F425877
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 371 | 197 | 355 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300050490|nmdc:mga03n38_27598_c1|nmdc:mga03n38_27598_c1_1360_2142 |
| Length | 260 |
| Sequence | MPNIAQDQIADCAASRKAAPIGSRAPSLTHDQGWRKDMHLKKMMIVAAMGAMGTALATAPAQAKQGDVLVRVRGIMVAPTEKSGSILPGFPGEKVSVNNGIAPEVDVTYMATDHIGFELIAATTKHSASGRSGTTGGIGKLASTWVLPPTLTMQYHPIVEGHVRPYIGAGVNYTLFYNEDASSGLEDAVGKTKVHMSDSFGWAGQIGVDIDLNDKIFLNLDVKYIDIDTKVRLTTAAAGTQNVKVSLDPFVFGVGVGMRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 5 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 6 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 7 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 8 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 9 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 10 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 11 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 12 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 13 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 14 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 15 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 16 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 17 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 18 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 22 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 23 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 126 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 127 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 128 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 140 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 167 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 171 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 175 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 176 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 177 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 178 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 179 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 183 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 184 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 185 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 186 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 187 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 188 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 189 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 190 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 191 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 192 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 193 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 194 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 195 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 196 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 197 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.69 |
| Metatranscriptomes | 0 |
| Isolates | 4.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.09 |
| Nodule | 0 |
| Rhizoplane | 2.43 |
| Rhizosphere | 75.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000172 | 3300001904 | Bacteria | 11486 |
| 2 | JGI24741J21665_1000143 | 3300001915 | Bacteria | 19927 |
| 3 | JGI24740J21852_10001999 | 3300001979 | Bacteria | 9315 |
| 4 | JGI24740J21852_10020121 | 3300001979 | Bacteria | 2336 |
| 5 | JGI24739J22299_10009114 | 3300001989 | Bacteria | 3701 |
| 6 | JGI24739J22299_10027014 | 3300001989 | Bacteria | 2009 |
| 7 | JGI24739J22299_10027022 | 3300001989 | Bacteria | 2009 |
| 8 | JGI24739J22299_10084381 | 3300001989 | Bacteria | 972 |
| 9 | JGI24737J22298_10010302 | 3300001990 | Bacteria | 3088 |
| 10 | JGI24737J22298_10053777 | 3300001990 | Bacteria | 1219 |
| 11 | JGI24735J21928_10006332 | 3300002067 | Bacteria | 3904 |
| 12 | JGI24735J21928_10016351 | 3300002067 | Bacteria | 2304 |
| 13 | JGI24735J21928_10027603 | 3300002067 | Bacteria | 1700 |
| 14 | JGI24735J21928_10029434 | 3300002067 | Bacteria | 1635 |
| 15 | JGI24735J21928_10043793 | 3300002067 | Bacteria | 1301 |
| 16 | JGI24738J21930_10000746 | 3300002075 | Bacteria | 9358 |
| 17 | JGI24751J29686_10000202 | 3300002459 | Bacteria | 25902 |
| 18 | JGI24751J29686_10033264 | 3300002459 | Bacteria | 1069 |
| 19 | JGI25165J46597_1000138 | 3300003214 | Bacteria | 121773 |
| 20 | rootH2_10074017 | 3300003320 | Bacteria | 1264 |
| 21 | rootH2_10147975 | 3300003320 | Bacteria | 1997 |
| 22 | rootL2_10039746 | 3300003322 | Bacteria | 1598 |
| 23 | rootL2_10098425 | 3300003322 | Bacteria | 4563 |
| 24 | Ga0065704_10098595 | 3300005289 | Bacteria | 2346 |
| 25 | Ga0065704_10138758 | 3300005289 | Bacteria | 1540 |
| 26 | Ga0065704_10313492 | 3300005289 | Bacteria | 864 |
| 27 | Ga0065707_10085901 | 3300005295 | Bacteria | 5807 |
| 28 | Ga0065707_10131960 | 3300005295 | Bacteria | 1905 |
| 29 | Ga0070658_10062302 | 3300005327 | Bacteria | 3039 |
| 30 | Ga0070658_10161699 | 3300005327 | Bacteria | 1879 |
| 31 | Ga0070658_10489864 | 3300005327 | Bacteria | 1061 |
| 32 | Ga0070670_100000339 | 3300005331 | Bacteria | 39253 |
| 33 | Ga0070670_100006458 | 3300005331 | Bacteria | 9928 |
| 34 | Ga0070666_10002112 | 3300005335 | Bacteria | 12076 |
| 35 | Ga0070660_100038969 | 3300005339 | Bacteria | 3611 |
| 36 | Ga0070660_100142601 | 3300005339 | Bacteria | 1923 |
| 37 | Ga0070661_100013900 | 3300005344 | Bacteria | 5657 |
| 38 | Ga0070661_100024469 | 3300005344 | Bacteria | 4331 |
| 39 | Ga0070668_100000005 | 3300005347 | Bacteria | 187511 |
| 40 | Ga0070668_100000623 | 3300005347 | Bacteria | 23826 |
| 41 | Ga0070668_100004784 | 3300005347 | Bacteria | 10042 |
| 42 | Ga0070668_100016994 | 3300005347 | Bacteria | 5442 |
| 43 | Ga0070669_100000345 | 3300005353 | Bacteria | 36221 |
| 44 | Ga0070669_100021568 | 3300005353 | Bacteria | 4603 |
| 45 | Ga0070669_100080816 | 3300005353 | Bacteria | 2420 |
| 46 | Ga0070671_100000027 | 3300005355 | Bacteria | 114189 |
| 47 | Ga0070671_100443490 | 3300005355 | Bacteria | 1113 |
| 48 | Ga0070659_100029626 | 3300005366 | Bacteria | 4230 |
| 49 | Ga0070659_100181260 | 3300005366 | Bacteria | 1729 |
| 50 | Ga0070659_100233644 | 3300005366 | Bacteria | 1520 |
| 51 | Ga0070667_100000004 | 3300005367 | Bacteria | 444091 |
| 52 | Ga0070667_100000053 | 3300005367 | Bacteria | 151974 |
| 53 | Ga0070667_100000300 | 3300005367 | Bacteria | 55347 |
| 54 | Ga0070667_100001960 | 3300005367 | Bacteria | 18263 |
| 55 | Ga0070667_100120651 | 3300005367 | Bacteria | 2280 |
| 56 | Ga0070667_100137847 | 3300005367 | Bacteria | 2134 |
| 57 | Ga0070663_100000791 | 3300005455 | Bacteria | 17178 |
