F425877

General Info

Members Datasets Scaffolds Average Seq Length
371 197 355 218

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_27598_c1|nmdc:mga03n38_27598_c1_1360_2142
Length 260
Sequence MPNIAQDQIADCAASRKAAPIGSRAPSLTHDQGWRKDMHLKKMMIVAAMGAMGTALATAPAQAKQGDVLVRVRGIMVAPTEKSGSILPGFPGEKVSVNNGIAPEVDVTYMATDHIGFELIAATTKHSASGRSGTTGGIGKLASTWVLPPTLTMQYHPIVEGHVRPYIGAGVNYTLFYNEDASSGLEDAVGKTKVHMSDSFGWAGQIGVDIDLNDKIFLNLDVKYIDIDTKVRLTTAAAGTQNVKVSLDPFVFGVGVGMRF

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
7 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
8 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
9 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
10 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
11 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
12 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
13 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
14 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
15 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
16 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
17 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
188 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
189 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
192 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
197 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 0
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.09
Nodule 0
Rhizoplane 2.43
Rhizosphere 75.2
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000172 3300001904 Bacteria 11486
2 JGI24741J21665_1000143 3300001915 Bacteria 19927
3 JGI24740J21852_10001999 3300001979 Bacteria 9315
4 JGI24740J21852_10020121 3300001979 Bacteria 2336
5 JGI24739J22299_10009114 3300001989 Bacteria 3701
6 JGI24739J22299_10027014 3300001989 Bacteria 2009
7 JGI24739J22299_10027022 3300001989 Bacteria 2009
8 JGI24739J22299_10084381 3300001989 Bacteria 972
9 JGI24737J22298_10010302 3300001990 Bacteria 3088
10 JGI24737J22298_10053777 3300001990 Bacteria 1219
11 JGI24735J21928_10006332 3300002067 Bacteria 3904
12 JGI24735J21928_10016351 3300002067 Bacteria 2304
13 JGI24735J21928_10027603 3300002067 Bacteria 1700
14 JGI24735J21928_10029434 3300002067 Bacteria 1635
15 JGI24735J21928_10043793 3300002067 Bacteria 1301
16 JGI24738J21930_10000746 3300002075 Bacteria 9358
17 JGI24751J29686_10000202 3300002459 Bacteria 25902
18 JGI24751J29686_10033264 3300002459 Bacteria 1069
19 JGI25165J46597_1000138 3300003214 Bacteria 121773
20 rootH2_10074017 3300003320 Bacteria 1264
21 rootH2_10147975 3300003320 Bacteria 1997
22 rootL2_10039746 3300003322 Bacteria 1598
23 rootL2_10098425 3300003322 Bacteria 4563
24 Ga0065704_10098595 3300005289 Bacteria 2346
25 Ga0065704_10138758 3300005289 Bacteria 1540
26 Ga0065704_10313492 3300005289 Bacteria 864
27 Ga0065707_10085901 3300005295 Bacteria 5807
28 Ga0065707_10131960 3300005295 Bacteria 1905
29 Ga0070658_10062302 3300005327 Bacteria 3039
30 Ga0070658_10161699 3300005327 Bacteria 1879
31 Ga0070658_10489864 3300005327 Bacteria 1061
32 Ga0070670_100000339 3300005331 Bacteria 39253
33 Ga0070670_100006458 3300005331 Bacteria 9928
34 Ga0070666_10002112 3300005335 Bacteria 12076
35 Ga0070660_100038969 3300005339 Bacteria 3611
36 Ga0070660_100142601 3300005339 Bacteria 1923
37 Ga0070661_100013900 3300005344 Bacteria 5657
38 Ga0070661_100024469 3300005344 Bacteria 4331
39 Ga0070668_100000005 3300005347 Bacteria 187511
40 Ga0070668_100000623 3300005347 Bacteria 23826
41 Ga0070668_100004784 3300005347 Bacteria 10042
42 Ga0070668_100016994 3300005347 Bacteria 5442
43 Ga0070669_100000345 3300005353 Bacteria 36221
44 Ga0070669_100021568 3300005353 Bacteria 4603
45 Ga0070669_100080816 3300005353 Bacteria 2420
46 Ga0070671_100000027 3300005355 Bacteria 114189
47 Ga0070671_100443490 3300005355 Bacteria 1113
48 Ga0070659_100029626 3300005366 Bacteria 4230
49 Ga0070659_100181260 3300005366 Bacteria 1729
50 Ga0070659_100233644 3300005366 Bacteria 1520
51 Ga0070667_100000004 3300005367 Bacteria 444091
52 Ga0070667_100000053 3300005367 Bacteria 151974
53 Ga0070667_100000300 3300005367 Bacteria 55347
54 Ga0070667_100001960 3300005367 Bacteria 18263
55 Ga0070667_100120651 3300005367 Bacteria 2280
56 Ga0070667_100137847 3300005367 Bacteria 2134
57 Ga0070663_100000791 3300005455 Bacteria 17178
58 Ga0070663_100171390 3300005455 Bacteria 1678
59 Ga0070662_100015656 3300005457 Bacteria 5084
60 Ga0068853_100217557 3300005539 Bacteria 1743
61 Ga0070665_100257333 3300005548 Bacteria 1747
62 Ga0070665_100392187 3300005548 Bacteria 1396
63 Ga0068855_100070229 3300005563 Bacteria 4075
64 Ga0068855_100348993 3300005563 Bacteria 1630
65 Ga0070664_100007138 3300005564 Bacteria 9009
66 Ga0070664_100171695 3300005564 Bacteria 1923
67 Ga0068857_100033940 3300005577 Bacteria 4514
68 Ga0068854_100066012 3300005578 Bacteria 2632
69 Ga0068856_100013336 3300005614 Bacteria 7957
70 Ga0068856_100028092 3300005614 Bacteria 5491
71 Ga0068856_100033854 3300005614 Bacteria 5004
72 Ga0068852_100001796 3300005616 Bacteria 14563
73 Ga0068859_100015701 3300005617 Bacteria 7610
74 Ga0068859_100037383 3300005617 Bacteria 4872
75 Ga0068859_100061074 3300005617 Bacteria 3797
76 Ga0068859_100064440 3300005617 Bacteria 3697
77 Ga0068859_100071734 3300005617 Bacteria 3499
78 Ga0068859_100211845 3300005617 Bacteria 2024
