300026118 Bacteria 1663
116 Ga0207698_10218850 3300026142 Bacteria 1719
117 Ga0209813_10007013 3300027866 Bacteria 2798
118 Ga0207428_10377240 3300027907 Bacteria 1041
119 Ga0268266_10000309 3300028379 Bacteria 77336
120 Ga0268266_11272776 3300028379 Bacteria 711
121 Ga0268265_10000013 3300028380 Bacteria 341536
122 Ga0268265_10268368 3300028380 Bacteria 1521
123 Ga0268264_10042703 3300028381 Bacteria 3754
124 Ga0268264_10583614 3300028381 Bacteria 1100
125 Ga0307408_100010384 3300031548 Bacteria 6139
126 Ga0307408_100068461 3300031548 Bacteria 2614
127 Ga0265314_10029270 3300031711 Bacteria 4096
128 Ga0316576_10045730 3300031727 Bacteria 3167
129 Ga0307516_10068141 3300031730 Bacteria 3428
130 Ga0307405_10000956 3300031731 Bacteria 11553
131 Ga0307405_10310470 3300031731 Bacteria 1200
132 Ga0307413_10000474 3300031824 Bacteria 13100
133 Ga0307413_10206882 3300031824 Bacteria 1422
134 Ga0307413_11673927 3300031824 Bacteria 567
135 Ga0307413_11968286 3300031824 Bacteria 526
136 Ga0307410_10010904 3300031852 Bacteria 5173
137 Ga0307410_10017353 3300031852 Bacteria 4321
138 Ga0307406_10001163 3300031901 Bacteria 14718
139 Ga0307406_10092554 3300031901 Bacteria 2039
140 Ga0307407_10027211 3300031903 Bacteria 3038
141 Ga0307407_10339948 3300031903 Bacteria 1059
142 Ga0307412_10006564 3300031911 Bacteria 6586
143 Ga0307412_10405130 3300031911 Bacteria 1111
144 Ga0307409_100014276 3300031995 Bacteria 5157
145 Ga0307409_100173868 3300031995 Bacteria 1898
146 Ga0307409_100447334 3300031995 Bacteria 1246
147 Ga0307409_100453800 3300031995 Bacteria 1238
148 Ga0307409_100822198 3300031995 Bacteria 938
149 Ga0307416_100000539 3300032002 Bacteria 19259
150 Ga0307416_101335697 3300032002 Bacteria 823
151 Ga0307414_10012634 3300032004 Bacteria 5003
152 Ga0307414_10017946 3300032004 Bacteria 4340
153 Ga0307414_10247903 3300032004 Bacteria 1478
154 Ga0307414_10353337 3300032004 Bacteria 1262
155 Ga0307411_10005729 3300032005 Bacteria 6139
156 Ga0307411_10039065 3300032005 Bacteria 2999
157 Ga0307411_10219333 3300032005 Bacteria 1474
158 Ga0307415_100002134 3300032126 Bacteria 9793
159 Ga0307415_100254340 3300032126 Bacteria 1429
160 Ga0307415_100379901 3300032126 Bacteria 1199
161 Ga0373929_0087449 3300035085 Bacteria 768
162 Ga0373945_0139726 3300035116 Bacteria 976
163 Ga0373943_0072967 3300035170 Bacteria 1742
164 Ga0316574_0017907 3300035398 Bacteria 4153
165 Ga0373931_0323036 3300035691 Bacteria 959
166 Ga0316582_0353701 3300036647 Bacteria 1011
167 Ga0316584_0227815 3300036712 Bacteria 1367
168 Ga0395899_0003143 3300037312 Bacteria 13127
169 Ga0395899_0174854 3300037312 Bacteria 1510
170 Ga0395899_0313169 3300037312 Bacteria 1059
171 Ga0395900_0014920 3300037418 Bacteria 7917
172 Ga0395900_0143320 3300037418 Bacteria 2445
173 Ga0395898_0119935 3300037466 Bacteria 2520
174 Ga0395898_0244496 3300037466 Bacteria 1711
175 Ga0395898_0281478 3300037466 Bacteria 1586
176 Ga0395905_0816846 3300037471 Bacteria 835
177 Ga0436364_1444884 3300037853 Bacteria 1081
178 Ga0436365_0718560 3300039437 Bacteria 848
179 Ga0436365_1301094 3300039437 Bacteria 725
180 Ga0436360_1011484 3300039438 Bacteria 1256
181 Ga0436360_1076255 3300039438 Bacteria 842