| 58 | Ga0070663_100171390 | 3300005455 | Bacteria | 1678 |
| 59 | Ga0070662_100015656 | 3300005457 | Bacteria | 5084 |
| 60 | Ga0068853_100217557 | 3300005539 | Bacteria | 1743 |
| 61 | Ga0070665_100257333 | 3300005548 | Bacteria | 1747 |
| 62 | Ga0070665_100392187 | 3300005548 | Bacteria | 1396 |
| 63 | Ga0068855_100070229 | 3300005563 | Bacteria | 4075 |
| 64 | Ga0068855_100348993 | 3300005563 | Bacteria | 1630 |
| 65 | Ga0070664_100007138 | 3300005564 | Bacteria | 9009 |
| 66 | Ga0070664_100171695 | 3300005564 | Bacteria | 1923 |
| 67 | Ga0068857_100033940 | 3300005577 | Bacteria | 4514 |
| 68 | Ga0068854_100066012 | 3300005578 | Bacteria | 2632 |
| 69 | Ga0068856_100013336 | 3300005614 | Bacteria | 7957 |
| 70 | Ga0068856_100028092 | 3300005614 | Bacteria | 5491 |
| 71 | Ga0068856_100033854 | 3300005614 | Bacteria | 5004 |
| 72 | Ga0068852_100001796 | 3300005616 | Bacteria | 14563 |
| 73 | Ga0068859_100015701 | 3300005617 | Bacteria | 7610 |
| 74 | Ga0068859_100037383 | 3300005617 | Bacteria | 4872 |
| 75 | Ga0068859_100061074 | 3300005617 | Bacteria | 3797 |
| 76 | Ga0068859_100064440 | 3300005617 | Bacteria | 3697 |
| 77 | Ga0068859_100071734 | 3300005617 | Bacteria | 3499 |
| 78 | Ga0068859_100211845 | 3300005617 | Bacteria | 2024 |
| 79 | Ga0068864_100000233 | 3300005618 | Bacteria | 49794 |
| 80 | Ga0068864_100000379 | 3300005618 | Bacteria | 38803 |
| 81 | Ga0068861_100001389 | 3300005719 | Bacteria | 15208 |
| 82 | Ga0068861_100006505 | 3300005719 | Bacteria | 7965 |
| 83 | Ga0068851_10012564 | 3300005834 | Bacteria | 3994 |
| 84 | Ga0068863_100000169 | 3300005841 | Bacteria | 70831 |
| 85 | Ga0068863_100000180 | 3300005841 | Bacteria | 67219 |
| 86 | Ga0068863_100004491 | 3300005841 | Bacteria | 13762 |
| 87 | Ga0068863_100006692 | 3300005841 | Bacteria | 11310 |
| 88 | Ga0068863_100020486 | 3300005841 | Bacteria | 6320 |
| 89 | Ga0068863_100048642 | 3300005841 | Bacteria | 4021 |
| 90 | Ga0068863_100121782 | 3300005841 | Bacteria | 2488 |
| 91 | Ga0068858_100001972 | 3300005842 | Bacteria | 20980 |
| 92 | Ga0068858_100003843 | 3300005842 | Bacteria | 14850 |
| 93 | Ga0068858_100023698 | 3300005842 | Bacteria | 5718 |
| 94 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 95 | Ga0068860_100000224 | 3300005843 | Bacteria | 88107 |
| 96 | Ga0068860_100007032 | 3300005843 | Bacteria | 11270 |
| 97 | Ga0068860_100036246 | 3300005843 | Bacteria | 4727 |
| 98 | Ga0068860_100366497 | 3300005843 | Bacteria | 1420 |
| 99 | Ga0068862_100000288 | 3300005844 | Bacteria | 55742 |
| 100 | Ga0068862_100003522 | 3300005844 | Bacteria | 13428 |
| 101 | Ga0068862_100081841 | 3300005844 | Bacteria | 2801 |
| 102 | Ga0068862_100370982 | 3300005844 | Bacteria | 1332 |
| 103 | Ga0075368_10002263 | 3300006042 | Bacteria | 6257 |
| 104 | Ga0075363_100016268 | 3300006048 | Bacteria | 3673 |
| 105 | Ga0075367_10013196 | 3300006178 | Bacteria | 4433 |
| 106 | Ga0075370_10184646 | 3300006353 | Bacteria | 1228 |
| 107 | Ga0097620_100015701 | 3300006931 | Bacteria | 7610 |
| 108 | Ga0097620_100037382 | 3300006931 | Bacteria | 4872 |
| 109 | Ga0097620_100061074 | 3300006931 | Bacteria | 3797 |
| 110 | Ga0097620_100064441 | 3300006931 | Bacteria | 3697 |
| 111 | Ga0097620_100071734 | 3300006931 | Bacteria | 3499 |
| 112 | Ga0097620_100211846 | 3300006931 | Bacteria | 2024 |
| 113 | Ga0105251_10197272 | 3300009011 | Bacteria | 907 |
| 114 | Ga0105240_10003469 | 3300009093 | Bacteria | 24462 |
| 115 | Ga0105240_10759762 | 3300009093 | Bacteria | 1053 |
| 116 | Ga0105247_10005393 | 3300009101 | Bacteria | 8060 |
| 117 | Ga0105247_10149653 | 3300009101 | Bacteria | 1537 |
| 118 | Ga0105247_10541041 | 3300009101 | Bacteria | 855 |
| 119 | Ga0105243_10125756 | 3300009148 | Bacteria | 2168 |
| 120 | Ga0105241_10001752 | 3300009174 | Bacteria | 16461 |
| 121 | Ga0105241_10394288 | 3300009174 | Bacteria | 1213 |
| 122 | Ga0105248_10001248 | 3300009177 | Bacteria | 28422 |
| 123 | Ga0105248_10008636 | 3300009177 | Bacteria | 11190 |
| 124 | Ga0105248_10051469 | 3300009177 | Bacteria | 4621 |
| 125 | Ga0105248_10072902 | 3300009177 | Bacteria | 3860 |
| 126 | Ga0105248_10086898 | 3300009177 | Bacteria | 3519 |
| 127 | Ga0105248_10621969 | 3300009177 | Bacteria | 1218 |
| 128 | Ga0105237_10018944 | 3300009545 | Bacteria | 7112 |
| 129 | Ga0105237_10042359 | 3300009545 | Bacteria | 4591 |
| 130 | Ga0105237_10137364 | 3300009545 | Bacteria | 2439 |
| 131 | Ga0105237_10238037 | 3300009545 | Bacteria | 1821 |
| 132 | Ga0105238_10528923 | 3300009551 | Bacteria | 1182 |
| 133 | Ga0105249_10000053 | 3300009553 | Bacteria | 168010 |
| 134 | Ga0105249_10074047 | 3300009553 | Bacteria | 3151 |
| 135 | Ga0105249_10098448 | 3300009553 | Bacteria | 2747 |
| 136 | Ga0105148_100595 | 3300009978 | Bacteria | 3020 |
| 137 | Ga0105239_10831097 | 3300010375 | Bacteria | 1059 |
| 138 | Ga0157373_10031392 | 3300013100 | Bacteria | 3824 |
| 139 | Ga0157373_10196253 | 3300013100 | Bacteria | 1423 |
| 140 | Ga0157373_10280346 | 3300013100 | Bacteria | 1181 |
| 141 | Ga0157371_10124961 | 3300013102 | Bacteria | 1829 |
| 142 | Ga0157370_10006473 | 3300013104 | Bacteria | 12913 |
| 143 | Ga0157370_10027954 | 3300013104 | Bacteria | 5556 |
| 144 | Ga0157369_10019643 | 3300013105 | Bacteria | 7562 |
| 145 | Ga0157369_10169432 | 3300013105 | Bacteria | 2301 |
| 146 | Ga0157378_10016553 | 3300013297 | Bacteria | 6458 |
| 147 | Ga0157372_10829655 | 3300013307 | Bacteria | 1074 |
| 148 | Ga0157380_10001252 | 3300014326 | Bacteria | 16487 |
| 149 | Ga0157379_10059854 | 3300014968 | Bacteria | 3406 |
| 150 | Ga0163161_10071432 | 3300017792 | Bacteria | 2540 |
| 151 | Ga0209147_101608 | 3300025229 | Bacteria | 7581 |
| 152 | Ga0209437_108849 | 3300025233 | Bacteria | 1594 |
| 153 | Ga0209233_1000182 | 3300025261 | Bacteria | 137671 |
| 154 | Ga0207656_10015814 | 3300025321 | Bacteria | 2926 |
| 155 | Ga0207656_10031333 | 3300025321 | Bacteria | 2203 |
| 156 | Ga0207710_10001187 | 3300025900 | Bacteria | 13232 |
| 157 | Ga0207680_10001628 | 3300025903 | Bacteria | 10621 |
| 158 | Ga0207647_10005479 | 3300025904 | Bacteria | 9290 |
| 159 | Ga0207647_10009755 | 3300025904 | Bacteria | 6814 |
| 160 | Ga0207647_10061799 | 3300025904 | Bacteria | 2284 |
| 161 | Ga0207705_10047370 | 3300025909 | Bacteria | 3091 |
| 162 | Ga0207654_10002334 | 3300025911 | Bacteria | 9737 |
| 163 | Ga0207654_10023203 | 3300025911 | Bacteria | 3320 |
| 164 | Ga0207695_10110243 | 3300025913 | Bacteria | 2733 |
| 165 | Ga0207695_10116412 | 3300025913 | Bacteria | 2647 |
| 166 | Ga0207671_10000841 | 3300025914 | Bacteria | 38929 |