79 Ga0068864_100000233 3300005618 Bacteria 49794
80 Ga0068864_100000379 3300005618 Bacteria 38803
81 Ga0068861_100001389 3300005719 Bacteria 15208
82 Ga0068861_100006505 3300005719 Bacteria 7965
83 Ga0068851_10012564 3300005834 Bacteria 3994
84 Ga0068863_100000169 3300005841 Bacteria 70831
85 Ga0068863_100000180 3300005841 Bacteria 67219
86 Ga0068863_100004491 3300005841 Bacteria 13762
87 Ga0068863_100006692 3300005841 Bacteria 11310
88 Ga0068863_100020486 3300005841 Bacteria 6320
89 Ga0068863_100048642 3300005841 Bacteria 4021
90 Ga0068863_100121782 3300005841 Bacteria 2488
91 Ga0068858_100001972 3300005842 Bacteria 20980
92 Ga0068858_100003843 3300005842 Bacteria 14850
93 Ga0068858_100023698 3300005842 Bacteria 5718
94 Ga0068860_100000002 3300005843 Bacteria 627849
95 Ga0068860_100000224 3300005843 Bacteria 88107
96 Ga0068860_100007032 3300005843 Bacteria 11270
97 Ga0068860_100036246 3300005843 Bacteria 4727
98 Ga0068860_100366497 3300005843 Bacteria 1420
99 Ga0068862_100000288 3300005844 Bacteria 55742
100 Ga0068862_100003522 3300005844 Bacteria 13428
101 Ga0068862_100081841 3300005844 Bacteria 2801
102 Ga0068862_100370982 3300005844 Bacteria 1332
103 Ga0075368_10002263 3300006042 Bacteria 6257
104 Ga0075363_100016268 3300006048 Bacteria 3673
105 Ga0075367_10013196 3300006178 Bacteria 4433
106 Ga0075370_10184646 3300006353 Bacteria 1228
107 Ga0097620_100015701 3300006931 Bacteria 7610
108 Ga0097620_100037382 3300006931 Bacteria 4872
109 Ga0097620_100061074 3300006931 Bacteria 3797
110 Ga0097620_100064441 3300006931 Bacteria 3697
111 Ga0097620_100071734 3300006931 Bacteria 3499
112 Ga0097620_100211846 3300006931 Bacteria 2024
113 Ga0105251_10197272 3300009011 Bacteria 907
114 Ga0105240_10003469 3300009093 Bacteria 24462
115 Ga0105240_10759762 3300009093 Bacteria 1053
116 Ga0105247_10005393 3300009101 Bacteria 8060
117 Ga0105247_10149653 3300009101 Bacteria 1537
118 Ga0105247_10541041 3300009101 Bacteria 855
119 Ga0105243_10125756 3300009148 Bacteria 2168
120 Ga0105241_10001752 3300009174 Bacteria 16461
121 Ga0105241_10394288 3300009174 Bacteria 1213
122 Ga0105248_10001248 3300009177 Bacteria 28422
123 Ga0105248_10008636 3300009177 Bacteria 11190
124 Ga0105248_10051469 3300009177 Bacteria 4621
125 Ga0105248_10072902 3300009177 Bacteria 3860
126 Ga0105248_10086898 3300009177 Bacteria 3519
127 Ga0105248_10621969 3300009177 Bacteria 1218
128 Ga0105237_10018944 3300009545 Bacteria 7112
129 Ga0105237_10042359 3300009545 Bacteria 4591
130 Ga0105237_10137364 3300009545 Bacteria 2439
131 Ga0105237_10238037 3300009545 Bacteria 1821
132 Ga0105238_10528923 3300009551 Bacteria 1182
133 Ga0105249_10000053 3300009553 Bacteria 168010
134 Ga0105249_10074047 3300009553 Bacteria 3151
135 Ga0105249_10098448 3300009553 Bacteria 2747
136 Ga0105148_100595 3300009978 Bacteria 3020
137 Ga0105239_10831097 3300010375 Bacteria 1059
138 Ga0157373_10031392 3300013100 Bacteria 3824
139 Ga0157373_10196253 3300013100 Bacteria 1423
140 Ga0157373_10280346 3300013100 Bacteria 1181
141 Ga0157371_10124961 3300013102 Bacteria 1829
142 Ga0157370_10006473 3300013104 Bacteria 12913
143 Ga0157370_10027954 3300013104 Bacteria 5556
144 Ga0157369_10019643 3300013105 Bacteria 7562
145 Ga0157369_10169432 3300013105 Bacteria 2301
146 Ga0157378_10016553 3300013297 Bacteria 6458
147 Ga0157372_10829655 3300013307 Bacteria 1074
148 Ga0157380_10001252 3300014326 Bacteria 16487
149 Ga0157379_10059854 3300014968 Bacteria 3406
150 Ga0163161_10071432 3300017792 Bacteria 2540
151 Ga0209147_101608 3300025229 Bacteria 7581
152 Ga0209437_108849 3300025233 Bacteria 1594
153 Ga0209233_1000182 3300025261 Bacteria 137671
154 Ga0207656_10015814 3300025321 Bacteria 2926
155 Ga0207656_10031333 3300025321 Bacteria 2203
156 Ga0207710_10001187 3300025900 Bacteria 13232
157 Ga0207680_10001628 3300025903 Bacteria 10621
158 Ga0207647_10005479 3300025904 Bacteria 9290
159 Ga0207647_10009755 3300025904 Bacteria 6814
160 Ga0207647_10061799 3300025904 Bacteria 2284
161 Ga0207705_10047370 3300025909 Bacteria 3091
162 Ga0207654_10002334 3300025911 Bacteria 9737
163 Ga0207654_10023203 3300025911 Bacteria 3320
164 Ga0207695_10110243 3300025913 Bacteria 2733
165 Ga0207695_10116412 3300025913 Bacteria 2647
166 Ga0207671_10000841 3300025914 Bacteria 38929
167 Ga0207671_10016046 3300025914 Bacteria 5837
168 Ga0207657_10156363 3300025919 Bacteria 1854
169 Ga0207681_10000086 3300025923 Bacteria 81919
170 Ga0207681_10068086 3300025923 Bacteria 2471
171 Ga0207694_10021664 3300025924 Bacteria 4870
172 Ga0207694_10109830 3300025924 Bacteria 2193
173 Ga0207650_10000008 3300025925 Bacteria 498534
174 Ga0207650_10013185 3300025925 Bacteria 5721
175 Ga0207644_10000064 3300025931 Bacteria 77442
176 Ga0207644_10183322 3300025931 Bacteria 1642
177 Ga0207690_10145976 3300025932 Bacteria 1749
178 Ga0207690_10202658 3300025932 Bacteria 1508
179 Ga0207706_10026568 3300025933 Bacteria 5181
180 Ga0207706_10051736 3300025933 Bacteria 3627
181 Ga0207709_10114836 3300025935 Bacteria 1807
182 Ga0207711_10005770 3300025941 Bacteria 10458
183 Ga0207711_10008436 3300025941 Bacteria 8617
184 Ga0207711_10043735 3300025941 Bacteria 3822
185 Ga0207711_10048231 3300025941 Bacteria 3644
186 Ga0207711_10127765 3300025941 Bacteria 2276
187 Ga0207661_10272874 3300025944 Bacteria 1510
188 Ga0207679_10074649 3300025945 Bacteria 2570