182 Ga0436360_1241767 3300039438 Bacteria 2090
183 Ga0436361_0278001 3300039447 Bacteria 62683
184 Ga0436361_0977465 3300039447 Bacteria 986
185 Ga0436361_1031382 3300039447 Bacteria 1284
186 Ga0439461_0100720 3300041410 Bacteria 703
187 Ga0439466_0223499 3300041411 Bacteria 571
188 Ga0439465_0011752 3300041413 Bacteria 2743
189 Ga0439465_0020653 3300041413 Bacteria 2063
190 Ga0439465_0130264 3300041413 Bacteria 887
191 Ga0451789_1120689 3300041443 Bacteria 1212
192 Ga0451797_0677879 3300041453 Bacteria 667
193 Ga0451802_1736450 3300041460 Bacteria 636
194 Ga0451807_0040971 3300041486 Bacteria 1080
195 Ga0451849_0080106 3300041505 Bacteria 515
196 Ga0451843_1434471 3300041509 Bacteria 866
197 Ga0439445_0010175 3300042004 Bacteria 2223
198 Ga0439445_0093101 3300042004 Bacteria 850
199 Ga0439432_062943 3300042006 Bacteria 1141
200 Ga0439449_0291360 3300042007 Bacteria 616
201 Ga0439434_0081198 3300042435 Bacteria 1029
202 Ga0451577_0385908 3300042876 Bacteria 1271
203 Ga0466965_0062922 3300044683 Bacteria 1857
204 Ga0466971_0207115 3300044719 Bacteria 927
205 Ga0466968_0383833 3300044735 Bacteria 686
206 Ga0466957_0020669 3300044842 Bacteria 3875
207 Ga0451576_0004114 3300045051 Bacteria 19182
208 Ga0495585_0241304 3300046492 Bacteria 905
209 Ga0495637_0021931 3300046520 Bacteria 2920
210 Ga0495643_0026858 3300046522 Bacteria 3242
211 Ga0495648_0303809 3300046524 Bacteria 746
212 Ga0495654_0385949 3300046530 Bacteria 558
213 Ga0495621_0108289 3300046539 Bacteria 1063
214 Ga0495597_0005247 3300046542 Bacteria 6886
215 Ga0495668_0043519 3300046616 Bacteria 2497
216 Ga0495668_0088730 3300046616 Bacteria 1695
217 Ga0495625_0179602 3300046660 Bacteria 1408
218 Ga0495659_0097963 3300046664 Bacteria 1133
219 Ga0495669_0016010 3300046684 Bacteria 3210
220 Ga0495649_0259206 3300046694 Bacteria 892
221 Ga0495676_0303415 3300047321 Bacteria 1076
222 Ga0495686_0200656 3300047472 Bacteria 1145
223 Ga0495615_0075054 3300048090 Bacteria 918
224 Ga0496100_0257901 3300048903 Bacteria 1292
225 Ga0496102_0319384 3300048905 Bacteria 1463
226 Ga0496102_0751948 3300048905 Bacteria 898
227 Ga0496104_0146279 3300048907 Bacteria 2269
228 Ga0496106_0069345 3300048909 Bacteria 2691
229 Ga0496108_0126917 3300048911 Bacteria 2191
230 Ga0496110_0208819 3300048913 Bacteria 1775
231 Ga0496110_0262355 3300048913 Bacteria 1572
232 Ga0496110_0645319 3300048913 Bacteria 958
233 Ga0496111_0062814 3300048914 Bacteria 2693
234 Ga0496112_0014406 3300048915 Bacteria 7333
235 Ga0496114_0797184 3300048917 Bacteria 823
236 Ga0496115_0005696 3300048918 Bacteria 9065
237 Ga0496116_0000089 3300048919 Bacteria 213129
238 Ga0496117_0046781 3300048920 Bacteria 3109
239 Ga0496117_0208912 3300048920 Bacteria 1096
240 Ga0496118_0008121 3300048921 Bacteria 10931
241 Ga0496121_0016815 3300048924 Bacteria 7524
242 Ga0496121_0074915 3300048924 Bacteria 2705
243 Ga0496121_0109837 3300048924 Bacteria 2106
244 Ga0496122_0074056 3300048925 Bacteria 2411
245 Ga0496124_0052104 3300048927 Bacteria 3479
246 Ga0496124_0422572 3300048927 Bacteria 918
247 Ga0496125_0017155 3300048928 Bacteria 6920
248 Ga0496126_0411009 3300048929 Bacteria 1096