| 167 | Ga0207671_10016046 | 3300025914 | Bacteria | 5837 |
| 168 | Ga0207657_10156363 | 3300025919 | Bacteria | 1854 |
| 169 | Ga0207681_10000086 | 3300025923 | Bacteria | 81919 |
| 170 | Ga0207681_10068086 | 3300025923 | Bacteria | 2471 |
| 171 | Ga0207694_10021664 | 3300025924 | Bacteria | 4870 |
| 172 | Ga0207694_10109830 | 3300025924 | Bacteria | 2193 |
| 173 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 174 | Ga0207650_10013185 | 3300025925 | Bacteria | 5721 |
| 175 | Ga0207644_10000064 | 3300025931 | Bacteria | 77442 |
| 176 | Ga0207644_10183322 | 3300025931 | Bacteria | 1642 |
| 177 | Ga0207690_10145976 | 3300025932 | Bacteria | 1749 |
| 178 | Ga0207690_10202658 | 3300025932 | Bacteria | 1508 |
| 179 | Ga0207706_10026568 | 3300025933 | Bacteria | 5181 |
| 180 | Ga0207706_10051736 | 3300025933 | Bacteria | 3627 |
| 181 | Ga0207709_10114836 | 3300025935 | Bacteria | 1807 |
| 182 | Ga0207711_10005770 | 3300025941 | Bacteria | 10458 |
| 183 | Ga0207711_10008436 | 3300025941 | Bacteria | 8617 |
| 184 | Ga0207711_10043735 | 3300025941 | Bacteria | 3822 |
| 185 | Ga0207711_10048231 | 3300025941 | Bacteria | 3644 |
| 186 | Ga0207711_10127765 | 3300025941 | Bacteria | 2276 |
| 187 | Ga0207661_10272874 | 3300025944 | Bacteria | 1510 |
| 188 | Ga0207679_10074649 | 3300025945 | Bacteria | 2570 |
| 189 | Ga0207667_10007432 | 3300025949 | Bacteria | 13166 |
| 190 | Ga0207712_10000045 | 3300025961 | Bacteria | 168093 |
| 191 | Ga0207712_10060000 | 3300025961 | Bacteria | 2695 |
| 192 | Ga0207712_10145068 | 3300025961 | Bacteria | 1826 |
| 193 | Ga0207668_10000024 | 3300025972 | Bacteria | 131871 |
| 194 | Ga0207668_10000265 | 3300025972 | Bacteria | 34885 |
| 195 | Ga0207668_10000763 | 3300025972 | Bacteria | 19660 |
| 196 | Ga0207668_10009189 | 3300025972 | Bacteria | 5913 |
| 197 | Ga0207640_10006230 | 3300025981 | Bacteria | 6537 |
| 198 | Ga0207640_10035301 | 3300025981 | Bacteria | 3128 |
| 199 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 200 | Ga0207658_10000074 | 3300025986 | Bacteria | 110470 |
| 201 | Ga0207658_10000258 | 3300025986 | Bacteria | 55336 |
| 202 | Ga0207658_10002154 | 3300025986 | Bacteria | 14633 |
| 203 | Ga0207658_10055991 | 3300025986 | Bacteria | 2924 |
| 204 | Ga0207658_10087369 | 3300025986 | Bacteria | 2408 |
| 205 | Ga0207703_10000409 | 3300026035 | Bacteria | 45646 |
| 206 | Ga0207703_10018370 | 3300026035 | Bacteria | 5459 |
| 207 | Ga0207639_10000366 | 3300026041 | Bacteria | 31310 |
| 208 | Ga0207639_10055592 | 3300026041 | Bacteria | 3030 |
| 209 | Ga0207678_10000979 | 3300026067 | Bacteria | 26012 |
| 210 | Ga0207678_10040722 | 3300026067 | Bacteria | 4028 |
| 211 | Ga0207702_10001863 | 3300026078 | Bacteria | 20726 |
| 212 | Ga0207702_10006970 | 3300026078 | Bacteria | 9678 |
| 213 | Ga0207702_10032045 | 3300026078 | Bacteria | 4384 |
| 214 | Ga0207641_10000181 | 3300026088 | Bacteria | 87655 |
| 215 | Ga0207641_10001052 | 3300026088 | Bacteria | 27867 |
| 216 | Ga0207641_10008420 | 3300026088 | Bacteria | 8525 |
| 217 | Ga0207641_10013982 | 3300026088 | Bacteria | 6579 |
| 218 | Ga0207641_10020970 | 3300026088 | Bacteria | 5372 |
| 219 | Ga0207641_10022362 | 3300026088 | Bacteria | 5205 |
| 220 | Ga0207641_10048708 | 3300026088 | Bacteria | 3578 |
| 221 | Ga0207676_10000150 | 3300026095 | Bacteria | 60517 |
| 222 | Ga0207676_10000264 | 3300026095 | Bacteria | 45636 |
| 223 | Ga0207674_10025605 | 3300026116 | Bacteria | 6285 |
| 224 | Ga0207674_10044666 | 3300026116 | Bacteria | 4563 |
| 225 | Ga0207674_10054315 | 3300026116 | Bacteria | 4078 |
| 226 | Ga0207675_100001855 | 3300026118 | Bacteria | 21175 |
| 227 | Ga0207675_100003442 | 3300026118 | Bacteria | 15473 |
| 228 | Ga0207698_10001985 | 3300026142 | Bacteria | 12034 |
| 229 | Ga0207698_10064298 | 3300026142 | Bacteria | 2875 |
| 230 | Ga0209813_10000216 | 3300027866 | Bacteria | 17763 |
| 231 | Ga0268266_11016670 | 3300028379 | Bacteria | 802 |
| 232 | Ga0268265_10000049 | 3300028380 | Bacteria | 177242 |
| 233 | Ga0268265_10000204 | 3300028380 | Bacteria | 68890 |
| 234 | Ga0268265_10168877 | 3300028380 | Bacteria | 1867 |
| 235 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 236 | Ga0268264_10000161 | 3300028381 | Bacteria | 150917 |
| 237 | Ga0268264_10004989 | 3300028381 | Bacteria | 11236 |
| 238 | Ga0268264_10036215 | 3300028381 | Bacteria | 4064 |
| 239 | Ga0268264_10525548 | 3300028381 | Bacteria | 1157 |
| 240 | Ga0316575_10201174 | 3300031665 | Bacteria | 829 |
| 241 | Ga0307405_10006017 | 3300031731 | Bacteria | 5926 |
| 242 | Ga0307405_10016968 | 3300031731 | Bacteria | 3985 |
| 243 | Ga0307413_10066086 | 3300031824 | Bacteria | 2255 |
| 244 | Ga0307410_10036598 | 3300031852 | Bacteria | 3197 |
| 245 | Ga0307407_10037054 | 3300031903 | Bacteria | 2692 |
| 246 | Ga0307407_10289833 | 3300031903 | Bacteria | 1137 |
| 247 | Ga0307412_10002269 | 3300031911 | Bacteria | 10638 |
| 248 | Ga0307409_100018365 | 3300031995 | Bacteria | 4699 |
| 249 | Ga0307416_100269103 | 3300032002 | Bacteria | 1671 |
| 250 | Ga0307414_10612848 | 3300032004 | Bacteria | 977 |
| 251 | Ga0307411_10025715 | 3300032005 | Bacteria | 3532 |
| 252 | Ga0307411_10036252 | 3300032005 | Bacteria | 3088 |
| 253 | Ga0307415_100234679 | 3300032126 | Unclassified | 1480 |
| 254 | Ga0307510_10000248 | 3300033180 | Bacteria | 48764 |
| 255 | Ga0373927_0154046 | 3300035695 | Bacteria | 1505 |
| 256 | Ga0373947_0312554 | 3300035725 | Bacteria | 1049 |
| 257 | Ga0316582_0051130 | 3300036647 | Unclassified | 2621 |
| 258 | Ga0395905_0370731 | 3300037471 | Bacteria | 1325 |
| 259 | Ga0395905_0507235 | 3300037471 | Bacteria | 1107 |
| 260 | Ga0237819_01796 | 3300038705 | Bacteria | 5001 |
| 261 | Ga0495627_000110 | 3300046453 | Bacteria | 101742 |
| 262 | Ga0495638_0000073 | 3300046460 | Bacteria | 164378 |
| 263 | Ga0495638_0152332 | 3300046460 | Bacteria | 1340 |
| 264 | Ga0495607_0029855 | 3300046501 | Bacteria | 3353 |
| 265 | Ga0495583_0000087 | 3300046506 | Bacteria | 164974 |
| 266 | Ga0495583_0023696 | 3300046506 | Bacteria | 3100 |
| 267 | Ga0495610_0007959 | 3300046512 | Bacteria | 6955 |
| 268 | Ga0495632_0001911 | 3300046519 | Bacteria | 16665 |
| 269 | Ga0495648_0000049 | 3300046524 | Bacteria | 164366 |
| 270 | Ga0495648_0135254 | 3300046524 | Bacteria | 1304 |
| 271 | Ga0495597_0003731 | 3300046542 | Bacteria | 8696 |
| 272 | Ga0495633_0213830 | 3300046558 | Bacteria | 883 |
| 273 | Ga0495668_0010860 | 3300046616 | Bacteria | 5484 |
| 274 | Ga0495611_0216592 | 3300046648 | Bacteria | 891 |
| 275 | Ga0495671_0000042 | 3300046692 | Bacteria | 165201 |
| 276 | Ga0495673_0000111 | 3300047469 | Bacteria | 164974 |