189 Ga0207667_10007432 3300025949 Bacteria 13166
190 Ga0207712_10000045 3300025961 Bacteria 168093
191 Ga0207712_10060000 3300025961 Bacteria 2695
192 Ga0207712_10145068 3300025961 Bacteria 1826
193 Ga0207668_10000024 3300025972 Bacteria 131871
194 Ga0207668_10000265 3300025972 Bacteria 34885
195 Ga0207668_10000763 3300025972 Bacteria 19660
196 Ga0207668_10009189 3300025972 Bacteria 5913
197 Ga0207640_10006230 3300025981 Bacteria 6537
198 Ga0207640_10035301 3300025981 Bacteria 3128
199 Ga0207658_10000002 3300025986 Bacteria 1364188
200 Ga0207658_10000074 3300025986 Bacteria 110470
201 Ga0207658_10000258 3300025986 Bacteria 55336
202 Ga0207658_10002154 3300025986 Bacteria 14633
203 Ga0207658_10055991 3300025986 Bacteria 2924
204 Ga0207658_10087369 3300025986 Bacteria 2408
205 Ga0207703_10000409 3300026035 Bacteria 45646
206 Ga0207703_10018370 3300026035 Bacteria 5459
207 Ga0207639_10000366 3300026041 Bacteria 31310
208 Ga0207639_10055592 3300026041 Bacteria 3030
209 Ga0207678_10000979 3300026067 Bacteria 26012
210 Ga0207678_10040722 3300026067 Bacteria 4028
211 Ga0207702_10001863 3300026078 Bacteria 20726
212 Ga0207702_10006970 3300026078 Bacteria 9678
213 Ga0207702_10032045 3300026078 Bacteria 4384
214 Ga0207641_10000181 3300026088 Bacteria 87655
215 Ga0207641_10001052 3300026088 Bacteria 27867
216 Ga0207641_10008420 3300026088 Bacteria 8525
217 Ga0207641_10013982 3300026088 Bacteria 6579
218 Ga0207641_10020970 3300026088 Bacteria 5372
219 Ga0207641_10022362 3300026088 Bacteria 5205
220 Ga0207641_10048708 3300026088 Bacteria 3578
221 Ga0207676_10000150 3300026095 Bacteria 60517
222 Ga0207676_10000264 3300026095 Bacteria 45636
223 Ga0207674_10025605 3300026116 Bacteria 6285
224 Ga0207674_10044666 3300026116 Bacteria 4563
225 Ga0207674_10054315 3300026116 Bacteria 4078
226 Ga0207675_100001855 3300026118 Bacteria 21175
227 Ga0207675_100003442 3300026118 Bacteria 15473
228 Ga0207698_10001985 3300026142 Bacteria 12034
229 Ga0207698_10064298 3300026142 Bacteria 2875
230 Ga0209813_10000216 3300027866 Bacteria 17763
231 Ga0268266_11016670 3300028379 Bacteria 802
232 Ga0268265_10000049 3300028380 Bacteria 177242
233 Ga0268265_10000204 3300028380 Bacteria 68890
234 Ga0268265_10168877 3300028380 Bacteria 1867
235 Ga0268264_10000001 3300028381 Bacteria 1221000
236 Ga0268264_10000161 3300028381 Bacteria 150917
237 Ga0268264_10004989 3300028381 Bacteria 11236
238 Ga0268264_10036215 3300028381 Bacteria 4064
239 Ga0268264_10525548 3300028381 Bacteria 1157
240 Ga0316575_10201174 3300031665 Bacteria 829
241 Ga0307405_10006017 3300031731 Bacteria 5926
242 Ga0307405_10016968 3300031731 Bacteria 3985
243 Ga0307413_10066086 3300031824 Bacteria 2255
244 Ga0307410_10036598 3300031852 Bacteria 3197
245 Ga0307407_10037054 3300031903 Bacteria 2692
246 Ga0307407_10289833 3300031903 Bacteria 1137
247 Ga0307412_10002269 3300031911 Bacteria 10638
248 Ga0307409_100018365 3300031995 Bacteria 4699
249 Ga0307416_100269103 3300032002 Bacteria 1671
250 Ga0307414_10612848 3300032004 Bacteria 977
251 Ga0307411_10025715 3300032005 Bacteria 3532
252 Ga0307411_10036252 3300032005 Bacteria 3088
253 Ga0307415_100234679 3300032126 Unclassified 1480
254 Ga0307510_10000248 3300033180 Bacteria 48764
255 Ga0373927_0154046 3300035695 Bacteria 1505
256 Ga0373947_0312554 3300035725 Bacteria 1049
257 Ga0316582_0051130 3300036647 Unclassified 2621
258 Ga0395905_0370731 3300037471 Bacteria 1325
259 Ga0395905_0507235 3300037471 Bacteria 1107
260 Ga0237819_01796 3300038705 Bacteria 5001
261 Ga0495627_000110 3300046453 Bacteria 101742
262 Ga0495638_0000073 3300046460 Bacteria 164378
263 Ga0495638_0152332 3300046460 Bacteria 1340
264 Ga0495607_0029855 3300046501 Bacteria 3353
265 Ga0495583_0000087 3300046506 Bacteria 164974
266 Ga0495583_0023696 3300046506 Bacteria 3100
267 Ga0495610_0007959 3300046512 Bacteria 6955
268 Ga0495632_0001911 3300046519 Bacteria 16665
269 Ga0495648_0000049 3300046524 Bacteria 164366
270 Ga0495648_0135254 3300046524 Bacteria 1304
271 Ga0495597_0003731 3300046542 Bacteria 8696
272 Ga0495633_0213830 3300046558 Bacteria 883
273 Ga0495668_0010860 3300046616 Bacteria 5484
274 Ga0495611_0216592 3300046648 Bacteria 891
275 Ga0495671_0000042 3300046692 Bacteria 165201
276 Ga0495673_0000111 3300047469 Bacteria 164974
277 Ga0495673_0049810 3300047469 Bacteria 1842
278 Ga0495686_0000661 3300047472 Bacteria 46810
279 Ga0495686_0003752 3300047472 Bacteria 12924
280 Ga0495686_0051191 3300047472 Bacteria 2592
281 Ga0496102_0000472 3300048905 Bacteria 44602
282 Ga0496103_0000318 3300048906 Bacteria 44504
283 Ga0496110_0028275 3300048913 Bacteria 4814
284 Ga0496110_0035881 3300048913 Bacteria 4305
285 Ga0496111_0089706 3300048914 Bacteria 2252
286 Ga0496111_0279058 3300048914 Bacteria 1239
287 Ga0496112_0233658 3300048915 Bacteria 1793
288 Ga0496115_0364601 3300048918 Bacteria 1177
289 Ga0496116_0001661 3300048919 Bacteria 24466
290 Ga0496116_0178823 3300048919 Bacteria 1139
291 Ga0496117_0000946 3300048920 Bacteria 44400
292 Ga0496117_0001317 3300048920 Bacteria 36512
293 Ga0496117_0006443 3300048920 Bacteria 11880
294 Ga0496117_0007799 3300048920 Bacteria 10313
295 Ga0496117_0022559 3300048920 Bacteria 5046
296 Ga0496117_0142718 3300048920 Bacteria 1431
297 Ga0496118_0000122 3300048921 Bacteria 137396
298 Ga0496118_0000133 3300048921 Bacteria 131319