249 Ga0496126_0589755 3300048929 Bacteria 877
250 Ga0501308_051381 3300049128 Bacteria 604
251 Ga0501300_035665 3300049523 Bacteria 741
252 Ga0501317_080691 3300049533 Bacteria 562
253 Ga0501031_0053738 3300049568 Bacteria 2625
254 Ga0501031_0417557 3300049568 Bacteria 867
255 Ga0501031_0534299 3300049568 Unclassified 756
256 Ga0501032_0004409 3300049569 Bacteria 10626
257 Ga0501032_0517717 3300049569 Bacteria 762
258 Ga0501033_0003989 3300049570 Bacteria 11948
259 Ga0501033_0117057 3300049570 Bacteria 1936
260 Ga0501034_0050645 3300049571 Bacteria 4188
261 Ga0501034_0136830 3300049571 Bacteria 2430
262 Ga0501034_0237779 3300049571 Bacteria 1768
263 Ga0501034_0322691 3300049571 Bacteria 1477
264 Ga0501036_0002826 3300049572 Bacteria 13756
265 Ga0501036_0186045 3300049572 Bacteria 1748
266 Ga0501037_0022689 3300049573 Bacteria 4640
267 Ga0501037_0362799 3300049573 Bacteria 998
268 Ga0501037_0409359 3300049573 Bacteria 929
269 Ga0501038_0001541 3300049574 Bacteria 21266
270 Ga0501039_0003789 3300049575 Bacteria 11364
271 Ga0501039_0158429 3300049575 Bacteria 1779
272 Ga0501041_0098443 3300049577 Bacteria 1809
273 Ga0501043_0006080 3300049579 Bacteria 9699
274 Ga0501046_0011189 3300049580 Bacteria 7687
275 Ga0501046_0294195 3300049580 Bacteria 1187
276 Ga0501046_0679814 3300049580 Bacteria 726
277 Ga0501047_0020813 3300049581 Bacteria 6301
278 Ga0501047_0162576 3300049581 Bacteria 2104
279 Ga0501047_0396706 3300049581 Bacteria 1213
280 Ga0501047_0461846 3300049581 Bacteria 1098
281 Ga0501048_0068114 3300049582 Bacteria 2515
282 Ga0501067_0020723 3300049583 Bacteria 3637
283 Ga0501068_0141444 3300049584 Bacteria 1508
284 Ga0501068_0176796 3300049584 Bacteria 1349
285 Ga0501069_0002189 3300049585 Bacteria 9837
286 Ga0501070_0050069 3300049586 Bacteria 3468
287 Ga0501070_0296096 3300049586 Bacteria 1319
288 Ga0501071_0105254 3300049587 Bacteria 2083
289 Ga0501071_1015018 3300049587 Bacteria 641
290 Ga0501072_0088318 3300049588 Bacteria 2460
291 Ga0501072_0534673 3300049588 Bacteria 926
292 Ga0501072_1280495 3300049588 Bacteria 568
293 Ga0501073_0001924 3300049589 Bacteria 15457
294 Ga0501073_0102036 3300049589 Bacteria 1992
295 Ga0501074_0001417 3300049590 Bacteria 15966
296 Ga0501074_0052741 3300049590 Bacteria 2935
297 Ga0501075_0165180 3300049591 Bacteria 1689
298 Ga0501075_1408637 3300049591 Bacteria 528
299 Ga0501076_0027164 3300049592 Bacteria 4440
300 Ga0501077_0003238 3300049593 Bacteria 9804
301 Ga0501209_116250 3300049656 Bacteria 791
302 Ga0501257_000039 3300049686 Bacteria 37011
303 Ga0501079_0001921 3300049741 Bacteria 14881
304 Ga0501079_0222502 3300049741 Bacteria 1475
305 Ga0501079_0251158 3300049741 Bacteria 1382
306 Ga0501080_0015009 3300049742 Bacteria 7135
307 Ga0501080_0318050 3300049742 Bacteria 1409
308 Ga0501081_0231721 3300049743 Bacteria 1345
309 Ga0501081_0299249 3300049743 Bacteria 1180
310 Ga0501081_0564140 3300049743 Bacteria 851
311 Ga0501083_0022269 3300049744 Bacteria 4396
312 Ga0501083_0030404 3300049744 Bacteria 3711
313 Ga0501273_014702 3300049770 Bacteria 1010
314 Ga0501035_0115393 3300049822 Bacteria 2351
315 Ga0501035_0451630 3300049822 Bacteria 1063