| 277 | Ga0495673_0049810 | 3300047469 | Bacteria | 1842 |
| 278 | Ga0495686_0000661 | 3300047472 | Bacteria | 46810 |
| 279 | Ga0495686_0003752 | 3300047472 | Bacteria | 12924 |
| 280 | Ga0495686_0051191 | 3300047472 | Bacteria | 2592 |
| 281 | Ga0496102_0000472 | 3300048905 | Bacteria | 44602 |
| 282 | Ga0496103_0000318 | 3300048906 | Bacteria | 44504 |
| 283 | Ga0496110_0028275 | 3300048913 | Bacteria | 4814 |
| 284 | Ga0496110_0035881 | 3300048913 | Bacteria | 4305 |
| 285 | Ga0496111_0089706 | 3300048914 | Bacteria | 2252 |
| 286 | Ga0496111_0279058 | 3300048914 | Bacteria | 1239 |
| 287 | Ga0496112_0233658 | 3300048915 | Bacteria | 1793 |
| 288 | Ga0496115_0364601 | 3300048918 | Bacteria | 1177 |
| 289 | Ga0496116_0001661 | 3300048919 | Bacteria | 24466 |
| 290 | Ga0496116_0178823 | 3300048919 | Bacteria | 1139 |
| 291 | Ga0496117_0000946 | 3300048920 | Bacteria | 44400 |
| 292 | Ga0496117_0001317 | 3300048920 | Bacteria | 36512 |
| 293 | Ga0496117_0006443 | 3300048920 | Bacteria | 11880 |
| 294 | Ga0496117_0007799 | 3300048920 | Bacteria | 10313 |
| 295 | Ga0496117_0022559 | 3300048920 | Bacteria | 5046 |
| 296 | Ga0496117_0142718 | 3300048920 | Bacteria | 1431 |
| 297 | Ga0496118_0000122 | 3300048921 | Bacteria | 137396 |
| 298 | Ga0496118_0000133 | 3300048921 | Bacteria | 131319 |
| 299 | Ga0496118_0005916 | 3300048921 | Bacteria | 13682 |
| 300 | Ga0496118_0032042 | 3300048921 | Bacteria | 4341 |
| 301 | Ga0496118_0044614 | 3300048921 | Bacteria | 3470 |
| 302 | Ga0496119_0046675 | 3300048922 | Bacteria | 2702 |
| 303 | Ga0496119_0086391 | 3300048922 | Bacteria | 1793 |
| 304 | Ga0496119_0239247 | 3300048922 | Bacteria | 920 |
| 305 | Ga0496120_0080829 | 3300048923 | Bacteria | 1760 |
| 306 | Ga0496121_0003614 | 3300048924 | Bacteria | 21832 |
| 307 | Ga0496121_0032294 | 3300048924 | Bacteria | 4763 |
| 308 | Ga0496121_0050677 | 3300048924 | Bacteria | 3504 |
| 309 | Ga0496122_0000579 | 3300048925 | Bacteria | 75073 |
| 310 | Ga0496122_0018110 | 3300048925 | Bacteria | 6526 |
| 311 | Ga0496122_0041148 | 3300048925 | Bacteria | 3659 |
| 312 | Ga0496123_0005053 | 3300048926 | Bacteria | 13486 |
| 313 | Ga0496123_0020708 | 3300048926 | Bacteria | 5137 |
| 314 | Ga0496123_0059143 | 3300048926 | Bacteria | 2480 |
| 315 | Ga0496124_0000054 | 3300048927 | Bacteria | 252172 |
| 316 | Ga0496124_0000359 | 3300048927 | Bacteria | 83092 |
| 317 | Ga0496124_0004655 | 3300048927 | Bacteria | 15882 |
| 318 | Ga0496124_0016798 | 3300048927 | Bacteria | 6937 |
| 319 | Ga0496124_0022957 | 3300048927 | Bacteria | 5707 |
| 320 | Ga0496124_0090233 | 3300048927 | Bacteria | 2500 |
| 321 | Ga0496124_0142364 | 3300048927 | Bacteria | 1891 |
| 322 | Ga0496125_0020671 | 3300048928 | Bacteria | 6174 |
| 323 | Ga0496125_0041532 | 3300048928 | Bacteria | 3930 |
| 324 | Ga0496125_0059518 | 3300048928 | Bacteria | 3077 |
| 325 | Ga0496125_0105626 | 3300048928 | Bacteria | 2058 |
| 326 | Ga0496125_0284530 | 3300048928 | Bacteria | 1022 |
| 327 | Ga0496126_0257920 | 3300048929 | Bacteria | 1451 |
| 328 | Ga0496126_0272669 | 3300048929 | Bacteria | 1404 |
| 329 | Ga0495678_045097 | 3300049459 | Bacteria | 1741 |
| 330 | Ga0495682_0141177 | 3300049460 | Bacteria | 860 |
| 331 | Ga0501038_0020213 | 3300049574 | Bacteria | 5991 |
| 332 | Ga0501223_000060 | 3300049663 | Bacteria | 35869 |
| 333 | Ga0501249_000209 | 3300049679 | Bacteria | 17902 |
| 334 | Ga0501225_0000021 | 3300049705 | Bacteria | 57397 |
| 335 | nmdc:mga03n38_27598_c1 | 3300050490 | Bacteria | 2357 |
| 336 | nmdc:mga0k408_51144_c1 | 3300050493 | Bacteria | 2393 |
| 337 | nmdc:mga06z11_111_c1 | 3300050494 | Bacteria | 33603 |
| 338 | nmdc:mga04h51_100_c1 | 3300050495 | Bacteria | 25673 |
| 339 | nmdc:mga07m45_185710_c1 | 3300050496 | Bacteria | 1209 |
| 340 | Ga0500643_000198 | 3300053087 | Bacteria | 57293 |
| 341 | Ga0500651_0112343 | 3300053093 | Bacteria | 1661 |
| 342 | Ga0500566_0000119 | 3300053094 | Bacteria | 40813 |
| 343 | Ga0500556_0095318 | 3300053104 | Bacteria | 1141 |
| 344 | Ga0500562_005202 | 3300053108 | Bacteria | 3268 |
| 345 | Ga0500592_005496 | 3300053116 | Bacteria | 2017 |
| 346 | Ga0500607_108524 | 3300053121 | Bacteria | 1365 |
| 347 | Ga0500614_069753 | 3300053123 | Bacteria | 962 |
| 348 | Ga0500642_0003892 | 3300053130 | Bacteria | 4594 |
| 349 | Ga0500652_079392 | 3300053131 | Bacteria | 1366 |
| 350 | Ga0500655_000102 | 3300053133 | Bacteria | 21853 |
| 351 | Ga0500559_0014090 | 3300053136 | Bacteria | 3380 |
| 352 | Ga0500590_013785 | 3300053148 | Bacteria | 4155 |
| 353 | Ga0500622_0044529 | 3300053156 | Bacteria | 2300 |
| 354 | Ga0500639_012381 | 3300053163 | Bacteria | 4478 |
| 355 | Ga0500661_000340 | 3300055283 | Bacteria | 8494 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009101 | Ga0105247_10541041 | Ga0105247_105410412 | 179 |
| 2 | 3300053121 | Ga0500607_108524 | Ga0500607_108524_804_1352 | 182 |
| 3 | 3300047472 | Ga0495686_0003752 | Ga0495686_0003752_8653_9228 | 191 |
| 4 | 3300005844 | Ga0068862_100370982 | Ga0068862_1003709822 | 200 |
| 5 | 3300005289 | Ga0065704_10313492 | Ga0065704_103134921 | 202 |
| 6 | 3300009177 | Ga0105248_10621969 | Ga0105248_106219692 | 202 |
| 7 | 3300014326 | Ga0157380_10001252 | Ga0157380_1000125213 | 202 |
| 8 | 3300053104 | Ga0500556_0095318 | Ga0500556_0095318_432_1103 | 202 |
| 9 | 3300033180 | Ga0307510_10000248 | Ga0307510_1000024841 | 204 |
| 10 | 3300005355 | Ga0070671_100443490 | Ga0070671_1004434902 | 205 |
| 11 | 3300005367 | Ga0070667_100120651 | Ga0070667_1001206513 | 205 |
| 12 | 3300005617 | Ga0068859_100064440 | Ga0068859_1000644401 | 205 |
| 13 | 3300005618 | Ga0068864_100000233 | Ga0068864_10000023321 | 205 |
| 14 | 3300005841 | Ga0068863_100048642 | Ga0068863_1000486425 | 205 |
| 15 | 3300005842 | Ga0068858_100001972 | Ga0068858_10000197223 | 205 |
| 16 | 3300006931 | Ga0097620_100064441 | Ga0097620_1000644415 | 205 |
| 17 | 3300009101 | Ga0105247_10149653 | Ga0105247_101496532 | 205 |
| 18 | 3300009177 | Ga0105248_10051469 | Ga0105248_100514692 | 205 |
| 19 | 3300009177 | Ga0105248_10086898 | Ga0105248_100868982 | 205 |
| 20 | 3300009553 | Ga0105249_10074047 | Ga0105249_100740474 | 205 |
| 21 | 3300025931 | Ga0207644_10183322 | Ga0207644_101833221 | 205 |
| 22 | 3300025941 | Ga0207711_10005770 | Ga0207711_100057709 | 205 |
| 23 | 3300025941 | Ga0207711_10043735 | Ga0207711_100437352 | 205 |
| 24 | 3300025986 | Ga0207658_10055991 | Ga0207658_100559911 | 205 |
| 25 | 3300026035 | Ga0207703_10000409 | Ga0207703_1000040923 | 205 |
| 26 | 3300026088 | Ga0207641_10020970 | Ga0207641_100209705 | 205 |