299 Ga0496118_0005916 3300048921 Bacteria 13682
300 Ga0496118_0032042 3300048921 Bacteria 4341
301 Ga0496118_0044614 3300048921 Bacteria 3470
302 Ga0496119_0046675 3300048922 Bacteria 2702
303 Ga0496119_0086391 3300048922 Bacteria 1793
304 Ga0496119_0239247 3300048922 Bacteria 920
305 Ga0496120_0080829 3300048923 Bacteria 1760
306 Ga0496121_0003614 3300048924 Bacteria 21832
307 Ga0496121_0032294 3300048924 Bacteria 4763
308 Ga0496121_0050677 3300048924 Bacteria 3504
309 Ga0496122_0000579 3300048925 Bacteria 75073
310 Ga0496122_0018110 3300048925 Bacteria 6526
311 Ga0496122_0041148 3300048925 Bacteria 3659
312 Ga0496123_0005053 3300048926 Bacteria 13486
313 Ga0496123_0020708 3300048926 Bacteria 5137
314 Ga0496123_0059143 3300048926 Bacteria 2480
315 Ga0496124_0000054 3300048927 Bacteria 252172
316 Ga0496124_0000359 3300048927 Bacteria 83092
317 Ga0496124_0004655 3300048927 Bacteria 15882
318 Ga0496124_0016798 3300048927 Bacteria 6937
319 Ga0496124_0022957 3300048927 Bacteria 5707
320 Ga0496124_0090233 3300048927 Bacteria 2500
321 Ga0496124_0142364 3300048927 Bacteria 1891
322 Ga0496125_0020671 3300048928 Bacteria 6174
323 Ga0496125_0041532 3300048928 Bacteria 3930
324 Ga0496125_0059518 3300048928 Bacteria 3077
325 Ga0496125_0105626 3300048928 Bacteria 2058
326 Ga0496125_0284530 3300048928 Bacteria 1022
327 Ga0496126_0257920 3300048929 Bacteria 1451
328 Ga0496126_0272669 3300048929 Bacteria 1404
329 Ga0495678_045097 3300049459 Bacteria 1741
330 Ga0495682_0141177 3300049460 Bacteria 860
331 Ga0501038_0020213 3300049574 Bacteria 5991
332 Ga0501223_000060 3300049663 Bacteria 35869
333 Ga0501249_000209 3300049679 Bacteria 17902
334 Ga0501225_0000021 3300049705 Bacteria 57397
335 nmdc:mga03n38_27598_c1 3300050490 Bacteria 2357
336 nmdc:mga0k408_51144_c1 3300050493 Bacteria 2393
337 nmdc:mga06z11_111_c1 3300050494 Bacteria 33603
338 nmdc:mga04h51_100_c1 3300050495 Bacteria 25673
339 nmdc:mga07m45_185710_c1 3300050496 Bacteria 1209
340 Ga0500643_000198 3300053087 Bacteria 57293
341 Ga0500651_0112343 3300053093 Bacteria 1661
342 Ga0500566_0000119 3300053094 Bacteria 40813
343 Ga0500556_0095318 3300053104 Bacteria 1141
344 Ga0500562_005202 3300053108 Bacteria 3268
345 Ga0500592_005496 3300053116 Bacteria 2017
346 Ga0500607_108524 3300053121 Bacteria 1365
347 Ga0500614_069753 3300053123 Bacteria 962
348 Ga0500642_0003892 3300053130 Bacteria 4594
349 Ga0500652_079392 3300053131 Bacteria 1366
350 Ga0500655_000102 3300053133 Bacteria 21853
351 Ga0500559_0014090 3300053136 Bacteria 3380
352 Ga0500590_013785 3300053148 Bacteria 4155
353 Ga0500622_0044529 3300053156 Bacteria 2300
354 Ga0500639_012381 3300053163 Bacteria 4478
355 Ga0500661_000340 3300055283 Bacteria 8494

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10541041 Ga0105247_105410412 179
2 3300053121 Ga0500607_108524 Ga0500607_108524_804_1352 182
3 3300047472 Ga0495686_0003752 Ga0495686_0003752_8653_9228 191
4 3300005844 Ga0068862_100370982 Ga0068862_1003709822 200
5 3300005289 Ga0065704_10313492 Ga0065704_103134921 202
6 3300009177 Ga0105248_10621969 Ga0105248_106219692 202
7 3300014326 Ga0157380_10001252 Ga0157380_1000125213 202
8 3300053104 Ga0500556_0095318 Ga0500556_0095318_432_1103 202
9 3300033180 Ga0307510_10000248 Ga0307510_1000024841 204
10 3300005355 Ga0070671_100443490 Ga0070671_1004434902 205
11 3300005367 Ga0070667_100120651 Ga0070667_1001206513 205
12 3300005617 Ga0068859_100064440 Ga0068859_1000644401 205
13 3300005618 Ga0068864_100000233 Ga0068864_10000023321 205
14 3300005841 Ga0068863_100048642 Ga0068863_1000486425 205
15 3300005842 Ga0068858_100001972 Ga0068858_10000197223 205
16 3300006931 Ga0097620_100064441 Ga0097620_1000644415 205
17 3300009101 Ga0105247_10149653 Ga0105247_101496532 205
18 3300009177 Ga0105248_10051469 Ga0105248_100514692 205
19 3300009177 Ga0105248_10086898 Ga0105248_100868982 205
20 3300009553 Ga0105249_10074047 Ga0105249_100740474 205
21 3300025931 Ga0207644_10183322 Ga0207644_101833221 205
22 3300025941 Ga0207711_10005770 Ga0207711_100057709 205
23 3300025941 Ga0207711_10043735 Ga0207711_100437352 205
24 3300025986 Ga0207658_10055991 Ga0207658_100559911 205
25 3300026035 Ga0207703_10000409 Ga0207703_1000040923 205
26 3300026088 Ga0207641_10020970 Ga0207641_100209705 205
27 3300026095 Ga0207676_10000150 Ga0207676_1000015035 205
28 3300038705 Ga0237819_01796 Ga0237819_01796_4005_4661 206
29 3300049663 Ga0501223_000060 Ga0501223_000060_13656_14318 206
30 3300049705 Ga0501225_0000021 Ga0501225_0000021_13656_14318 206
31 3300002459 JGI24751J29686_10000202 JGI24751J29686_1000020215 207
32 3300002459 JGI24751J29686_10033264 JGI24751J29686_100332642 207
33 3300005295 Ga0065707_10085901 Ga0065707_100859013 207
34 3300005331 Ga0070670_100000339 Ga0070670_10000033914 207
35 3300005331 Ga0070670_100006458 Ga0070670_1000064582 207
36 3300005347 Ga0070668_100000005 Ga0070668_10000000516 207
37 3300005353 Ga0070669_100000345 Ga0070669_10000034530 207
38 3300005353 Ga0070669_100021568 Ga0070669_1000215682 207
39 3300005355 Ga0070671_100000027 Ga0070671_10000002799 207
40 3300005367 Ga0070667_100000004 Ga0070667_10000000460 207
41 3300005367 Ga0070667_100000053 Ga0070667_100000053128 207
42 3300005367 Ga0070667_100001960 Ga0070667_10000196011 207
43 3300005617 Ga0068859_100015701 Ga0068859_1000157015 207