316 Ga0501044_0010456 3300049823 Bacteria 10071
317 Ga0501044_0472364 3300049823 Bacteria 1158
318 Ga0501044_0493180 3300049823 Bacteria 1127
319 Ga0501044_1043027 3300049823 Bacteria 688
320 Ga0501045_0059149 3300049824 Bacteria 2807
321 nmdc:mga03n38_33641_c1 3300050490 Bacteria 2182
322 nmdc:mga04h51_1642_c1 3300050495 Bacteria 5219
323 nmdc:mga08y16_959004_c1 3300050511 Bacteria 838
324 nmdc:mga0n895_225509_c1 3300050512 Bacteria 1902
325 nmdc:mga0a205_136502_c1 3300050515 Bacteria 2353
326 Ga0500647_0203905 3300053091 Bacteria 895
327 Ga0500566_0091322 3300053094 Bacteria 1683
328 Ga0500566_0096511 3300053094 Bacteria 1627
329 Ga0500650_0224677 3300053098 Bacteria 849
330 Ga0500562_000084 3300053108 Bacteria 39703
331 Ga0500592_010133 3300053116 Bacteria 1501
332 Ga0500608_099140 3300053122 Bacteria 1352
333 Ga0500614_003545 3300053123 Bacteria 3351
334 Ga0500618_021838 3300053125 Bacteria 1560
335 Ga0500642_0007308 3300053130 Bacteria 3703
336 Ga0500652_194744 3300053131 Bacteria 825
337 Ga0500655_000098 3300053133 Bacteria 22758
338 Ga0500577_0069178 3300053142 Bacteria 1380
339 Ga0500588_0000232 3300053146 Bacteria 7967
340 Ga0500590_001847 3300053148 Bacteria 8996
341 Ga0500622_0132496 3300053156 Bacteria 1197
342 Ga0500639_034893 3300053163 Bacteria 2657
343 Ga0500636_0172087 3300053177 Bacteria 1170
344 Ga0500637_0011486 3300053178 Bacteria 4584
345 Ga0500570_001992 3300053724 Bacteria 9845
346 Ga0501084_0003247 3300054114 Bacteria 13161
347 Ga0501084_0061754 3300054114 Bacteria 3137
348 Ga0587084_011847 3300059477 Bacteria 1170
349 Ga0587077_012701 3300059493 Bacteria 1351
350 Ga0587090_010280 3300059510 Bacteria 1295
351 Ga0587098_010748 3300059604 Bacteria 1018
352 Ga0587101_006075 3300059623 Bacteria 1368
353 Ga0587062_013799 3300059639 Bacteria 1058
354 Ga0587068_022810 3300059641 Bacteria 1039
355 Ga0587076_009989 3300059645 Bacteria 1360
356 Ga0587078_001792 3300059646 Bacteria 1988
357 Ga0587111_0015422 3300060346 Bacteria 1396
358 Ga0587111_0037403 3300060346 Bacteria 1020
359 Ga0501082_0152923 3300060353 Bacteria 2004
360 Ga0501082_0754623 3300060353 Bacteria 851
361 Ga0466962_0048430 3300061719 Bacteria 2031
362 Ga0530510_0161141 3300061734 Bacteria 1659
363 2512032294 2511231221 Bacteria 6846400
364 2523103092 2522572158 Bacteria 6514390
365 2524609411 2524023250 Bacteria 5457705
366 2585260002 2582581305 Bacteria 4895574
367 2821450768 2821443989 Bacteria 7658172
368 2844534008 2844533157 Bacteria 7517899
369 2846955090 2846952575 Bacteria 6587527
370 2848858617 2848858292 Bacteria 7391279
371 8054005191 8054002106 Bacteria 7987183
372 Ga0500645_040863
373 JGI24749J21850_1000037
374 JGI24034J26672_10053669
375 JGI24751J29686_10000052
376 JGI25159J45721_1024475
377 JGI25160J50197_1008201
378 Ga0065707_10093279
379 Ga0070670_100000024
380 Ga0068869_101274532
381 Ga0070666_10190468
382 Ga0070666_10524588
383 Ga0070666_11438872
384 Ga0070680_101384845
385 Ga0070689_100861553
386 Ga0070687_100969903
387 Ga0070668_100900082
388 Ga0070669_100000047
389 Ga0070669_100376196
390 Ga0070669_101908306
391 Ga0070671_101780738
392 Ga0070674_100641765
393 Ga0070673_100650510
394 Ga0070667_100000261
395 Ga0070667_100000480