| 27 | 3300026095 | Ga0207676_10000150 | Ga0207676_1000015035 | 205 |
| 28 | 3300038705 | Ga0237819_01796 | Ga0237819_01796_4005_4661 | 206 |
| 29 | 3300049663 | Ga0501223_000060 | Ga0501223_000060_13656_14318 | 206 |
| 30 | 3300049705 | Ga0501225_0000021 | Ga0501225_0000021_13656_14318 | 206 |
| 31 | 3300002459 | JGI24751J29686_10000202 | JGI24751J29686_1000020215 | 207 |
| 32 | 3300002459 | JGI24751J29686_10033264 | JGI24751J29686_100332642 | 207 |
| 33 | 3300005295 | Ga0065707_10085901 | Ga0065707_100859013 | 207 |
| 34 | 3300005331 | Ga0070670_100000339 | Ga0070670_10000033914 | 207 |
| 35 | 3300005331 | Ga0070670_100006458 | Ga0070670_1000064582 | 207 |
| 36 | 3300005347 | Ga0070668_100000005 | Ga0070668_10000000516 | 207 |
| 37 | 3300005353 | Ga0070669_100000345 | Ga0070669_10000034530 | 207 |
| 38 | 3300005353 | Ga0070669_100021568 | Ga0070669_1000215682 | 207 |
| 39 | 3300005355 | Ga0070671_100000027 | Ga0070671_10000002799 | 207 |
| 40 | 3300005367 | Ga0070667_100000004 | Ga0070667_10000000460 | 207 |
| 41 | 3300005367 | Ga0070667_100000053 | Ga0070667_100000053128 | 207 |
| 42 | 3300005367 | Ga0070667_100001960 | Ga0070667_10000196011 | 207 |
| 43 | 3300005617 | Ga0068859_100015701 | Ga0068859_1000157015 | 207 |
| 44 | 3300005617 | Ga0068859_100061074 | Ga0068859_1000610747 | 207 |
| 45 | 3300005617 | Ga0068859_100211845 | Ga0068859_1002118452 | 207 |
| 46 | 3300005618 | Ga0068864_100000379 | Ga0068864_10000037930 | 207 |
| 47 | 3300005719 | Ga0068861_100001389 | Ga0068861_10000138912 | 207 |
| 48 | 3300005841 | Ga0068863_100000180 | Ga0068863_10000018073 | 207 |
| 49 | 3300005841 | Ga0068863_100006692 | Ga0068863_10000669211 | 207 |
| 50 | 3300005842 | Ga0068858_100003843 | Ga0068858_1000038431 | 207 |
| 51 | 3300005843 | Ga0068860_100000002 | Ga0068860_10000000246 | 207 |
| 52 | 3300005843 | Ga0068860_100000224 | Ga0068860_10000022469 | 207 |
| 53 | 3300005844 | Ga0068862_100003522 | Ga0068862_10000352218 | 207 |
| 54 | 3300006931 | Ga0097620_100015701 | Ga0097620_1000157015 | 207 |
| 55 | 3300006931 | Ga0097620_100061074 | Ga0097620_1000610747 | 207 |
| 56 | 3300006931 | Ga0097620_100211846 | Ga0097620_1002118462 | 207 |
| 57 | 3300025923 | Ga0207681_10000086 | Ga0207681_1000008653 | 207 |
| 58 | 3300025923 | Ga0207681_10068086 | Ga0207681_100680863 | 207 |
| 59 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008446 | 207 |
| 60 | 3300025925 | Ga0207650_10013185 | Ga0207650_100131854 | 207 |
| 61 | 3300025931 | Ga0207644_10000064 | Ga0207644_1000006415 | 207 |
| 62 | 3300025961 | Ga0207712_10145068 | Ga0207712_101450682 | 207 |
| 63 | 3300025972 | Ga0207668_10000024 | Ga0207668_10000024131 | 207 |
| 64 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002353 | 207 |
| 65 | 3300025986 | Ga0207658_10000074 | Ga0207658_1000007486 | 207 |
| 66 | 3300025986 | Ga0207658_10002154 | Ga0207658_1000215412 | 207 |
| 67 | 3300026088 | Ga0207641_10013982 | Ga0207641_100139822 | 207 |
| 68 | 3300026088 | Ga0207641_10022362 | Ga0207641_100223625 | 207 |
| 69 | 3300026095 | Ga0207676_10000264 | Ga0207676_1000026418 | 207 |
| 70 | 3300026118 | Ga0207675_100003442 | Ga0207675_10000344212 | 207 |
| 71 | 3300028380 | Ga0268265_10000204 | Ga0268265_1000020418 | 207 |
| 72 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001678 | 207 |
| 73 | 3300028381 | Ga0268264_10000161 | Ga0268264_1000016120 | 207 |
| 74 | 3300046648 | Ga0495611_0216592 | Ga0495611_0216592_104_763 | 207 |
| 75 | 3300053087 | Ga0500643_000198 | Ga0500643_000198_46512_47171 | 207 |
| 76 | 3300053136 | Ga0500559_0014090 | Ga0500559_0014090_1728_2387 | 207 |
| 77 | 3300055283 | Ga0500661_000340 | Ga0500661_000340_3866_4525 | 207 |
| 78 | 3300003214 | JGI25165J46597_1000138 | JGI25165J46597_100013841 | 209 |
| 79 | 3300005841 | Ga0068863_100121782 | Ga0068863_1001217825 | 209 |
| 80 | 3300013297 | Ga0157378_10016553 | Ga0157378_100165535 | 209 |
| 81 | 3300025233 | Ga0209437_108849 | Ga0209437_1088492 | 209 |
| 82 | 3300025261 | Ga0209233_1000182 | Ga0209233_100018251 | 209 |
| 83 | 3300026088 | Ga0207641_10048708 | Ga0207641_100487082 | 209 |
| 84 | 3300035695 | Ga0373927_0154046 | Ga0373927_0154046_179_835 | 209 |
| 85 | 3300035725 | Ga0373947_0312554 | Ga0373947_0312554_197_853 | 209 |
| 86 | 3300046542 | Ga0495597_0003731 | Ga0495597_0003731_7297_7953 | 209 |
| 87 | 3300053093 | Ga0500651_0112343 | Ga0500651_0112343_258_914 | 209 |
| 88 | 3300053123 | Ga0500614_069753 | Ga0500614_069753_278_934 | 209 |
| 89 | 3300053130 | Ga0500642_0003892 | Ga0500642_0003892_2536_3192 | 209 |
| 90 | 3300053131 | Ga0500652_079392 | Ga0500652_079392_468_1124 | 209 |
| 91 | 3300053133 | Ga0500655_000102 | Ga0500655_000102_12416_13072 | 209 |
| 92 | 3300053148 | Ga0500590_013785 | Ga0500590_013785_1758_2414 | 209 |
| 93 | 3300053156 | Ga0500622_0044529 | Ga0500622_0044529_396_1052 | 209 |
| 94 | 3300053163 | Ga0500639_012381 | Ga0500639_012381_949_1605 | 209 |
| 95 | iso_pu_bacteria | 2751185897 | 2753763227 | 210 |
| 96 | 3300005295 | Ga0065707_10131960 | Ga0065707_101319603 | 211 |
| 97 | 3300005347 | Ga0070668_100004784 | Ga0070668_1000047848 | 211 |
| 98 | 3300005367 | Ga0070667_100137847 | Ga0070667_1001378473 | 211 |
| 99 | 3300005548 | Ga0070665_100392187 | Ga0070665_1003921871 | 211 |
| 100 | 3300005617 | Ga0068859_100071734 | Ga0068859_1000717343 | 211 |
| 101 | 3300005843 | Ga0068860_100366497 | Ga0068860_1003664972 | 211 |
| 102 | 3300005844 | Ga0068862_100081841 | Ga0068862_1000818412 | 211 |
| 103 | 3300006931 | Ga0097620_100071734 | Ga0097620_1000717343 | 211 |
| 104 | 3300009553 | Ga0105249_10098448 | Ga0105249_100984483 | 211 |
| 105 | 3300025229 | Ga0209147_101608 | Ga0209147_1016088 | 211 |
| 106 | 3300025941 | Ga0207711_10127765 | Ga0207711_101277652 | 211 |
| 107 | 3300025961 | Ga0207712_10060000 | Ga0207712_100600002 | 211 |
| 108 | 3300025972 | Ga0207668_10000763 | Ga0207668_1000076317 | 211 |
| 109 | 3300025986 | Ga0207658_10087369 | Ga0207658_100873692 | 211 |
| 110 | 3300028379 | Ga0268266_11016670 | Ga0268266_110166701 | 211 |
| 111 | 3300028380 | Ga0268265_10168877 | Ga0268265_101688772 | 211 |
| 112 | 3300028381 | Ga0268264_10525548 | Ga0268264_105255482 | 211 |
| 113 | 3300048920 | Ga0496117_0001317 | Ga0496117_0001317_7678_8340 | 211 |
| 114 | 3300048921 | Ga0496118_0000122 | Ga0496118_0000122_35839_36501 | 211 |
| 115 | 3300048928 | Ga0496125_0284530 | Ga0496125_0284530_284_946 | 211 |
| 116 | 3300053108 | Ga0500562_005202 | Ga0500562_005202_859_1599 | 211 |
| 117 | iso_pu_bacteria | 2599185359 | 2600224991 | 211 |
| 118 | iso_pu_bacteria | 2818991466 | 2819713235 | 211 |
| 119 | iso_pu_bacteria | 2879163058 | 2879164870 | 211 |