44 3300005617 Ga0068859_100061074 Ga0068859_1000610747 207
45 3300005617 Ga0068859_100211845 Ga0068859_1002118452 207
46 3300005618 Ga0068864_100000379 Ga0068864_10000037930 207
47 3300005719 Ga0068861_100001389 Ga0068861_10000138912 207
48 3300005841 Ga0068863_100000180 Ga0068863_10000018073 207
49 3300005841 Ga0068863_100006692 Ga0068863_10000669211 207
50 3300005842 Ga0068858_100003843 Ga0068858_1000038431 207
51 3300005843 Ga0068860_100000002 Ga0068860_10000000246 207
52 3300005843 Ga0068860_100000224 Ga0068860_10000022469 207
53 3300005844 Ga0068862_100003522 Ga0068862_10000352218 207
54 3300006931 Ga0097620_100015701 Ga0097620_1000157015 207
55 3300006931 Ga0097620_100061074 Ga0097620_1000610747 207
56 3300006931 Ga0097620_100211846 Ga0097620_1002118462 207
57 3300025923 Ga0207681_10000086 Ga0207681_1000008653 207
58 3300025923 Ga0207681_10068086 Ga0207681_100680863 207
59 3300025925 Ga0207650_10000008 Ga0207650_10000008446 207
60 3300025925 Ga0207650_10013185 Ga0207650_100131854 207
61 3300025931 Ga0207644_10000064 Ga0207644_1000006415 207
62 3300025961 Ga0207712_10145068 Ga0207712_101450682 207
63 3300025972 Ga0207668_10000024 Ga0207668_10000024131 207
64 3300025986 Ga0207658_10000002 Ga0207658_10000002353 207
65 3300025986 Ga0207658_10000074 Ga0207658_1000007486 207
66 3300025986 Ga0207658_10002154 Ga0207658_1000215412 207
67 3300026088 Ga0207641_10013982 Ga0207641_100139822 207
68 3300026088 Ga0207641_10022362 Ga0207641_100223625 207
69 3300026095 Ga0207676_10000264 Ga0207676_1000026418 207
70 3300026118 Ga0207675_100003442 Ga0207675_10000344212 207
71 3300028380 Ga0268265_10000204 Ga0268265_1000020418 207
72 3300028381 Ga0268264_10000001 Ga0268264_10000001678 207
73 3300028381 Ga0268264_10000161 Ga0268264_1000016120 207
74 3300046648 Ga0495611_0216592 Ga0495611_0216592_104_763 207
75 3300053087 Ga0500643_000198 Ga0500643_000198_46512_47171 207
76 3300053136 Ga0500559_0014090 Ga0500559_0014090_1728_2387 207
77 3300055283 Ga0500661_000340 Ga0500661_000340_3866_4525 207
78 3300003214 JGI25165J46597_1000138 JGI25165J46597_100013841 209
79 3300005841 Ga0068863_100121782 Ga0068863_1001217825 209
80 3300013297 Ga0157378_10016553 Ga0157378_100165535 209
81 3300025233 Ga0209437_108849 Ga0209437_1088492 209
82 3300025261 Ga0209233_1000182 Ga0209233_100018251 209
83 3300026088 Ga0207641_10048708 Ga0207641_100487082 209
84 3300035695 Ga0373927_0154046 Ga0373927_0154046_179_835 209
85 3300035725 Ga0373947_0312554 Ga0373947_0312554_197_853 209
86 3300046542 Ga0495597_0003731 Ga0495597_0003731_7297_7953 209
87 3300053093 Ga0500651_0112343 Ga0500651_0112343_258_914 209
88 3300053123 Ga0500614_069753 Ga0500614_069753_278_934 209
89 3300053130 Ga0500642_0003892 Ga0500642_0003892_2536_3192 209
90 3300053131 Ga0500652_079392 Ga0500652_079392_468_1124 209
91 3300053133 Ga0500655_000102 Ga0500655_000102_12416_13072 209
92 3300053148 Ga0500590_013785 Ga0500590_013785_1758_2414 209
93 3300053156 Ga0500622_0044529 Ga0500622_0044529_396_1052 209
94 3300053163 Ga0500639_012381 Ga0500639_012381_949_1605 209
95 iso_pu_bacteria 2751185897 2753763227 210
96 3300005295 Ga0065707_10131960 Ga0065707_101319603 211
97 3300005347 Ga0070668_100004784 Ga0070668_1000047848 211
98 3300005367 Ga0070667_100137847 Ga0070667_1001378473 211
99 3300005548 Ga0070665_100392187 Ga0070665_1003921871 211
100 3300005617 Ga0068859_100071734 Ga0068859_1000717343 211
101 3300005843 Ga0068860_100366497 Ga0068860_1003664972 211
102 3300005844 Ga0068862_100081841 Ga0068862_1000818412 211
103 3300006931 Ga0097620_100071734 Ga0097620_1000717343 211
104 3300009553 Ga0105249_10098448 Ga0105249_100984483 211
105 3300025229 Ga0209147_101608 Ga0209147_1016088 211
106 3300025941 Ga0207711_10127765 Ga0207711_101277652 211
107 3300025961 Ga0207712_10060000 Ga0207712_100600002 211
108 3300025972 Ga0207668_10000763 Ga0207668_1000076317 211
109 3300025986 Ga0207658_10087369 Ga0207658_100873692 211
110 3300028379 Ga0268266_11016670 Ga0268266_110166701 211
111 3300028380 Ga0268265_10168877 Ga0268265_101688772 211
112 3300028381 Ga0268264_10525548 Ga0268264_105255482 211
113 3300048920 Ga0496117_0001317 Ga0496117_0001317_7678_8340 211
114 3300048921 Ga0496118_0000122 Ga0496118_0000122_35839_36501 211
115 3300048928 Ga0496125_0284530 Ga0496125_0284530_284_946 211
116 3300053108 Ga0500562_005202 Ga0500562_005202_859_1599 211
117 iso_pu_bacteria 2599185359 2600224991 211
118 iso_pu_bacteria 2818991466 2819713235 211
119 iso_pu_bacteria 2879163058 2879164870 211
120 iso_pu_bacteria 2928526807 2928527777 211
121 iso_pu_bacteria 2928968154 2928971590 211
122 3300001989 JGI24739J22299_10027014 JGI24739J22299_100270142 212
123 3300001989 JGI24739J22299_10027022 JGI24739J22299_100270222 212
124 3300001990 JGI24737J22298_10053777 JGI24737J22298_100537772 212
125 3300002067 JGI24735J21928_10029434 JGI24735J21928_100294342 212
126 3300002067 JGI24735J21928_10043793 JGI24735J21928_100437932 212
127 3300003320 rootH2_10074017 rootH2_100740172 212
128 3300003322 rootL2_10098425 rootL2_100984254 212
129 3300005335 Ga0070666_10002112 Ga0070666_100021123 212
130 3300005347 Ga0070668_100000623 Ga0070668_10000062313 212
131 3300005366 Ga0070659_100181260 Ga0070659_1001812603 212
132 3300005367 Ga0070667_100000300 Ga0070667_10000030040 212
133 3300005457 Ga0070662_100015656 Ga0070662_1000156566 212