396 Ga0070667_100265751
397 Ga0070705_101390206
398 Ga0068867_101281472
399 Ga0070685_10677678
400 Ga0068853_100045118
401 Ga0070704_100785616
402 Ga0068855_100147617
403 Ga0068855_100827128
404 Ga0068855_101155034
405 Ga0068854_100530442
406 Ga0068854_100895132
407 Ga0068859_100023713
408 Ga0068864_100000036
409 Ga0068861_100006300
410 Ga0068870_10359707
411 Ga0068863_100020734
412 Ga0068860_100155149
413 Ga0068860_100257857
414 Ga0068860_101074743
415 Ga0068860_101297400
416 Ga0068862_100000033
417 Ga0081455_10059189
418 Ga0081539_10128058
419 Ga0075368_10000400
420 Ga0075363_100123628
421 Ga0075367_10176523
422 Ga0075370_10032435
423 Ga0097620_100023714
424 Ga0105251_10287374
425 Ga0105240_10246940
426 Ga0111539_10256562
427 Ga0105245_11009508
428 Ga0105247_10098733
429 Ga0114129_10129134
430 Ga0105248_10000091
431 Ga0105248_10662829
432 Ga0105237_10025095
433 Ga0105238_10543831
434 Ga0105238_12356821
435 Ga0105249_10557772
436 Ga0105239_10060291
437 Ga0105239_10564942
438 Ga0105239_12029060
439 Ga0157369_10091652
440 Ga0157378_10999849
441 Ga0157375_11377352
442 Ga0163163_10817789
443 Ga0157380_10000217
444 Ga0157379_10415900
445 Ga0157379_10420818
446 Ga0163161_10080849
447 Ga0206354_10846945
448 Ga0213872_10000095
449 Ga0213872_10000813
450 Ga0213871_10161175
451 Ga0209130_1000325
452 Ga0207426_1000066
453 Ga0207710_10100242
454 Ga0207680_10911173
455 Ga0207643_10715389
456 Ga0207695_10063402
457 Ga0207671_10017519
458 Ga0207671_10184944
459 Ga0207662_10734400
460 Ga0207649_11101654
461 Ga0207681_10000014
462 Ga0207650_10000015
463 Ga0207687_10522684
464 Ga0207664_10006501
465 Ga0207706_10299039
466 Ga0207669_11109306
467 Ga0207711_10000252
468 Ga0207689_10597856
469 Ga0207689_11023555
470 Ga0207667_10881569
471 Ga0207667_11562578
472 Ga0207712_11665193
473 Ga0207668_10932121
474 Ga0207640_10007436
475 Ga0207640_10056926
476 Ga0207658_10000247
477 Ga0207658_10003592
478 Ga0207658_10409852
479 Ga0207658_11542628
480 Ga0207639_10085475
481 Ga0207678_10580998
482 Ga0207641_10039290
483 Ga0207641_10366850
484 Ga0207676_10000021
485 Ga0207675_100002066
486 Ga0207675_100265910
487 Ga0207698_10218850
488 Ga0209813_10007013
489 Ga0207428_10377240
490 Ga0268266_10000309
491 Ga0268266_11272776
492 Ga0268265_10000013
493 Ga0268265_10268368
494 Ga0268264_10042703
495 Ga0268264_10583614
496 Ga0307408_100010384
497 Ga0307408_100068461
498 Ga0265314_10029270
499 Ga0316576_10045730
500 Ga0307516_10068141
501 Ga0307405_10000956
502 Ga0307405_10310470
503 Ga0307413_10000474
504 Ga0307413_10206882
505 Ga0307413_11673927
506 Ga0307413_11968286
507 Ga0307410_10010904
508 Ga0307410_10017353
509 Ga0307406_10001163
510 Ga0307406_10092554
511 Ga0307407_10027211
512 Ga0307407_10339948
513 Ga0307412_10006564
514 Ga0307412_10405130
515 Ga0307409_100014276
516 Ga0307409_100173868
517 Ga0307409_100447334
518 Ga0307409_100453800
519 Ga0307409_100822198
520 Ga0307416_100000539
521 Ga0307416_101335697
522 Ga0307414_10012634
523 Ga0307414_10017946
524 Ga0307414_10247903
525 Ga0307414_10353337
526 Ga0307411_10005729
527 Ga0307411_10039065
528 Ga0307411_10219333
529 Ga0307415_100002134
530 Ga0307415_100254340
531 Ga0307415_100379901