| 120 | iso_pu_bacteria | 2928526807 | 2928527777 | 211 |
| 121 | iso_pu_bacteria | 2928968154 | 2928971590 | 211 |
| 122 | 3300001989 | JGI24739J22299_10027014 | JGI24739J22299_100270142 | 212 |
| 123 | 3300001989 | JGI24739J22299_10027022 | JGI24739J22299_100270222 | 212 |
| 124 | 3300001990 | JGI24737J22298_10053777 | JGI24737J22298_100537772 | 212 |
| 125 | 3300002067 | JGI24735J21928_10029434 | JGI24735J21928_100294342 | 212 |
| 126 | 3300002067 | JGI24735J21928_10043793 | JGI24735J21928_100437932 | 212 |
| 127 | 3300003320 | rootH2_10074017 | rootH2_100740172 | 212 |
| 128 | 3300003322 | rootL2_10098425 | rootL2_100984254 | 212 |
| 129 | 3300005335 | Ga0070666_10002112 | Ga0070666_100021123 | 212 |
| 130 | 3300005347 | Ga0070668_100000623 | Ga0070668_10000062313 | 212 |
| 131 | 3300005366 | Ga0070659_100181260 | Ga0070659_1001812603 | 212 |
| 132 | 3300005367 | Ga0070667_100000300 | Ga0070667_10000030040 | 212 |
| 133 | 3300005457 | Ga0070662_100015656 | Ga0070662_1000156566 | 212 |
| 134 | 3300005548 | Ga0070665_100257333 | Ga0070665_1002573332 | 212 |
| 135 | 3300005577 | Ga0068857_100033940 | Ga0068857_1000339404 | 212 |
| 136 | 3300005614 | Ga0068856_100013336 | Ga0068856_1000133364 | 212 |
| 137 | 3300005616 | Ga0068852_100001796 | Ga0068852_1000017968 | 212 |
| 138 | 3300005617 | Ga0068859_100037383 | Ga0068859_1000373835 | 212 |
| 139 | 3300005841 | Ga0068863_100000169 | Ga0068863_10000016934 | 212 |
| 140 | 3300005841 | Ga0068863_100004491 | Ga0068863_1000044914 | 212 |
| 141 | 3300005842 | Ga0068858_100023698 | Ga0068858_1000236986 | 212 |
| 142 | 3300005843 | Ga0068860_100007032 | Ga0068860_10000703211 | 212 |
| 143 | 3300005843 | Ga0068860_100036246 | Ga0068860_1000362465 | 212 |
| 144 | 3300005844 | Ga0068862_100000288 | Ga0068862_10000028831 | 212 |
| 145 | 3300006931 | Ga0097620_100037382 | Ga0097620_1000373823 | 212 |
| 146 | 3300009545 | Ga0105237_10042359 | Ga0105237_100423594 | 212 |
| 147 | 3300013100 | Ga0157373_10031392 | Ga0157373_100313924 | 212 |
| 148 | 3300013307 | Ga0157372_10829655 | Ga0157372_108296552 | 212 |
| 149 | 3300025900 | Ga0207710_10001187 | Ga0207710_100011873 | 212 |
| 150 | 3300025903 | Ga0207680_10001628 | Ga0207680_100016282 | 212 |
| 151 | 3300025904 | Ga0207647_10009755 | Ga0207647_100097553 | 212 |
| 152 | 3300025932 | Ga0207690_10145976 | Ga0207690_101459761 | 212 |
| 153 | 3300025933 | Ga0207706_10026568 | Ga0207706_100265686 | 212 |
| 154 | 3300025961 | Ga0207712_10000045 | Ga0207712_10000045157 | 212 |
| 155 | 3300025972 | Ga0207668_10000265 | Ga0207668_1000026530 | 212 |
| 156 | 3300025986 | Ga0207658_10000258 | Ga0207658_1000025818 | 212 |
| 157 | 3300026035 | Ga0207703_10018370 | Ga0207703_100183704 | 212 |
| 158 | 3300026078 | Ga0207702_10032045 | Ga0207702_100320455 | 212 |
| 159 | 3300026088 | Ga0207641_10000181 | Ga0207641_1000018131 | 212 |
| 160 | 3300026088 | Ga0207641_10001052 | Ga0207641_1000105213 | 212 |
| 161 | 3300026116 | Ga0207674_10044666 | Ga0207674_100446665 | 212 |
| 162 | 3300028380 | Ga0268265_10000049 | Ga0268265_100000499 | 212 |
| 163 | 3300028381 | Ga0268264_10004989 | Ga0268264_100049894 | 212 |
| 164 | 3300028381 | Ga0268264_10036215 | Ga0268264_100362155 | 212 |
| 165 | 3300036647 | Ga0316582_0051130 | Ga0316582_0051130_724_1413 | 212 |
| 166 | 3300037471 | Ga0395905_0370731 | Ga0395905_0370731_381_1028 | 212 |
| 167 | 3300037471 | Ga0395905_0507235 | Ga0395905_0507235_410_1057 | 212 |
| 168 | 3300048920 | Ga0496117_0006443 | Ga0496117_0006443_5844_6503 | 212 |
| 169 | 3300048922 | Ga0496119_0086391 | Ga0496119_0086391_977_1636 | 212 |
| 170 | 3300048927 | Ga0496124_0004655 | Ga0496124_0004655_14716_15375 | 212 |
| 171 | iso_pu_bacteria | 2643221541 | 2643729534 | 212 |
| 172 | iso_pu_bacteria | 2643221606 | 2644043891 | 212 |
| 173 | iso_pu_bacteria | 2643221671 | 2644392362 | 212 |
| 174 | 3300002067 | JGI24735J21928_10016351 | JGI24735J21928_100163514 | 213 |
| 175 | 3300003320 | rootH2_10147975 | rootH2_101479754 | 213 |
| 176 | 3300005327 | Ga0070658_10489864 | Ga0070658_104898641 | 213 |
| 177 | 3300046460 | Ga0495638_0152332 | Ga0495638_0152332_460_1134 | 213 |
| 178 | 3300048914 | Ga0496111_0279058 | Ga0496111_0279058_36_686 | 213 |
| 179 | 3300048918 | Ga0496115_0364601 | Ga0496115_0364601_324_977 | 213 |
| 180 | 3300048920 | Ga0496117_0007799 | Ga0496117_0007799_9123_9773 | 213 |
| 181 | 3300048920 | Ga0496117_0022559 | Ga0496117_0022559_1297_1956 | 213 |
| 182 | 3300048920 | Ga0496117_0142718 | Ga0496117_0142718_373_1023 | 213 |
| 183 | 3300048921 | Ga0496118_0005916 | Ga0496118_0005916_699_1349 | 213 |
| 184 | 3300048921 | Ga0496118_0032042 | Ga0496118_0032042_3070_3729 | 213 |
| 185 | 3300048921 | Ga0496118_0044614 | Ga0496118_0044614_805_1455 | 213 |
| 186 | 3300048923 | Ga0496120_0080829 | Ga0496120_0080829_539_1189 | 213 |
| 187 | 3300048924 | Ga0496121_0003614 | Ga0496121_0003614_2322_2972 | 213 |
| 188 | 3300048924 | Ga0496121_0050677 | Ga0496121_0050677_2223_2873 | 213 |
| 189 | 3300048925 | Ga0496122_0000579 | Ga0496122_0000579_27902_28552 | 213 |
| 190 | 3300048925 | Ga0496122_0018110 | Ga0496122_0018110_5384_6034 | 213 |
| 191 | 3300048926 | Ga0496123_0005053 | Ga0496123_0005053_4262_4912 | 213 |
| 192 | 3300048927 | Ga0496124_0022957 | Ga0496124_0022957_2896_3546 | 213 |
| 193 | 3300048927 | Ga0496124_0142364 | Ga0496124_0142364_1139_1789 | 213 |
| 194 | 3300048928 | Ga0496125_0041532 | Ga0496125_0041532_811_1461 | 213 |
| 195 | 3300005614 | Ga0068856_100028092 | Ga0068856_1000280925 | 214 |
| 196 | 3300009093 | Ga0105240_10003469 | Ga0105240_100034695 | 214 |
| 197 | 3300031824 | Ga0307413_10066086 | Ga0307413_100660862 | 214 |
| 198 | 3300031903 | Ga0307407_10037054 | Ga0307407_100370543 | 214 |
| 199 | 3300031995 | Ga0307409_100018365 | Ga0307409_1000183653 | 214 |
| 200 | 3300032005 | Ga0307411_10025715 | Ga0307411_100257154 | 214 |
| 201 | 3300032126 | Ga0307415_100234679 | Ga0307415_1002346793 | 214 |
| 202 | 3300046506 | Ga0495583_0023696 | Ga0495583_0023696_1623_2282 | 214 |
| 203 | 3300046524 | Ga0495648_0135254 | Ga0495648_0135254_99_794 | 214 |
| 204 | 3300047472 | Ga0495686_0000661 | Ga0495686_0000661_26064_26717 | 214 |
| 205 | 3300047472 | Ga0495686_0051191 | Ga0495686_0051191_279_932 | 214 |
| 206 | 3300053094 | Ga0500566_0000119 | Ga0500566_0000119_39608_40258 | 214 |
| 207 | iso_pu_bacteria | 2512564014 | 2512642017 | 214 |
| 208 | iso_pu_bacteria | 2808606401 | 2809064433 | 214 |
| 209 | iso_pu_bacteria | 2808606404 | 2809080402 | 214 |
| 210 | iso_pu_bacteria | 2808606405 | 2809084765 | 214 |
| 211 | iso_pu_bacteria | 2880518877 | 2880519207 | 214 |