134 3300005548 Ga0070665_100257333 Ga0070665_1002573332 212
135 3300005577 Ga0068857_100033940 Ga0068857_1000339404 212
136 3300005614 Ga0068856_100013336 Ga0068856_1000133364 212
137 3300005616 Ga0068852_100001796 Ga0068852_1000017968 212
138 3300005617 Ga0068859_100037383 Ga0068859_1000373835 212
139 3300005841 Ga0068863_100000169 Ga0068863_10000016934 212
140 3300005841 Ga0068863_100004491 Ga0068863_1000044914 212
141 3300005842 Ga0068858_100023698 Ga0068858_1000236986 212
142 3300005843 Ga0068860_100007032 Ga0068860_10000703211 212
143 3300005843 Ga0068860_100036246 Ga0068860_1000362465 212
144 3300005844 Ga0068862_100000288 Ga0068862_10000028831 212
145 3300006931 Ga0097620_100037382 Ga0097620_1000373823 212
146 3300009545 Ga0105237_10042359 Ga0105237_100423594 212
147 3300013100 Ga0157373_10031392 Ga0157373_100313924 212
148 3300013307 Ga0157372_10829655 Ga0157372_108296552 212
149 3300025900 Ga0207710_10001187 Ga0207710_100011873 212
150 3300025903 Ga0207680_10001628 Ga0207680_100016282 212
151 3300025904 Ga0207647_10009755 Ga0207647_100097553 212
152 3300025932 Ga0207690_10145976 Ga0207690_101459761 212
153 3300025933 Ga0207706_10026568 Ga0207706_100265686 212
154 3300025961 Ga0207712_10000045 Ga0207712_10000045157 212
155 3300025972 Ga0207668_10000265 Ga0207668_1000026530 212
156 3300025986 Ga0207658_10000258 Ga0207658_1000025818 212
157 3300026035 Ga0207703_10018370 Ga0207703_100183704 212
158 3300026078 Ga0207702_10032045 Ga0207702_100320455 212
159 3300026088 Ga0207641_10000181 Ga0207641_1000018131 212
160 3300026088 Ga0207641_10001052 Ga0207641_1000105213 212
161 3300026116 Ga0207674_10044666 Ga0207674_100446665 212
162 3300028380 Ga0268265_10000049 Ga0268265_100000499 212
163 3300028381 Ga0268264_10004989 Ga0268264_100049894 212
164 3300028381 Ga0268264_10036215 Ga0268264_100362155 212
165 3300036647 Ga0316582_0051130 Ga0316582_0051130_724_1413 212
166 3300037471 Ga0395905_0370731 Ga0395905_0370731_381_1028 212
167 3300037471 Ga0395905_0507235 Ga0395905_0507235_410_1057 212
168 3300048920 Ga0496117_0006443 Ga0496117_0006443_5844_6503 212
169 3300048922 Ga0496119_0086391 Ga0496119_0086391_977_1636 212
170 3300048927 Ga0496124_0004655 Ga0496124_0004655_14716_15375 212
171 iso_pu_bacteria 2643221541 2643729534 212
172 iso_pu_bacteria 2643221606 2644043891 212
173 iso_pu_bacteria 2643221671 2644392362 212
174 3300002067 JGI24735J21928_10016351 JGI24735J21928_100163514 213
175 3300003320 rootH2_10147975 rootH2_101479754 213
176 3300005327 Ga0070658_10489864 Ga0070658_104898641 213
177 3300046460 Ga0495638_0152332 Ga0495638_0152332_460_1134 213
178 3300048914 Ga0496111_0279058 Ga0496111_0279058_36_686 213
179 3300048918 Ga0496115_0364601 Ga0496115_0364601_324_977 213
180 3300048920 Ga0496117_0007799 Ga0496117_0007799_9123_9773 213
181 3300048920 Ga0496117_0022559 Ga0496117_0022559_1297_1956 213
182 3300048920 Ga0496117_0142718 Ga0496117_0142718_373_1023 213
183 3300048921 Ga0496118_0005916 Ga0496118_0005916_699_1349 213
184 3300048921 Ga0496118_0032042 Ga0496118_0032042_3070_3729 213
185 3300048921 Ga0496118_0044614 Ga0496118_0044614_805_1455 213
186 3300048923 Ga0496120_0080829 Ga0496120_0080829_539_1189 213
187 3300048924 Ga0496121_0003614 Ga0496121_0003614_2322_2972 213
188 3300048924 Ga0496121_0050677 Ga0496121_0050677_2223_2873 213
189 3300048925 Ga0496122_0000579 Ga0496122_0000579_27902_28552 213
190 3300048925 Ga0496122_0018110 Ga0496122_0018110_5384_6034 213
191 3300048926 Ga0496123_0005053 Ga0496123_0005053_4262_4912 213
192 3300048927 Ga0496124_0022957 Ga0496124_0022957_2896_3546 213
193 3300048927 Ga0496124_0142364 Ga0496124_0142364_1139_1789 213
194 3300048928 Ga0496125_0041532 Ga0496125_0041532_811_1461 213
195 3300005614 Ga0068856_100028092 Ga0068856_1000280925 214
196 3300009093 Ga0105240_10003469 Ga0105240_100034695 214
197 3300031824 Ga0307413_10066086 Ga0307413_100660862 214
198 3300031903 Ga0307407_10037054 Ga0307407_100370543 214
199 3300031995 Ga0307409_100018365 Ga0307409_1000183653 214
200 3300032005 Ga0307411_10025715 Ga0307411_100257154 214
201 3300032126 Ga0307415_100234679 Ga0307415_1002346793 214
202 3300046506 Ga0495583_0023696 Ga0495583_0023696_1623_2282 214
203 3300046524 Ga0495648_0135254 Ga0495648_0135254_99_794 214
204 3300047472 Ga0495686_0000661 Ga0495686_0000661_26064_26717 214
205 3300047472 Ga0495686_0051191 Ga0495686_0051191_279_932 214
206 3300053094 Ga0500566_0000119 Ga0500566_0000119_39608_40258 214
207 iso_pu_bacteria 2512564014 2512642017 214
208 iso_pu_bacteria 2808606401 2809064433 214
209 iso_pu_bacteria 2808606404 2809080402 214
210 iso_pu_bacteria 2808606405 2809084765 214
211 iso_pu_bacteria 2880518877 2880519207 214
212 iso_pu_bacteria 2919709256 2919710684 214
213 3300003322 rootL2_10039746 rootL2_100397461 215
214 3300005719 Ga0068861_100006505 Ga0068861_1000065054 215
215 3300009148 Ga0105243_10125756 Ga0105243_101257563 215
216 3300009177 Ga0105248_10001248 Ga0105248_1000124826 215
217 3300009545 Ga0105237_10018944 Ga0105237_100189442 215
218 3300014968 Ga0157379_10059854 Ga0157379_100598542 215
219 3300025935 Ga0207709_10114836 Ga0207709_101148362 215
220 3300025941 Ga0207711_10008436 Ga0207711_100084365 215
221 3300026118 Ga0207675_100001855 Ga0207675_10000185518 215
222 3300031911 Ga0307412_10002269 Ga0307412_100022696 215
223 3300047469 Ga0495673_0049810 Ga0495673_0049810_1053_1772 215