532 Ga0373929_0087449
533 Ga0373945_0139726
534 Ga0373943_0072967
535 Ga0316574_0017907
536 Ga0373931_0323036
537 Ga0316582_0353701
538 Ga0316584_0227815
539 Ga0395899_0003143
540 Ga0395899_0174854
541 Ga0395899_0313169
542 Ga0395900_0014920
543 Ga0395900_0143320
544 Ga0395898_0119935
545 Ga0395898_0244496
546 Ga0395898_0281478
547 Ga0395905_0816846
548 Ga0436364_1444884
549 Ga0436365_0718560
550 Ga0436365_1301094
551 Ga0436360_1011484
552 Ga0436360_1076255
553 Ga0436360_1241767
554 Ga0436361_0278001
555 Ga0436361_0977465
556 Ga0436361_1031382
557 Ga0439461_0100720
558 Ga0439466_0223499
559 Ga0439465_0011752
560 Ga0439465_0020653
561 Ga0439465_0130264
562 Ga0451789_1120689
563 Ga0451797_0677879
564 Ga0451802_1736450
565 Ga0451807_0040971
566 Ga0451849_0080106
567 Ga0451843_1434471
568 Ga0439445_0010175
569 Ga0439445_0093101
570 Ga0439432_062943
571 Ga0439449_0291360
572 Ga0439434_0081198
573 Ga0451577_0385908
574 Ga0466965_0062922
575 Ga0466971_0207115
576 Ga0466968_0383833
577 Ga0466957_0020669
578 Ga0451576_0004114
579 Ga0495585_0241304
580 Ga0495637_0021931
581 Ga0495643_0026858
582 Ga0495648_0303809
583 Ga0495654_0385949
584 Ga0495621_0108289
585 Ga0495597_0005247
586 Ga0495668_0043519
587 Ga0495668_0088730
588 Ga0495625_0179602
589 Ga0495659_0097963
590 Ga0495669_0016010
591 Ga0495649_0259206
592 Ga0495676_0303415
593 Ga0495686_0200656
594 Ga0495615_0075054
595 Ga0496100_0257901
596 Ga0496102_0319384
597 Ga0496102_0751948
598 Ga0496104_0146279
599 Ga0496106_0069345
600 Ga0496108_0126917
601 Ga0496110_0208819
602 Ga0496110_0262355
603 Ga0496110_0645319
604 Ga0496111_0062814
605 Ga0496112_0014406
606 Ga0496114_0797184
607 Ga0496115_0005696
608 Ga0496116_0000089
609 Ga0496117_0046781
610 Ga0496117_0208912
611 Ga0496118_0008121
612 Ga0496121_0016815
613 Ga0496121_0074915
614 Ga0496121_0109837
615 Ga0496122_0074056
616 Ga0496124_0052104
617 Ga0496124_0422572
618 Ga0496125_0017155
619 Ga0496126_0411009
620 Ga0496126_0589755
621 Ga0501308_051381
622 Ga0501300_035665
623 Ga0501317_080691
624 Ga0501031_0053738
625 Ga0501031_0417557
626 Ga0501031_0534299
627 Ga0501032_0004409
628 Ga0501032_0517717
629 Ga0501033_0003989
630 Ga0501033_0117057
631 Ga0501034_0050645
632 Ga0501034_0136830
633 Ga0501034_0237779
634 Ga0501034_0322691
635 Ga0501036_0002826
636 Ga0501036_0186045
637 Ga0501037_0022689
638 Ga0501037_0362799
639 Ga0501037_0409359
640 Ga0501038_0001541
641 Ga0501039_0003789
642 Ga0501039_0158429
643 Ga0501041_0098443
644 Ga0501043_0006080
645 Ga0501046_0011189
646 Ga0501046_0294195
647 Ga0501046_0679814
648 Ga0501047_0020813
649 Ga0501047_0162576
650 Ga0501047_0396706
651 Ga0501047_0461846
652 Ga0501048_0068114
653 Ga0501067_0020723
654 Ga0501068_0141444
655 Ga0501068_0176796
656 Ga0501069_0002189
657 Ga0501070_0050069
658 Ga0501070_0296096
659 Ga0501071_0105254
660 Ga0501071_1015018
661 Ga0501072_0088318
662 Ga0501072_0534673
663 Ga0501072_1280495
664 Ga0501073_0001924
665 Ga0501073_0102036
666 Ga0501074_0001417
667 Ga0501074_0052741
668 Ga0501075_0165180
669 Ga0501075_1408637
670 Ga0501076_0027164
671 Ga0501077_0003238
672 Ga0501209_116250
673 Ga0501257_000039
674 Ga0501079_0001921
675 Ga0501079_0222502
676 Ga0501079_0251158
677 Ga0501080_0015009
678 Ga0501080_0318050
679 Ga0501081_0231721
680 Ga0501081_0299249
681 Ga0501081_0564140
682 Ga0501083_0022269
683 Ga0501083_0030404
684 Ga0501273_014702
685 Ga0501035_0115393
686 Ga0501035_0451630
687 Ga0501044_0010456
688 Ga0501044_0472364
689 Ga0501044_0493180
690 Ga0501044_1043027
691 Ga0501045_0059149
692 nmdc:mga03n38_33641_c1
693 nmdc:mga04h51_1642_c1
694 nmdc:mga08y16_959004_c1
695 nmdc:mga0n895_225509_c1
696 nmdc:mga0a205_136502_c1
697 Ga0500647_0203905
698 Ga0500566_0091322
699 Ga0500566_0096511
700 Ga0500650_0224677
701 Ga0500562_000084
702 Ga0500592_010133
703 Ga0500608_099140
704 Ga0500614_003545
705 Ga0500618_021838
706 Ga0500642_0007308
707 Ga0500652_194744
708 Ga0500655_000098
709 Ga0500577_0069178
710 Ga0500588_0000232
711 Ga0500590_001847
712 Ga0500622_0132496
713 Ga0500639_034893
714 Ga0500636_0172087
715 Ga0500637_0011486
716 Ga0500570_001992
717 Ga0501084_0003247
718 Ga0501084_0061754
719 Ga0587084_011847
720 Ga0587077_012701
721 Ga0587090_010280
722 Ga0587098_010748
723 Ga0587101_006075
724 Ga0587062_013799
725 Ga0587068_022810
726 Ga0587076_009989
727 Ga0587078_001792
728 Ga0587111_0015422
729 Ga0587111_0037403
730 Ga0501082_0152923
731 Ga0501082_0754623
732 Ga0466962_0048430
733 Ga0530510_0161141
734 2512032294
735 2523103092
736 2524609411
737 2585260002
738 2821450768
739 2844534008
740 2846955090
741 2848858617
742 8054005191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00886

Ribosomal_S16

Ribosomal protein S16

9

70

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cdv-assembly1.cif.gz_P rnase r bound to a 30s degradation intermediate (state ii) 0.9473 2 82
7p7u-assembly1.cif.gz_q e. faecalis 70s ribosome with p-trna, state iv 0.9428 2 82
8ced-assembly1.cif.gz_P rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.942 2 82
5mmm-assembly1.cif.gz_p structure of the 70s chloroplast ribosome 0.9407 3 82
7jil-assembly1.cif.gz_u 70s ribosome flavobacterium johnsoniae 0.9362 2 82
ID Description Score Start End Superfamily
af_Q2FZ45_1_91_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.9406 1 82 3.30.1320.10
af_P56806_1_79_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.9196 3 85 3.30.1320.10
5x8rp00 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8977 3 85 3.30.1320.10
af_P56806_1_79_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8976 3 85 3.30.1320.10
af_A0A0R0FN90_1_75_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8951 17 82 3.30.1320.10
ID Description Score Start End GO Terms
AF-A0A2D7IHL7-F1-model_v4 30S ribosomal protein S16 0.9787 1 85 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V2WYE7-F1-model_v4 Small ribosomal subunit protein bS16 0.9767 1 83 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A075MP32-F1-model_v4 Small ribosomal subunit protein bS16 0.9757 1 83 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A4Q7DMT3-F1-model_v4 Small ribosomal subunit protein bS16 0.974 1 79 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A3T0GI49-F1-model_v4 Small ribosomal subunit protein bS16 0.9719 1 81 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904

Map