| 212 | iso_pu_bacteria | 2919709256 | 2919710684 | 214 |
| 213 | 3300003322 | rootL2_10039746 | rootL2_100397461 | 215 |
| 214 | 3300005719 | Ga0068861_100006505 | Ga0068861_1000065054 | 215 |
| 215 | 3300009148 | Ga0105243_10125756 | Ga0105243_101257563 | 215 |
| 216 | 3300009177 | Ga0105248_10001248 | Ga0105248_1000124826 | 215 |
| 217 | 3300009545 | Ga0105237_10018944 | Ga0105237_100189442 | 215 |
| 218 | 3300014968 | Ga0157379_10059854 | Ga0157379_100598542 | 215 |
| 219 | 3300025935 | Ga0207709_10114836 | Ga0207709_101148362 | 215 |
| 220 | 3300025941 | Ga0207711_10008436 | Ga0207711_100084365 | 215 |
| 221 | 3300026118 | Ga0207675_100001855 | Ga0207675_10000185518 | 215 |
| 222 | 3300031911 | Ga0307412_10002269 | Ga0307412_100022696 | 215 |
| 223 | 3300047469 | Ga0495673_0049810 | Ga0495673_0049810_1053_1772 | 215 |
| 224 | 3300048922 | Ga0496119_0239247 | Ga0496119_0239247_175_849 | 215 |
| 225 | 3300048926 | Ga0496123_0059143 | Ga0496123_0059143_971_1645 | 215 |
| 226 | 3300048927 | Ga0496124_0000054 | Ga0496124_0000054_10066_10740 | 215 |
| 227 | 3300048927 | Ga0496124_0090233 | Ga0496124_0090233_1782_2456 | 215 |
| 228 | 3300013102 | Ga0157371_10124961 | Ga0157371_101249612 | 216 |
| 229 | 3300013105 | Ga0157369_10169432 | Ga0157369_101694322 | 216 |
| 230 | 3300046501 | Ga0495607_0029855 | Ga0495607_0029855_1361_2044 | 216 |
| 231 | 3300048928 | Ga0496125_0105626 | Ga0496125_0105626_484_1215 | 216 |
| 232 | 3300049459 | Ga0495678_045097 | Ga0495678_045097_461_1132 | 216 |
| 233 | iso_pu_bacteria | 2946787523 | 2946788461 | 216 |
| 234 | 3300005347 | Ga0070668_100016994 | Ga0070668_1000169946 | 217 |
| 235 | 3300005841 | Ga0068863_100020486 | Ga0068863_1000204863 | 217 |
| 236 | 3300009101 | Ga0105247_10005393 | Ga0105247_100053936 | 217 |
| 237 | 3300009177 | Ga0105248_10008636 | Ga0105248_100086362 | 217 |
| 238 | 3300009553 | Ga0105249_10000053 | Ga0105249_1000005317 | 217 |
| 239 | 3300025941 | Ga0207711_10048231 | Ga0207711_100482312 | 217 |
| 240 | 3300025972 | Ga0207668_10009189 | Ga0207668_100091897 | 217 |
| 241 | 3300026088 | Ga0207641_10008420 | Ga0207641_100084203 | 217 |
| 242 | 3300031665 | Ga0316575_10201174 | Ga0316575_102011741 | 217 |
| 243 | 3300046616 | Ga0495668_0010860 | Ga0495668_0010860_1510_2166 | 217 |
| 244 | 3300048905 | Ga0496102_0000472 | Ga0496102_0000472_20618_21274 | 217 |
| 245 | 3300048906 | Ga0496103_0000318 | Ga0496103_0000318_23305_23961 | 217 |
| 246 | 3300048919 | Ga0496116_0001661 | Ga0496116_0001661_10138_10794 | 217 |
| 247 | 3300048920 | Ga0496117_0000946 | Ga0496117_0000946_23246_23902 | 217 |
| 248 | 3300048921 | Ga0496118_0000133 | Ga0496118_0000133_71436_72092 | 217 |
| 249 | 3300048922 | Ga0496119_0046675 | Ga0496119_0046675_1597_2253 | 217 |
| 250 | 3300048927 | Ga0496124_0000359 | Ga0496124_0000359_23268_23924 | 217 |
| 251 | 3300048928 | Ga0496125_0059518 | Ga0496125_0059518_735_1484 | 217 |
| 252 | 3300049460 | Ga0495682_0141177 | Ga0495682_0141177_29_685 | 217 |
| 253 | 3300049679 | Ga0501249_000209 | Ga0501249_000209_6573_7229 | 217 |
| 254 | 3300050493 | nmdc:mga0k408_51144_c1 | nmdc:mga0k408_51144_c1_289_945 | 217 |
| 255 | 3300053116 | Ga0500592_005496 | Ga0500592_005496_472_1128 | 217 |
| 256 | 3300001904 | JGI24736J21556_1000172 | JGI24736J21556_100017213 | 218 |
| 257 | 3300001915 | JGI24741J21665_1000143 | JGI24741J21665_100014311 | 218 |
| 258 | 3300001979 | JGI24740J21852_10001999 | JGI24740J21852_100019998 | 218 |
| 259 | 3300001979 | JGI24740J21852_10020121 | JGI24740J21852_100201211 | 218 |
| 260 | 3300001989 | JGI24739J22299_10009114 | JGI24739J22299_100091143 | 218 |
| 261 | 3300001989 | JGI24739J22299_10084381 | JGI24739J22299_100843812 | 218 |
| 262 | 3300001990 | JGI24737J22298_10010302 | JGI24737J22298_100103022 | 218 |
| 263 | 3300002067 | JGI24735J21928_10006332 | JGI24735J21928_100063322 | 218 |
| 264 | 3300002067 | JGI24735J21928_10027603 | JGI24735J21928_100276031 | 218 |
| 265 | 3300002075 | JGI24738J21930_10000746 | JGI24738J21930_100007463 | 218 |
| 266 | 3300005289 | Ga0065704_10098595 | Ga0065704_100985953 | 218 |
| 267 | 3300005289 | Ga0065704_10138758 | Ga0065704_101387582 | 218 |
| 268 | 3300005327 | Ga0070658_10062302 | Ga0070658_100623022 | 218 |
| 269 | 3300005327 | Ga0070658_10161699 | Ga0070658_101616992 | 218 |
| 270 | 3300005339 | Ga0070660_100038969 | Ga0070660_1000389694 | 218 |
| 271 | 3300005339 | Ga0070660_100142601 | Ga0070660_1001426012 | 218 |
| 272 | 3300005344 | Ga0070661_100013900 | Ga0070661_1000139004 | 218 |
| 273 | 3300005344 | Ga0070661_100024469 | Ga0070661_1000244692 | 218 |
| 274 | 3300005353 | Ga0070669_100080816 | Ga0070669_1000808162 | 218 |
| 275 | 3300005366 | Ga0070659_100029626 | Ga0070659_1000296262 | 218 |
| 276 | 3300005366 | Ga0070659_100233644 | Ga0070659_1002336443 | 218 |
| 277 | 3300005455 | Ga0070663_100000791 | Ga0070663_1000007916 | 218 |
| 278 | 3300005455 | Ga0070663_100171390 | Ga0070663_1001713902 | 218 |
| 279 | 3300005539 | Ga0068853_100217557 | Ga0068853_1002175571 | 218 |
| 280 | 3300005563 | Ga0068855_100070229 | Ga0068855_1000702293 | 218 |
| 281 | 3300005563 | Ga0068855_100348993 | Ga0068855_1003489933 | 218 |
| 282 | 3300005564 | Ga0070664_100007138 | Ga0070664_1000071388 | 218 |
| 283 | 3300005564 | Ga0070664_100171695 | Ga0070664_1001716952 | 218 |
| 284 | 3300005578 | Ga0068854_100066012 | Ga0068854_1000660123 | 218 |
| 285 | 3300005614 | Ga0068856_100033854 | Ga0068856_1000338542 | 218 |
| 286 | 3300005834 | Ga0068851_10012564 | Ga0068851_100125643 | 218 |
| 287 | 3300006042 | Ga0075368_10002263 | Ga0075368_100022632 | 218 |
| 288 | 3300006048 | Ga0075363_100016268 | Ga0075363_1000162684 | 218 |
| 289 | 3300006178 | Ga0075367_10013196 | Ga0075367_100131962 | 218 |
| 290 | 3300006353 | Ga0075370_10184646 | Ga0075370_101846462 | 218 |
| 291 | 3300009011 | Ga0105251_10197272 | Ga0105251_101972721 | 218 |
| 292 | 3300009093 | Ga0105240_10759762 | Ga0105240_107597621 | 218 |
| 293 | 3300009174 | Ga0105241_10001752 | Ga0105241_1000175210 | 218 |
| 294 | 3300009174 | Ga0105241_10394288 | Ga0105241_103942883 | 218 |
| 295 | 3300009177 | Ga0105248_10072902 | Ga0105248_100729024 | 218 |
| 296 | 3300009545 | Ga0105237_10137364 | Ga0105237_101373643 | 218 |
| 297 | 3300009545 | Ga0105237_10238037 | Ga0105237_102380371 | 218 |
| 298 | 3300009551 | Ga0105238_10528923 | Ga0105238_105289232 | 218 |
| 299 | 3300009978 | Ga0105148_100595 | Ga0105148_1005952 | 218 |
| 300 | 3300010375 | Ga0105239_10831097 | Ga0105239_108310971 | 218 |
| 301 | 3300013100 | Ga0157373_10196253 | Ga0157373_101962532 | 218 |