224 3300048922 Ga0496119_0239247 Ga0496119_0239247_175_849 215
225 3300048926 Ga0496123_0059143 Ga0496123_0059143_971_1645 215
226 3300048927 Ga0496124_0000054 Ga0496124_0000054_10066_10740 215
227 3300048927 Ga0496124_0090233 Ga0496124_0090233_1782_2456 215
228 3300013102 Ga0157371_10124961 Ga0157371_101249612 216
229 3300013105 Ga0157369_10169432 Ga0157369_101694322 216
230 3300046501 Ga0495607_0029855 Ga0495607_0029855_1361_2044 216
231 3300048928 Ga0496125_0105626 Ga0496125_0105626_484_1215 216
232 3300049459 Ga0495678_045097 Ga0495678_045097_461_1132 216
233 iso_pu_bacteria 2946787523 2946788461 216
234 3300005347 Ga0070668_100016994 Ga0070668_1000169946 217
235 3300005841 Ga0068863_100020486 Ga0068863_1000204863 217
236 3300009101 Ga0105247_10005393 Ga0105247_100053936 217
237 3300009177 Ga0105248_10008636 Ga0105248_100086362 217
238 3300009553 Ga0105249_10000053 Ga0105249_1000005317 217
239 3300025941 Ga0207711_10048231 Ga0207711_100482312 217
240 3300025972 Ga0207668_10009189 Ga0207668_100091897 217
241 3300026088 Ga0207641_10008420 Ga0207641_100084203 217
242 3300031665 Ga0316575_10201174 Ga0316575_102011741 217
243 3300046616 Ga0495668_0010860 Ga0495668_0010860_1510_2166 217
244 3300048905 Ga0496102_0000472 Ga0496102_0000472_20618_21274 217
245 3300048906 Ga0496103_0000318 Ga0496103_0000318_23305_23961 217
246 3300048919 Ga0496116_0001661 Ga0496116_0001661_10138_10794 217
247 3300048920 Ga0496117_0000946 Ga0496117_0000946_23246_23902 217
248 3300048921 Ga0496118_0000133 Ga0496118_0000133_71436_72092 217
249 3300048922 Ga0496119_0046675 Ga0496119_0046675_1597_2253 217
250 3300048927 Ga0496124_0000359 Ga0496124_0000359_23268_23924 217
251 3300048928 Ga0496125_0059518 Ga0496125_0059518_735_1484 217
252 3300049460 Ga0495682_0141177 Ga0495682_0141177_29_685 217
253 3300049679 Ga0501249_000209 Ga0501249_000209_6573_7229 217
254 3300050493 nmdc:mga0k408_51144_c1 nmdc:mga0k408_51144_c1_289_945 217
255 3300053116 Ga0500592_005496 Ga0500592_005496_472_1128 217
256 3300001904 JGI24736J21556_1000172 JGI24736J21556_100017213 218
257 3300001915 JGI24741J21665_1000143 JGI24741J21665_100014311 218
258 3300001979 JGI24740J21852_10001999 JGI24740J21852_100019998 218
259 3300001979 JGI24740J21852_10020121 JGI24740J21852_100201211 218
260 3300001989 JGI24739J22299_10009114 JGI24739J22299_100091143 218
261 3300001989 JGI24739J22299_10084381 JGI24739J22299_100843812 218
262 3300001990 JGI24737J22298_10010302 JGI24737J22298_100103022 218
263 3300002067 JGI24735J21928_10006332 JGI24735J21928_100063322 218
264 3300002067 JGI24735J21928_10027603 JGI24735J21928_100276031 218
265 3300002075 JGI24738J21930_10000746 JGI24738J21930_100007463 218
266 3300005289 Ga0065704_10098595 Ga0065704_100985953 218
267 3300005289 Ga0065704_10138758 Ga0065704_101387582 218
268 3300005327 Ga0070658_10062302 Ga0070658_100623022 218
269 3300005327 Ga0070658_10161699 Ga0070658_101616992 218
270 3300005339 Ga0070660_100038969 Ga0070660_1000389694 218
271 3300005339 Ga0070660_100142601 Ga0070660_1001426012 218
272 3300005344 Ga0070661_100013900 Ga0070661_1000139004 218
273 3300005344 Ga0070661_100024469 Ga0070661_1000244692 218
274 3300005353 Ga0070669_100080816 Ga0070669_1000808162 218
275 3300005366 Ga0070659_100029626 Ga0070659_1000296262 218
276 3300005366 Ga0070659_100233644 Ga0070659_1002336443 218
277 3300005455 Ga0070663_100000791 Ga0070663_1000007916 218
278 3300005455 Ga0070663_100171390 Ga0070663_1001713902 218
279 3300005539 Ga0068853_100217557 Ga0068853_1002175571 218
280 3300005563 Ga0068855_100070229 Ga0068855_1000702293 218
281 3300005563 Ga0068855_100348993 Ga0068855_1003489933 218
282 3300005564 Ga0070664_100007138 Ga0070664_1000071388 218
283 3300005564 Ga0070664_100171695 Ga0070664_1001716952 218
284 3300005578 Ga0068854_100066012 Ga0068854_1000660123 218
285 3300005614 Ga0068856_100033854 Ga0068856_1000338542 218
286 3300005834 Ga0068851_10012564 Ga0068851_100125643 218
287 3300006042 Ga0075368_10002263 Ga0075368_100022632 218
288 3300006048 Ga0075363_100016268 Ga0075363_1000162684 218
289 3300006178 Ga0075367_10013196 Ga0075367_100131962 218
290 3300006353 Ga0075370_10184646 Ga0075370_101846462 218
291 3300009011 Ga0105251_10197272 Ga0105251_101972721 218
292 3300009093 Ga0105240_10759762 Ga0105240_107597621 218
293 3300009174 Ga0105241_10001752 Ga0105241_1000175210 218
294 3300009174 Ga0105241_10394288 Ga0105241_103942883 218
295 3300009177 Ga0105248_10072902 Ga0105248_100729024 218
296 3300009545 Ga0105237_10137364 Ga0105237_101373643 218
297 3300009545 Ga0105237_10238037 Ga0105237_102380371 218
298 3300009551 Ga0105238_10528923 Ga0105238_105289232 218
299 3300009978 Ga0105148_100595 Ga0105148_1005952 218
300 3300010375 Ga0105239_10831097 Ga0105239_108310971 218
301 3300013100 Ga0157373_10196253 Ga0157373_101962532 218
302 3300013100 Ga0157373_10280346 Ga0157373_102803462 218
303 3300013104 Ga0157370_10006473 Ga0157370_100064732 218
304 3300013104 Ga0157370_10027954 Ga0157370_100279545 218
305 3300013105 Ga0157369_10019643 Ga0157369_100196438 218
306 3300017792 Ga0163161_10071432 Ga0163161_100714322 218
307 3300025321 Ga0207656_10015814 Ga0207656_100158144 218
308 3300025321 Ga0207656_10031333 Ga0207656_100313332 218
309 3300025904 Ga0207647_10005479 Ga0207647_100054791 218
310 3300025904 Ga0207647_10061799 Ga0207647_100617993 218
311 3300025909 Ga0207705_10047370 Ga0207705_100473703 218
312 3300025911 Ga0207654_10002334 Ga0207654_100023341 218
313 3300025911 Ga0207654_10023203 Ga0207654_100232033 218
314 3300025913 Ga0207695_10110243 Ga0207695_101102433 218
315 3300025913 Ga0207695_10116412 Ga0207695_101164123 218
316 3300025914 Ga0207671_10000841 Ga0207671_1000084133 218
317 3300025914 Ga0207671_10016046 Ga0207671_100160463 218
318 3300025919 Ga0207657_10156363 Ga0207657_101563632 218
319 3300025924 Ga0207694_10021664 Ga0207694_100216643 218
320 3300025924 Ga0207694_10109830 Ga0207694_101098303 218
321 3300025932 Ga0207690_10202658 Ga0207690_102026583 218
322 3300025933 Ga0207706_10051736 Ga0207706_100517363 218
323 3300025944 Ga0207661_10272874 Ga0207661_102728742 218
324 3300025945 Ga0207679_10074649 Ga0207679_100746493 218
325 3300025949 Ga0207667_10007432 Ga0207667_1000743215 218
326 3300025981 Ga0207640_10006230 Ga0207640_100062308 218
327 3300025981 Ga0207640_10035301 Ga0207640_100353013 218
328 3300026041 Ga0207639_10000366 Ga0207639_100003663 218
329 3300026041 Ga0207639_10055592 Ga0207639_100555923 218
330 3300026067 Ga0207678_10000979 Ga0207678_1000097916 218
331 3300026067 Ga0207678_10040722 Ga0207678_100407225 218
332 3300026078 Ga0207702_10001863 Ga0207702_100018639 218
333 3300026078 Ga0207702_10006970 Ga0207702_100069703 218
334 3300026116 Ga0207674_10025605 Ga0207674_100256054 218
335 3300026116 Ga0207674_10054315 Ga0207674_100543152 218
336 3300026142 Ga0207698_10001985 Ga0207698_100019852 218
337 3300026142 Ga0207698_10064298 Ga0207698_100642982 218
338 3300027866 Ga0209813_10000216 Ga0209813_100002163 218
339 3300031731 Ga0307405_10006017 Ga0307405_100060175 218
340 3300031731 Ga0307405_10016968 Ga0307405_100169683 218
341 3300031852 Ga0307410_10036598 Ga0307410_100365983 218
342 3300031903 Ga0307407_10289833 Ga0307407_102898332 218
343 3300032002 Ga0307416_100269103 Ga0307416_1002691032 218
344 3300032004 Ga0307414_10612848 Ga0307414_106128482 218
345 3300032005 Ga0307411_10036252 Ga0307411_100362525 218
346 3300046453 Ga0495627_000110 Ga0495627_000110_3843_4505 218
347 3300046460 Ga0495638_0000073 Ga0495638_0000073_62114_62776 218
348 3300046506 Ga0495583_0000087 Ga0495583_0000087_62081_62743 218
349 3300046512 Ga0495610_0007959 Ga0495610_0007959_5294_5956 218
350 3300046519 Ga0495632_0001911 Ga0495632_0001911_10015_10677 218
351 3300046524 Ga0495648_0000049 Ga0495648_0000049_62114_62776 218
352 3300046558 Ga0495633_0213830 Ga0495633_0213830_73_735 218
353 3300046692 Ga0495671_0000042 Ga0495671_0000042_62308_62970 218
354 3300047469 Ga0495673_0000111 Ga0495673_0000111_102232_102894 218
355 3300048913 Ga0496110_0028275 Ga0496110_0028275_3141_3893 218
356 3300048913 Ga0496110_0035881 Ga0496110_0035881_1269_2006 218
357 3300048914 Ga0496111_0089706 Ga0496111_0089706_524_1246 218
358 3300048915 Ga0496112_0233658 Ga0496112_0233658_113_850 218
359 3300048919 Ga0496116_0178823 Ga0496116_0178823_303_1040 218
360 3300048924 Ga0496121_0032294 Ga0496121_0032294_435_1187 218
361 3300048925 Ga0496122_0041148 Ga0496122_0041148_1760_2512 218
362 3300048926 Ga0496123_0020708 Ga0496123_0020708_214_966 218
363 3300048927 Ga0496124_0016798 Ga0496124_0016798_1212_1889 218
364 3300048928 Ga0496125_0020671 Ga0496125_0020671_4305_5057 218
365 3300048929 Ga0496126_0257920 Ga0496126_0257920_412_1149 218
366 3300048929 Ga0496126_0272669 Ga0496126_0272669_60_812 218
367 3300049574 Ga0501038_0020213 Ga0501038_0020213_1346_2014 218
368 3300050490 nmdc:mga03n38_27598_c1 nmdc:mga03n38_27598_c1_1360_2142 218
369 3300050494 nmdc:mga06z11_111_c1 nmdc:mga06z11_111_c1_17239_18021 218
370 3300050495 nmdc:mga04h51_100_c1 nmdc:mga04h51_100_c1_15583_16365 218
371 3300050496 nmdc:mga07m45_185710_c1 nmdc:mga07m45_185710_c1_501_1172 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03922

OmpW

OmpW family

64

260

0.94

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

45

260

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x27-assembly1.cif.gz_X crystal structure of the outer membrane protein oprg from pseudomonas aeruginosa 0.9277 22 218
2f1t-assembly3.cif.gz_C outer membrane protein ompw 0.9223 23 218
2f1v-assembly1.cif.gz_A outer membrane protein ompw 0.9206 23 218
2f1t-assembly3.cif.gz_C outer membrane protein ompw 0.9077 23 218
2f1v-assembly1.cif.gz_A outer membrane protein ompw 0.9059 23 218
ID Description Score Start End Superfamily
2x27X00 Mainly Beta;Beta Barrel;Porin; 0.9277 22 218 2.40.160.20
2f1tA00 Mainly Beta;Beta Barrel;Porin; 0.9263 23 218 2.40.160.20
2f1tA00 Mainly Beta;Beta Barrel;Porin; 0.9116 23 218 2.40.160.20
2x27X00 Mainly Beta;Beta Barrel;Porin; 0.8716 22 218 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.7107 21 218 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A520JRN7-F1-model_v4 OmpW family protein 0.999 19 218 GO:0019867
GO:0055085
AF-A0A258TDS3-F1-model_v4 OmpW family protein 0.9942 19 218 GO:0019867
GO:0055085
AF-A0A239J7L3-F1-model_v4 Outer membrane protein 0.9895 14 218 GO:0019867
GO:0055085
AF-A0A1W9H9M4-F1-model_v4 OmpW family protein 0.9886 20 218 GO:0019867
GO:0055085
AF-A0A7Z2S5P6-F1-model_v4 Outer membrane beta-barrel protein 0.9774 14 218 GO:0019867
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.51 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map