| 302 | 3300013100 | Ga0157373_10280346 | Ga0157373_102803462 | 218 |
| 303 | 3300013104 | Ga0157370_10006473 | Ga0157370_100064732 | 218 |
| 304 | 3300013104 | Ga0157370_10027954 | Ga0157370_100279545 | 218 |
| 305 | 3300013105 | Ga0157369_10019643 | Ga0157369_100196438 | 218 |
| 306 | 3300017792 | Ga0163161_10071432 | Ga0163161_100714322 | 218 |
| 307 | 3300025321 | Ga0207656_10015814 | Ga0207656_100158144 | 218 |
| 308 | 3300025321 | Ga0207656_10031333 | Ga0207656_100313332 | 218 |
| 309 | 3300025904 | Ga0207647_10005479 | Ga0207647_100054791 | 218 |
| 310 | 3300025904 | Ga0207647_10061799 | Ga0207647_100617993 | 218 |
| 311 | 3300025909 | Ga0207705_10047370 | Ga0207705_100473703 | 218 |
| 312 | 3300025911 | Ga0207654_10002334 | Ga0207654_100023341 | 218 |
| 313 | 3300025911 | Ga0207654_10023203 | Ga0207654_100232033 | 218 |
| 314 | 3300025913 | Ga0207695_10110243 | Ga0207695_101102433 | 218 |
| 315 | 3300025913 | Ga0207695_10116412 | Ga0207695_101164123 | 218 |
| 316 | 3300025914 | Ga0207671_10000841 | Ga0207671_1000084133 | 218 |
| 317 | 3300025914 | Ga0207671_10016046 | Ga0207671_100160463 | 218 |
| 318 | 3300025919 | Ga0207657_10156363 | Ga0207657_101563632 | 218 |
| 319 | 3300025924 | Ga0207694_10021664 | Ga0207694_100216643 | 218 |
| 320 | 3300025924 | Ga0207694_10109830 | Ga0207694_101098303 | 218 |
| 321 | 3300025932 | Ga0207690_10202658 | Ga0207690_102026583 | 218 |
| 322 | 3300025933 | Ga0207706_10051736 | Ga0207706_100517363 | 218 |
| 323 | 3300025944 | Ga0207661_10272874 | Ga0207661_102728742 | 218 |
| 324 | 3300025945 | Ga0207679_10074649 | Ga0207679_100746493 | 218 |
| 325 | 3300025949 | Ga0207667_10007432 | Ga0207667_1000743215 | 218 |
| 326 | 3300025981 | Ga0207640_10006230 | Ga0207640_100062308 | 218 |
| 327 | 3300025981 | Ga0207640_10035301 | Ga0207640_100353013 | 218 |
| 328 | 3300026041 | Ga0207639_10000366 | Ga0207639_100003663 | 218 |
| 329 | 3300026041 | Ga0207639_10055592 | Ga0207639_100555923 | 218 |
| 330 | 3300026067 | Ga0207678_10000979 | Ga0207678_1000097916 | 218 |
| 331 | 3300026067 | Ga0207678_10040722 | Ga0207678_100407225 | 218 |
| 332 | 3300026078 | Ga0207702_10001863 | Ga0207702_100018639 | 218 |
| 333 | 3300026078 | Ga0207702_10006970 | Ga0207702_100069703 | 218 |
| 334 | 3300026116 | Ga0207674_10025605 | Ga0207674_100256054 | 218 |
| 335 | 3300026116 | Ga0207674_10054315 | Ga0207674_100543152 | 218 |
| 336 | 3300026142 | Ga0207698_10001985 | Ga0207698_100019852 | 218 |
| 337 | 3300026142 | Ga0207698_10064298 | Ga0207698_100642982 | 218 |
| 338 | 3300027866 | Ga0209813_10000216 | Ga0209813_100002163 | 218 |
| 339 | 3300031731 | Ga0307405_10006017 | Ga0307405_100060175 | 218 |
| 340 | 3300031731 | Ga0307405_10016968 | Ga0307405_100169683 | 218 |
| 341 | 3300031852 | Ga0307410_10036598 | Ga0307410_100365983 | 218 |
| 342 | 3300031903 | Ga0307407_10289833 | Ga0307407_102898332 | 218 |
| 343 | 3300032002 | Ga0307416_100269103 | Ga0307416_1002691032 | 218 |
| 344 | 3300032004 | Ga0307414_10612848 | Ga0307414_106128482 | 218 |
| 345 | 3300032005 | Ga0307411_10036252 | Ga0307411_100362525 | 218 |
| 346 | 3300046453 | Ga0495627_000110 | Ga0495627_000110_3843_4505 | 218 |
| 347 | 3300046460 | Ga0495638_0000073 | Ga0495638_0000073_62114_62776 | 218 |
| 348 | 3300046506 | Ga0495583_0000087 | Ga0495583_0000087_62081_62743 | 218 |
| 349 | 3300046512 | Ga0495610_0007959 | Ga0495610_0007959_5294_5956 | 218 |
| 350 | 3300046519 | Ga0495632_0001911 | Ga0495632_0001911_10015_10677 | 218 |
| 351 | 3300046524 | Ga0495648_0000049 | Ga0495648_0000049_62114_62776 | 218 |
| 352 | 3300046558 | Ga0495633_0213830 | Ga0495633_0213830_73_735 | 218 |
| 353 | 3300046692 | Ga0495671_0000042 | Ga0495671_0000042_62308_62970 | 218 |
| 354 | 3300047469 | Ga0495673_0000111 | Ga0495673_0000111_102232_102894 | 218 |
| 355 | 3300048913 | Ga0496110_0028275 | Ga0496110_0028275_3141_3893 | 218 |
| 356 | 3300048913 | Ga0496110_0035881 | Ga0496110_0035881_1269_2006 | 218 |
| 357 | 3300048914 | Ga0496111_0089706 | Ga0496111_0089706_524_1246 | 218 |
| 358 | 3300048915 | Ga0496112_0233658 | Ga0496112_0233658_113_850 | 218 |
| 359 | 3300048919 | Ga0496116_0178823 | Ga0496116_0178823_303_1040 | 218 |
| 360 | 3300048924 | Ga0496121_0032294 | Ga0496121_0032294_435_1187 | 218 |
| 361 | 3300048925 | Ga0496122_0041148 | Ga0496122_0041148_1760_2512 | 218 |
| 362 | 3300048926 | Ga0496123_0020708 | Ga0496123_0020708_214_966 | 218 |
| 363 | 3300048927 | Ga0496124_0016798 | Ga0496124_0016798_1212_1889 | 218 |
| 364 | 3300048928 | Ga0496125_0020671 | Ga0496125_0020671_4305_5057 | 218 |
| 365 | 3300048929 | Ga0496126_0257920 | Ga0496126_0257920_412_1149 | 218 |
| 366 | 3300048929 | Ga0496126_0272669 | Ga0496126_0272669_60_812 | 218 |
| 367 | 3300049574 | Ga0501038_0020213 | Ga0501038_0020213_1346_2014 | 218 |
| 368 | 3300050490 | nmdc:mga03n38_27598_c1 | nmdc:mga03n38_27598_c1_1360_2142 | 218 |
| 369 | 3300050494 | nmdc:mga06z11_111_c1 | nmdc:mga06z11_111_c1_17239_18021 | 218 |
| 370 | 3300050495 | nmdc:mga04h51_100_c1 | nmdc:mga04h51_100_c1_15583_16365 | 218 |
| 371 | 3300050496 | nmdc:mga07m45_185710_c1 | nmdc:mga07m45_185710_c1_501_1172 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2x27-assembly1.cif.gz_X | crystal structure of the outer membrane protein oprg from pseudomonas aeruginosa | 0.9277 | 22 | 218 |
| 2f1t-assembly3.cif.gz_C | outer membrane protein ompw | 0.9223 | 23 | 218 |
| 2f1v-assembly1.cif.gz_A | outer membrane protein ompw | 0.9206 | 23 | 218 |
| 2f1t-assembly3.cif.gz_C | outer membrane protein ompw | 0.9077 | 23 | 218 |
| 2f1v-assembly1.cif.gz_A | outer membrane protein ompw | 0.9059 | 23 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2x27X00 | Mainly Beta;Beta Barrel;Porin; | 0.9277 | 22 | 218 | 2.40.160.20 |
| 2f1tA00 | Mainly Beta;Beta Barrel;Porin; | 0.9263 | 23 | 218 | 2.40.160.20 |
| 2f1tA00 | Mainly Beta;Beta Barrel;Porin; | 0.9116 | 23 | 218 | 2.40.160.20 |
| 2x27X00 | Mainly Beta;Beta Barrel;Porin; | 0.8716 | 22 | 218 | 2.40.160.20 |
| 1qjpA00 | Mainly Beta;Beta Barrel;Porin; | 0.7107 | 21 | 218 | 2.40.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520JRN7-F1-model_v4 | OmpW family protein | 0.999 | 19 | 218 |
GO:0019867
GO:0055085 |
| AF-A0A258TDS3-F1-model_v4 | OmpW family protein | 0.9942 | 19 | 218 |
GO:0019867
GO:0055085 |
| AF-A0A239J7L3-F1-model_v4 | Outer membrane protein | 0.9895 | 14 | 218 |
GO:0019867
GO:0055085 |
| AF-A0A1W9H9M4-F1-model_v4 | OmpW family protein | 0.9886 | 20 | 218 |
GO:0019867
GO:0055085 |
| AF-A0A7Z2S5P6-F1-model_v4 | Outer membrane beta-barrel protein | 0.9774 | 14 | 218 |
GO:0019867
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar