F425814

General Info

Members Datasets Scaffolds Average Seq Length
371 198 371 124

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0002414|Ga0451577_0002414_20093_20503
Length 136
Sequence MTPLLTGGNRLIIGTGIDIAEIARFERFVAENNLPLLNRLFTPREYAYCSARRLSAQHFALRFAAKESFLKALGTGLRDGINWLDIEVVNDSLGKPVLELTGRAAEFFAAKGGGNCHLSLSHDAGCAIAMVVLEGN

Samples

Sample ID Description Type Environment
1 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.27
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 1.62
Rhizosphere 94.61
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10078583 3300003316 Bacteria 5677
2 rootH1_10078583 3300003323 Bacteria 9821
3 rootL2_10196589 3300003322 Unclassified 2321
4 rootL2_10384261 3300003322 Bacteria 1279
5 rootH1_10035951 3300003323 Bacteria 13234
6 Ga0065165_1001781 3300005262 Bacteria 21283
7 Ga0065704_10119855 3300005289 Bacteria 1793
8 Ga0065712_10278593 3300005290 Bacteria 900
9 Ga0065712_10499433 3300005290 Unclassified 639
10 Ga0065707_10009074 3300005295 Bacteria 3027
11 Ga0065707_10083488 3300005295 Bacteria 8975
12 Ga0070658_10005477 3300005327 Bacteria 10298
13 Ga0070676_10000262 3300005328 Bacteria 22949
14 Ga0070676_10438071 3300005328 Bacteria 916
15 Ga0070670_100444265 3300005331 Bacteria 1149
16 Ga0070677_10055814 3300005333 Bacteria 1614
17 Ga0068869_100065130 3300005334 Bacteria 2682
18 Ga0070666_10000648 3300005335 Bacteria 20974
19 Ga0070666_10064919 3300005335 Bacteria 2476
20 Ga0070680_100004495 3300005336 Bacteria 10508
21 Ga0070682_100000921 3300005337 Bacteria 17144
22 Ga0068868_100003081 3300005338 Bacteria 11605
23 Ga0068868_100294635 3300005338 Unclassified 1376
24 Ga0070660_100123347 3300005339 Bacteria 2069
25 Ga0070691_10016742 3300005341 Bacteria 3371
26 Ga0070661_100135080 3300005344 Unclassified 1855
27 Ga0070661_100205956 3300005344 Bacteria 1504
28 Ga0070661_100460313 3300005344 Bacteria 1013
29 Ga0070668_100007622 3300005347 Bacteria 8034
30 Ga0070668_100358089 3300005347 Bacteria 1236
31 Ga0070668_100490683 3300005347 Bacteria 1062
32 Ga0070669_101356970 3300005353 Unclassified 616
33 Ga0070675_100614668 3300005354 Bacteria 986
34 Ga0070675_102028638 3300005354 Bacteria 530
35 Ga0070673_100000580 3300005364 Bacteria 19823
36 Ga0070673_100180949 3300005364 Bacteria 1805
37 Ga0070667_100000151 3300005367 Bacteria 86629
38 Ga0070667_100074739 3300005367 Bacteria 2891
39 Ga0070667_100492276 3300005367 Bacteria 1123
40 Ga0070667_100703765 3300005367 Bacteria 935
41 Ga0070713_100706836 3300005436 Bacteria 962
42 Ga0070710_10116865 3300005437 Bacteria 1609
43 Ga0070711_101383021 3300005439 Bacteria 612
44 Ga0070708_100062367 3300005445 Bacteria 3334
45 Ga0070708_100134563 3300005445 Bacteria 2289
46 Ga0070663_100151017 3300005455 Bacteria 1781
47 Ga0070678_100069789 3300005456 Bacteria 2624
48 Ga0070662_100001317 3300005457 Bacteria 15266
49 Ga0070681_10118050 3300005458 Bacteria 2589
50 Ga0068867_100057667 3300005459 Bacteria 2876
51 Ga0068867_100103441 3300005459 Bacteria 2178
52 Ga0068867_100873546 3300005459 Bacteria 807
53 Ga0070679_100002055 3300005530 Bacteria 18077
54 Ga0070679_100793810 3300005530 Unclassified 890
55 Ga0068853_100049247 3300005539 Bacteria 3620
56 Ga0070672_100000225 3300005543 Bacteria 31458
57 Ga0070672_100033547 3300005543 Bacteria 3888
58 Ga0070672_101301838 3300005543 Bacteria 649
59 Ga0070693_100004896 3300005547 Bacteria 6390
60 Ga0070665_100160046 3300005548 Unclassified 2253
61 Ga0070665_100575233 3300005548 Bacteria 1139
62 Ga0068855_100128407 3300005563 Unclassified 2897
63 Ga0068857_100782201 3300005577 Bacteria 910
64 Ga0068857_101149520 3300005577 Bacteria 751
65 Ga0068854_100170903 3300005578 Bacteria 1691
66 Ga0068856_100002599 3300005614 Bacteria 18585
67 Ga0068852_100065785 3300005616 Bacteria 3164
68 Ga0068859_100053613 3300005617 Bacteria 4057
69 Ga0068859_101170460 3300005617 Bacteria 846
70 Ga0068859_101884028 3300005617 Bacteria 660
71 Ga0068864_100039871 3300005618 Bacteria 4015
72 Ga0068864_101370564 3300005618 Bacteria 709
73 Ga0068866_10009371 3300005718 Bacteria 4155
74 Ga0068861_100021954 3300005719 Bacteria 4593
75 Ga0068851_10000910 3300005834 Bacteria 12739
76 Ga0068851_10135630 3300005834 Bacteria 1334
77 Ga0068870_10461014 3300005840 Unclassified 840
78 Ga0068863_100000510 3300005841 Bacteria 39514
79 Ga0068863_100242663 3300005841 Unclassified 1739
80 Ga0068863_100692020 3300005841 Bacteria 1013
81 Ga0068858_100001077 3300005842 Bacteria 28263
82 Ga0068858_101421943 3300005842 Bacteria 683
83 Ga0068858_102010018 3300005842 Unclassified 571
84 Ga0068858_102181912 3300005842 Unclassified 548
85 Ga0068860_100013305 3300005843 Bacteria 8067
86 Ga0068860_100045105 3300005843 Bacteria 4203
87 Ga0068860_100385609 3300005843 Bacteria 1384
88 Ga0068862_100245409 3300005844 Unclassified 1630
89 Ga0070717_10002290 3300006028 Bacteria 13426
90 Ga0070716_100090221 3300006173 Unclassified 1853
91 Ga0070712_100274819 3300006175 Bacteria 1355
92 Ga0097621_100014262 3300006237 Bacteria 5943
93 Ga0097621_100290979 3300006237 Unclassified 1440
94 Ga0097621_100407254 3300006237 Bacteria 1218
95 Ga0097621_100524666 3300006237 Bacteria 1075
96 Ga0097621_102082682 3300006237 Unclassified 542
97 Ga0068871_100001549 3300006358 Bacteria 15431
98 Ga0068865_100005540 3300006881 Bacteria 7661
99 Ga0068865_100094066 3300006881 Bacteria 2180
100 Ga0068865_100825492 3300006881 Unclassified 801
101 Ga0097620_100053614 3300006931 Bacteria 4057
102 Ga0097620_101170561 3300006931 Bacteria 846
103 Ga0097620_101884050 3300006931 Bacteria 660
104 Ga0099795_10021180 3300007788 Bacteria 2129
105 Ga0099795_10532141 3300007788 Unclassified 552
106 Ga0105251_10121850 3300009011 Unclassified 1184
107 Ga0105240_10014907 3300009093 Bacteria 10589
108 Ga0105240_10118243 3300009093 Bacteria 3194
109 Ga0105240_10843199 3300009093 Bacteria 990
110 Ga0105240_12343443 3300009093 Unclassified 553
111 Ga0105245_10056797 3300009098 Bacteria 3519
112 Ga0105243_10088521 3300009148 Bacteria 2544
113 Ga0105243_10154725 3300009148 Bacteria 1971
114 Ga0105241_10002398 3300009174 Bacteria 14076
115 Ga0105242_10032726 3300009176 Bacteria 4159
116 Ga0105242_10049886 3300009176 Bacteria 3407
117 Ga0105248_10503770 3300009177 Unclassified 1365
118 Ga0105238_11093407 3300009551 Bacteria 820
119 Ga0105249_10017791 3300009553 Bacteria 6315
120 Ga0105249_10379784 3300009553 Bacteria 1439
121 Ga0105249_10764795 3300009553 Unclassified 1029
122 Ga0105249_11280547 3300009553 Unclassified 805
123 Ga0099796_10043864 3300010159 Bacteria 1525
124 Ga0099796_10455085 3300010159 Bacteria 570
125 Ga0105239_10038985 3300010375 Bacteria 5204
126 Ga0105239_10859319 3300010375 Bacteria 1041
127 Ga0105239_12468207 3300010375 Unclassified 606
128 Ga0105246_10331245 3300011119 Bacteria 1241
129 Ga0105246_11769411 3300011119 Bacteria 589
130 Ga0157373_10644403 3300013100 Bacteria 773
131 Ga0157371_10175034 3300013102 Bacteria 1534
132 Ga0157370_10002126 3300013104 Bacteria 24195
133 Ga0157370_10004238 3300013104 Bacteria 16589
134 Ga0157370_10087242 3300013104 Bacteria 2931
135 Ga0157370_10127682 3300013104 Bacteria 2373
136 Ga0157370_10814465 3300013104 Bacteria 849
137 Ga0157369_10215575 3300013105 Unclassified 2011
138 Ga0157369_10246006 3300013105 Unclassified 1867
139 Ga0157374_10000498 3300013296 Bacteria 35652
140 Ga0157378_10005695 3300013297 Bacteria 10902
141 Ga0157378_10094802 3300013297 Bacteria 2717
142 Ga0163162_10000515 3300013306 Bacteria 35864
143 Ga0163162_10005375 3300013306 Bacteria 12368
144 Ga0163162_10114832 3300013306 Bacteria 2792
145 Ga0163162_10176774 3300013306 Bacteria 2260
146 Ga0163162_10655108 3300013306 Bacteria 1174
147 Ga0157372_10258390 3300013307 Bacteria 2022
148 Ga0157372_10291231 3300013307 Unclassified 1899
149 Ga0157372_10734527 3300013307 Unclassified 1148
150 Ga0157375_10000476 3300013308 Bacteria 36510
151 Ga0157375_10090936 3300013308 Bacteria 3112
152 Ga0157375_10440899 3300013308 Unclassified 1468
153 Ga0163163_10004719 3300014325 Bacteria 11678
154 Ga0157380_10975109 3300014326 Bacteria 879
155 Ga0157379_10000114 3300014968 Bacteria 55633
156 Ga0157379_10152119 3300014968 Bacteria 2087
157 Ga0157379_10712473 3300014968 Bacteria 943
158 Ga0157379_11199671 3300014968 Unclassified 730
159 Ga0157376_10000596 3300014969 Bacteria 23325
160 Ga0157376_10155142 3300014969 Unclassified 2069
161 Ga0157376_10570864 3300014969 Unclassified 1122
162 Ga0163161_10330976 3300017792 Bacteria 1206
163 Ga0209050_1022015 3300025298 Bacteria 2300
164 Ga0207697_10043596 3300025315 Bacteria 1845
165 Ga0207656_10001994 3300025321 Bacteria 6803
166 Ga0207688_10013390 3300025901 Bacteria 4455
167 Ga0207680_10001497 3300025903 Bacteria 11018
168 Ga0207680_10099975 3300025903 Unclassified 1862
169 Ga0207647_10628226 3300025904 Bacteria 590
170 Ga0207645_10000496 3300025907 Bacteria 32469
171 Ga0207645_10000631 3300025907 Bacteria 29230
172 Ga0207643_10500940 3300025908 Unclassified 776
173 Ga0207705_10004700 3300025909 Bacteria 10296
174 Ga0207654_10019898 3300025911 Unclassified 3550
175 Ga0207707_10000611 3300025912 Bacteria 35815
176 Ga0207695_10097031 3300025913 Bacteria 2949
177 Ga0207695_10808445 3300025913 Bacteria 817
178 Ga0207695_11465376 3300025913 Bacteria 563
179 Ga0207693_10268139 3300025915 Unclassified 1338
180 Ga0207660_10003274 3300025917 Bacteria 10588
181 Ga0207657_10347335 3300025919 Bacteria 1170
182 Ga0207657_10909404 3300025919 Bacteria 678
183 Ga0207652_10032094 3300025921 Unclassified 4411
184 Ga0207646_10174507 3300025922 Bacteria 1941
185 Ga0207650_10546388 3300025925 Bacteria 971
186 Ga0207650_11545057 3300025925 Unclassified 564
187 Ga0207659_10043055 3300025926 Bacteria 3169
188 Ga0207659_10726437 3300025926 Bacteria 851
189 Ga0207706_10006982 3300025933 Bacteria 10437
190 Ga0207686_10088801 3300025934 Bacteria 2036
191 Ga0207686_10113885 3300025934 Bacteria 1829
192 Ga0207704_10000928 3300025938 Bacteria 12957
193 Ga0207704_10254097 3300025938 Bacteria 1321
194 Ga0207704_11030233 3300025938 Unclassified 697
195 Ga0207665_10158032 3300025939 Unclassified 1628
196 Ga0207691_10000067 3300025940 Bacteria 84512
197 Ga0207691_10414043 3300025940 Bacteria 1149
198 Ga0207691_10569982 3300025940 Bacteria 959
199 Ga0207689_10005978 3300025942 Bacteria 10766
200 Ga0207689_10017524 3300025942 Bacteria 6056
201 Ga0207689_10057764 3300025942 Bacteria 3191
202 Ga0207679_11147600 3300025945 Bacteria 713
203 Ga0207667_10052725 3300025949 Unclassified 4282
204 Ga0207651_10094836 3300025960 Unclassified 2195
205 Ga0207712_10200305 3300025961 Unclassified 1583
206 Ga0207712_10255973 3300025961 Bacteria 1417
207 Ga0207712_10358555 3300025961 Bacteria 1214
208 Ga0207668_10000310 3300025972 Bacteria 31943
209 Ga0207668_10389542 3300025972 Unclassified 1175
210 Ga0207668_11349470 3300025972 Unclassified 642
211 Ga0207658_10002592 3300025986 Bacteria 13130
212 Ga0207658_10383973 3300025986 Unclassified 1231
213 Ga0207658_10423760 3300025986 Bacteria 1174
214 Ga0207677_10000704 3300026023 Bacteria 19842
215 Ga0207677_11380335 3300026023 Unclassified 649
216 Ga0207703_10003179 3300026035 Bacteria 13838
217 Ga0207703_10920337 3300026035 Bacteria 837
218 Ga0207639_10037046 3300026041 Bacteria 3620
219 Ga0207639_10039961 3300026041 Unclassified 3499
220 Ga0207639_10146233 3300026041 Bacteria 1974
221 Ga0207678_10221814 3300026067 Bacteria 1618
222 Ga0207702_10031859 3300026078 Bacteria 4397
223 Ga0207641_10001302 3300026088 Bacteria 24754
224 Ga0207641_10026497 3300026088 Bacteria 4785
225 Ga0207641_11188159 3300026088 Bacteria 762
226 Ga0207641_12528905 3300026088 Unclassified 512
227 Ga0207648_10014626 3300026089 Bacteria 7245
228 Ga0207676_10030438 3300026095 Bacteria 4052
229 Ga0207674_11059005 3300026116 Bacteria 780
230 Ga0207675_100086981 3300026118 Bacteria 2935
231 Ga0207675_100117197 3300026118 Bacteria 2518
232 Ga0207683_10346023 3300026121 Unclassified 1364
233 Ga0207698_10042752 3300026142 Bacteria 3389
234 Ga0268266_10007373 3300028379 Bacteria 9932
235 Ga0268266_11184039 3300028379 Bacteria 739
236 Ga0268265_10497678 3300028380 Bacteria 1148
237 Ga0268264_10112315 3300028381 Bacteria 2389
238 Ga0268264_10128174 3300028381 Bacteria 2246
239 Ga0268264_10287343 3300028381 Bacteria 1543
240 Ga0265338_10002470 3300028800 Bacteria 27614
241 Ga0265338_10052457 3300028800 Bacteria 3658
242 Ga0265338_10151099 3300028800 Bacteria 1804
243 Ga0265324_10189398 3300029957 Bacteria 699
244 Ga0265762_1009088 3300030760 Bacteria 1772
245 Ga0265327_10022357 3300031251 Bacteria 3785
246 Ga0265327_10029109 3300031251 Bacteria 3146
247 Ga0265316_10017015 3300031344 Bacteria 6294
248 Ga0265316_10077330 3300031344 Bacteria 2556
249 Ga0265314_10020965 3300031711 Bacteria 5038
250 Ga0265314_10090112 3300031711 Unclassified 1998
251 Ga0265342_10436131 3300031712 Unclassified 673
252 Ga0307405_10854819 3300031731 Unclassified 766
253 Ga0307414_10000017 3300032004 Bacteria 247306
254 Ga0307414_10040994 3300032004 Bacteria 3131
255 Ga0373928_0006155 3300035084 Bacteria 2304
256 Ga0373953_0172317 3300035117 Bacteria 932
257 Ga0373955_0076793 3300035172 Bacteria 1880
258 Ga0373955_0223878 3300035172 Bacteria 1124
259 Ga0373935_0581226 3300035692 Bacteria 818
260 Ga0373935_0752722 3300035692 Bacteria 718
261 Ga0373927_0508254 3300035695 Unclassified 796
262 Ga0373933_0005852 3300035724 Bacteria 6685
263 Ga0373933_0926876 3300035724 Bacteria 574
264 Ga0373937_0125731 3300036401 Bacteria 2392
265 Ga0373937_0134173 3300036401 Bacteria 2314
266 Ga0373937_0261440 3300036401 Bacteria 1632
267 Ga0373937_1641828 3300036401 Bacteria 590
268 Ga0373925_0582183 3300037068 Unclassified 921
269 Ga0373925_0884640 3300037068 Unclassified 736
270 Ga0373925_0981615 3300037068 Bacteria 696
271 Ga0436364_0845729 3300037853 Unclassified 861
272 Ga0436363_1594272 3300039450 Bacteria 1669
273 Ga0451795_0383258 3300041456 Bacteria 1038
274 Ga0451855_0785823 3300041511 Unclassified 697
275 Ga0451577_0001056 3300042876 Bacteria 39727
276 Ga0451577_0002414 3300042876 Bacteria 22289
277 Ga0451577_0034417 3300042876 Bacteria 4566
278 Ga0451577_0057282 3300042876 Bacteria 3474
279 Ga0451577_0092989 3300042876 Bacteria 2693
280 Ga0451577_0199395 3300042876 Bacteria 1807
281 Ga0451577_0296636 3300042876 Bacteria 1465
282 Ga0451577_0423341 3300042876 Unclassified 1209
283 Ga0451577_0526877 3300042876 Unclassified 1073
284 Ga0451577_0726698 3300042876 Bacteria 899
285 Ga0453683_0000002 3300044673 Bacteria 1244396
286 Ga0453683_0000108 3300044673 Bacteria 124178
287 Ga0453683_0000704 3300044673 Bacteria 34785
288 Ga0453683_0010715 3300044673 Bacteria 6070
289 Ga0453683_0011650 3300044673 Bacteria 5791
290 Ga0453683_0041787 3300044673 Bacteria 2879
291 Ga0453683_0047922 3300044673 Bacteria 2680
292 Ga0453683_0057044 3300044673 Bacteria 2444
293 Ga0453683_0145650 3300044673 Bacteria 1495
294 Ga0453683_0146498 3300044673 Unclassified 1491
295 Ga0453683_0170393 3300044673 Bacteria 1379
296 Ga0453683_0241750 3300044673 Unclassified 1150
297 Ga0453683_0337096 3300044673 Unclassified 968
298 Ga0453683_0429840 3300044673 Bacteria 853
299 Ga0453683_0646231 3300044673 Bacteria 691
300 Ga0453684_0000457 3300044712 Bacteria 163653
301 Ga0453684_0001567 3300044712 Bacteria 63409
302 Ga0453684_0002972 3300044712 Bacteria 39605
303 Ga0453684_0021658 3300044712 Bacteria 9587
304 Ga0453684_0039133 3300044712 Bacteria 6468
305 Ga0453684_0083529 3300044712 Bacteria 3974
306 Ga0453684_0105317 3300044712 Bacteria 3440
307 Ga0453684_0122297 3300044712 Bacteria 3140
308 Ga0453684_0248588 3300044712 Bacteria 2043
309 Ga0453684_0260397 3300044712 Bacteria 1987
310 Ga0453684_0298818 3300044712 Bacteria 1830
311 Ga0453684_0380367 3300044712 Bacteria 1585
312 Ga0453684_0460731 3300044712 Unclassified 1414
313 Ga0453684_0937343 3300044712 Bacteria 925
314 Ga0453684_1315376 3300044712 Unclassified 753
315 Ga0451576_0002739 3300045051 Bacteria 25571
316 Ga0451576_0006447 3300045051 Bacteria 14389
317 Ga0451576_0026579 3300045051 Bacteria 6225
318 Ga0451576_0121823 3300045051 Bacteria 2716
319 Ga0451576_0130613 3300045051 Bacteria 2618
320 Ga0451576_0150165 3300045051 Bacteria 2430
321 Ga0451576_0209293 3300045051 Unclassified 2037
322 Ga0451576_0269335 3300045051 Unclassified 1780
323 Ga0451576_0599120 3300045051 Bacteria 1158
324 Ga0451576_0677497 3300045051 Bacteria 1083
325 Ga0451576_0688410 3300045051 Bacteria 1074
326 Ga0451576_1515638 3300045051 Unclassified 696
327 Ga0495592_0125361 3300046454 Bacteria 1803
328 Ga0495629_0164478 3300046459 Bacteria 1541
329 Ga0495629_0854925 3300046459 Unclassified 598
330 Ga0495653_0528087 3300046463 Unclassified 733
331 Ga0495650_0020707 3300046471 Bacteria 3200
332 Ga0495580_0942089 3300046472 Bacteria 553
333 Ga0495582_0267070 3300046473 Bacteria 982
334 Ga0495630_0126690 3300046517 Bacteria 1938
335 Ga0495665_0144822 3300046531 Bacteria 1241
336 Ga0495645_0584088 3300046543 Unclassified 689
337 Ga0495635_0265658 3300046663 Unclassified 1155
338 Ga0495635_0929439 3300046663 Bacteria 556
339 Ga0495657_0140289 3300046675 Unclassified 1507
340 Ga0495657_0187933 3300046675 Bacteria 1264
341 Ga0495669_0008206 3300046684 Bacteria 4384
342 Ga0495670_0374847 3300046691 Bacteria 767
343 Ga0495600_0951105 3300046809 Bacteria 505
344 Ga0495674_0189670 3300047319 Unclassified 1709
345 Ga0495674_0346888 3300047319 Unclassified 1206
346 Ga0495602_0448542 3300048088 Unclassified 911
347 Ga0495602_1175058 3300048088 Bacteria 501
348 Ga0496102_0966407 3300048905 Unclassified 773
349 Ga0496104_0353228 3300048907 Bacteria 1383
350 Ga0496109_0030100 3300048912 Bacteria 4866
351 Ga0496110_1082466 3300048913 Bacteria 710
352 Ga0496114_1085630 3300048917 Bacteria 685
353 Ga0501032_0291725 3300049569 Bacteria 1055
354 Ga0501034_0042857 3300049571 Unclassified 4581
355 Ga0501047_0254101 3300049581 Bacteria 1606
356 Ga0501068_0332817 3300049584 Bacteria 974
357 Ga0501069_0191174 3300049585 Unclassified 1184
358 Ga0501071_0071404 3300049587 Unclassified 2531
359 Ga0501073_0010990 3300049589 Bacteria 6621
360 Ga0501079_0030151 3300049741 Unclassified 4168
361 Ga0501080_0256615 3300049742 Unclassified 1593
362 Ga0501083_0331510 3300049744 Unclassified 989
363 Ga0501044_0045288 3300049823 Bacteria 4559
364 Ga0495619_0664892 3300053085 Bacteria 710
365 Ga0500578_0125628 3300053086 Unclassified 1611
366 Ga0500568_0053354 3300053139 Bacteria 1585
367 Ga0500568_0225796 3300053139 Unclassified 684
368 Ga0500616_0004017 3300053153 Bacteria 10720
369 Ga0500622_0003424 3300053156 Bacteria 10636
370 Ga0501084_0721126 3300054114 Bacteria 840
371 Ga0501082_0319521 3300060353 Bacteria 1352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025298 Ga0209050_1022015 Ga0209050_10220152 110
2 3300046684 Ga0495669_0008206 Ga0495669_0008206_2868_3245 110
3 3300005445 Ga0070708_100062367 Ga0070708_1000623672 111
4 3300005614 Ga0068856_100002599 Ga0068856_1000025993 111
5 3300025922 Ga0207646_10174507 Ga0207646_101745071 111
6 3300026078 Ga0207702_10031859 Ga0207702_100318593 111
7 3300030760 Ga0265762_1009088 Ga0265762_10090883 111
8 3300035172 Ga0373955_0223878 Ga0373955_0223878_59_436 111
9 3300035724 Ga0373933_0005852 Ga0373933_0005852_1992_2369 111
10 3300036401 Ga0373937_0134173 Ga0373937_0134173_671_1048 111
11 3300037068 Ga0373925_0884640 Ga0373925_0884640_347_724 111
12 3300046463 Ga0495653_0528087 Ga0495653_0528087_58_435 111
13 3300005577 Ga0068857_101149520 Ga0068857_1011495202 116
14 3300005834 Ga0068851_10135630 Ga0068851_101356301 116
15 3300005840 Ga0068870_10461014 Ga0068870_104610142 116
16 3300006237 Ga0097621_100407254 Ga0097621_1004072542 116
17 3300025315 Ga0207697_10043596 Ga0207697_100435962 116
18 3300025908 Ga0207643_10500940 Ga0207643_105009401 116
19 3300025911 Ga0207654_10019898 Ga0207654_100198982 116
20 3300025925 Ga0207650_10546388 Ga0207650_105463881 116
21 3300025934 Ga0207686_10113885 Ga0207686_101138852 116
22 3300025940 Ga0207691_10569982 Ga0207691_105699822 116
23 3300025972 Ga0207668_10389542 Ga0207668_103895422 116
24 3300026116 Ga0207674_11059005 Ga0207674_110590052 116
25 3300026121 Ga0207683_10346023 Ga0207683_103460232 116
26 3300005439 Ga0070711_101383021 Ga0070711_1013830212 117
27 3300031712 Ga0265342_10436131 Ga0265342_104361311 117
28 3300039450 Ga0436363_1594272 Ga0436363_1594272_525_902 117
29 3300053085 Ga0495619_0664892 Ga0495619_0664892_229_606 117
30 iso_pu_bacteria 2919692658 2919694156 117
31 3300037853 Ga0436364_0845729 Ga0436364_0845729_373_750 118
32 3300032004 Ga0307414_10000017 Ga0307414_10000017174 121
33 3300032004 Ga0307414_10040994 Ga0307414_100409943 121
34 3300041511 Ga0451855_0785823 Ga0451855_0785823_280_648 121
35 3300044712 Ga0453684_0460731 Ga0453684_0460731_605_976 122
36 3300045051 Ga0451576_0150165 Ga0451576_0150165_2001_2381 122
37 3300003322 rootL2_10196589 rootL2_101965891 123
38 3300003323 rootH1_10035951 rootH1_100359516 123
39 3300005262 Ga0065165_1001781 Ga0065165_100178122 123
40 3300006237 Ga0097621_100290979 Ga0097621_1002909792 123
41 3300003316 rootH1_10078583 rootH1_100785832 124
42 3300003322 rootL2_10384261 rootL2_103842612 124
43 3300005289 Ga0065704_10119855 Ga0065704_101198552 124
44 3300005290 Ga0065712_10278593 Ga0065712_102785932 124
45 3300005290 Ga0065712_10499433 Ga0065712_104994331 124
46 3300005295 Ga0065707_10009074 Ga0065707_100090742 124
47 3300005295 Ga0065707_10083488 Ga0065707_100834882 124
48 3300005327 Ga0070658_10005477 Ga0070658_100054777 124
49 3300005328 Ga0070676_10000262 Ga0070676_100002622 124
50 3300005328 Ga0070676_10438071 Ga0070676_104380712 124
51 3300005331 Ga0070670_100444265 Ga0070670_1004442652 124
52 3300005333 Ga0070677_10055814 Ga0070677_100558142 124
53 3300005334 Ga0068869_100065130 Ga0068869_1000651302 124
54 3300005335 Ga0070666_10000648 Ga0070666_100006482 124
55 3300005335 Ga0070666_10064919 Ga0070666_100649193 124
56 3300005336 Ga0070680_100004495 Ga0070680_10000449510 124
57 3300005337 Ga0070682_100000921 Ga0070682_1000009213 124
58 3300005338 Ga0068868_100003081 Ga0068868_1000030819 124
59 3300005338 Ga0068868_100294635 Ga0068868_1002946352 124
60 3300005339 Ga0070660_100123347 Ga0070660_1001233472 124
61 3300005341 Ga0070691_10016742 Ga0070691_100167422 124
62 3300005344 Ga0070661_100135080 Ga0070661_1001350802 124
63 3300005344 Ga0070661_100205956 Ga0070661_1002059562 124
64 3300005344 Ga0070661_100460313 Ga0070661_1004603132 124
65 3300005347 Ga0070668_100007622 Ga0070668_1000076224 124
66 3300005347 Ga0070668_100358089 Ga0070668_1003580892 124
67 3300005347 Ga0070668_100490683 Ga0070668_1004906832 124
68 3300005353 Ga0070669_101356970 Ga0070669_1013569701 124
69 3300005354 Ga0070675_100614668 Ga0070675_1006146681 124
70 3300005354 Ga0070675_102028638 Ga0070675_1020286381 124
71 3300005364 Ga0070673_100000580 Ga0070673_10000058013 124
72 3300005364 Ga0070673_100180949 Ga0070673_1001809492 124
73 3300005367 Ga0070667_100000151 Ga0070667_10000015173 124
74 3300005367 Ga0070667_100074739 Ga0070667_1000747392 124
75 3300005367 Ga0070667_100492276 Ga0070667_1004922762 124
76 3300005367 Ga0070667_100703765 Ga0070667_1007037652 124
77 3300005436 Ga0070713_100706836 Ga0070713_1007068361 124
78 3300005437 Ga0070710_10116865 Ga0070710_101168652 124
79 3300005445 Ga0070708_100134563 Ga0070708_1001345632 124
80 3300005455 Ga0070663_100151017 Ga0070663_1001510172 124
81 3300005456 Ga0070678_100069789 Ga0070678_1000697892 124
82 3300005457 Ga0070662_100001317 Ga0070662_1000013178 124
83 3300005458 Ga0070681_10118050 Ga0070681_101180502 124
84 3300005459 Ga0068867_100057667 Ga0068867_1000576672 124
85 3300005459 Ga0068867_100103441 Ga0068867_1001034412 124
86 3300005459 Ga0068867_100873546 Ga0068867_1008735462 124
87 3300005530 Ga0070679_100002055 Ga0070679_1000020558 124
88 3300005530 Ga0070679_100793810 Ga0070679_1007938102 124
89 3300005539 Ga0068853_100049247 Ga0068853_1000492472 124
90 3300005543 Ga0070672_100000225 Ga0070672_10000022515 124
91 3300005543 Ga0070672_100033547 Ga0070672_1000335473 124
92 3300005543 Ga0070672_101301838 Ga0070672_1013018382 124
93 3300005547 Ga0070693_100004896 Ga0070693_1000048962 124
94 3300005548 Ga0070665_100160046 Ga0070665_1001600463 124
95 3300005548 Ga0070665_100575233 Ga0070665_1005752332 124
96 3300005563 Ga0068855_100128407 Ga0068855_1001284073 124
97 3300005577 Ga0068857_100782201 Ga0068857_1007822012 124
98 3300005578 Ga0068854_100170903 Ga0068854_1001709032 124
99 3300005616 Ga0068852_100065785 Ga0068852_1000657853 124
100 3300005617 Ga0068859_100053613 Ga0068859_1000536132 124
101 3300005617 Ga0068859_101170460 Ga0068859_1011704602 124
102 3300005617 Ga0068859_101884028 Ga0068859_1018840282 124
103 3300005618 Ga0068864_100039871 Ga0068864_1000398712 124
104 3300005618 Ga0068864_101370564 Ga0068864_1013705642 124
105 3300005718 Ga0068866_10009371 Ga0068866_100093711 124
106 3300005719 Ga0068861_100021954 Ga0068861_1000219545 124
107 3300005834 Ga0068851_10000910 Ga0068851_100009104 124
108 3300005841 Ga0068863_100000510 Ga0068863_10000051022 124
109 3300005841 Ga0068863_100242663 Ga0068863_1002426632 124
110 3300005841 Ga0068863_100692020 Ga0068863_1006920202 124
111 3300005842 Ga0068858_100001077 Ga0068858_10000107722 124
112 3300005842 Ga0068858_101421943 Ga0068858_1014219432 124
113 3300005842 Ga0068858_102010018 Ga0068858_1020100181 124
114 3300005842 Ga0068858_102181912 Ga0068858_1021819122 124
115 3300005843 Ga0068860_100013305 Ga0068860_1000133052 124
116 3300005843 Ga0068860_100045105 Ga0068860_1000451053 124
117 3300005843 Ga0068860_100385609 Ga0068860_1003856092 124
118 3300005844 Ga0068862_100245409 Ga0068862_1002454092 124
119 3300006028 Ga0070717_10002290 Ga0070717_100022905 124
120 3300006173 Ga0070716_100090221 Ga0070716_1000902212 124
121 3300006175 Ga0070712_100274819 Ga0070712_1002748192 124
122 3300006237 Ga0097621_100014262 Ga0097621_1000142625 124
123 3300006237 Ga0097621_100524666 Ga0097621_1005246662 124
124 3300006237 Ga0097621_102082682 Ga0097621_1020826822 124
125 3300006358 Ga0068871_100001549 Ga0068871_1000015497 124
126 3300006881 Ga0068865_100005540 Ga0068865_1000055403 124
127 3300006881 Ga0068865_100094066 Ga0068865_1000940662 124
128 3300006881 Ga0068865_100825492 Ga0068865_1008254922 124
129 3300006931 Ga0097620_100053614 Ga0097620_1000536143 124
130 3300006931 Ga0097620_101170561 Ga0097620_1011705612 124
131 3300006931 Ga0097620_101884050 Ga0097620_1018840502 124
132 3300007788 Ga0099795_10021180 Ga0099795_100211802 124
133 3300007788 Ga0099795_10532141 Ga0099795_105321412 124
134 3300009011 Ga0105251_10121850 Ga0105251_101218502 124
135 3300009093 Ga0105240_10014907 Ga0105240_100149078 124
136 3300009093 Ga0105240_10118243 Ga0105240_101182432 124
137 3300009093 Ga0105240_10843199 Ga0105240_108431992 124
138 3300009093 Ga0105240_12343443 Ga0105240_123434432 124
139 3300009098 Ga0105245_10056797 Ga0105245_100567973 124
140 3300009148 Ga0105243_10088521 Ga0105243_100885212 124
141 3300009148 Ga0105243_10154725 Ga0105243_101547251 124
142 3300009174 Ga0105241_10002398 Ga0105241_100023984 124
143 3300009176 Ga0105242_10032726 Ga0105242_100327262 124
144 3300009176 Ga0105242_10049886 Ga0105242_100498863 124
145 3300009177 Ga0105248_10503770 Ga0105248_105037702 124
146 3300009551 Ga0105238_11093407 Ga0105238_110934072 124
147 3300009553 Ga0105249_10017791 Ga0105249_100177914 124
148 3300009553 Ga0105249_10379784 Ga0105249_103797842 124
149 3300009553 Ga0105249_10764795 Ga0105249_107647952 124
150 3300009553 Ga0105249_11280547 Ga0105249_112805472 124
151 3300010159 Ga0099796_10043864 Ga0099796_100438642 124
152 3300010159 Ga0099796_10455085 Ga0099796_104550852 124
153 3300010375 Ga0105239_10038985 Ga0105239_100389855 124
154 3300010375 Ga0105239_10859319 Ga0105239_108593192 124
155 3300010375 Ga0105239_12468207 Ga0105239_124682071 124
156 3300011119 Ga0105246_10331245 Ga0105246_103312452 124
157 3300011119 Ga0105246_11769411 Ga0105246_117694112 124
158 3300013100 Ga0157373_10644403 Ga0157373_106444032 124
159 3300013102 Ga0157371_10175034 Ga0157371_101750342 124
160 3300013104 Ga0157370_10002126 Ga0157370_100021269 124
161 3300013104 Ga0157370_10004238 Ga0157370_100042382 124
162 3300013104 Ga0157370_10087242 Ga0157370_100872423 124
163 3300013104 Ga0157370_10127682 Ga0157370_101276822 124
164 3300013104 Ga0157370_10814465 Ga0157370_108144652 124
165 3300013105 Ga0157369_10215575 Ga0157369_102155751 124
166 3300013105 Ga0157369_10246006 Ga0157369_102460062 124
167 3300013296 Ga0157374_10000498 Ga0157374_1000049822 124
168 3300013297 Ga0157378_10005695 Ga0157378_100056954 124
169 3300013297 Ga0157378_10094802 Ga0157378_100948022 124
170 3300013306 Ga0163162_10000515 Ga0163162_100005157 124
171 3300013306 Ga0163162_10005375 Ga0163162_100053755 124
172 3300013306 Ga0163162_10114832 Ga0163162_101148323 124
173 3300013306 Ga0163162_10176774 Ga0163162_101767742 124
174 3300013306 Ga0163162_10655108 Ga0163162_106551082 124
175 3300013307 Ga0157372_10258390 Ga0157372_102583902 124
176 3300013307 Ga0157372_10291231 Ga0157372_102912311 124
177 3300013307 Ga0157372_10734527 Ga0157372_107345272 124
178 3300013308 Ga0157375_10000476 Ga0157375_1000047613 124
179 3300013308 Ga0157375_10090936 Ga0157375_100909362 124
180 3300013308 Ga0157375_10440899 Ga0157375_104408992 124
181 3300014325 Ga0163163_10004719 Ga0163163_100047192 124
182 3300014326 Ga0157380_10975109 Ga0157380_109751091 124
183 3300014968 Ga0157379_10000114 Ga0157379_1000011432 124
184 3300014968 Ga0157379_10152119 Ga0157379_101521192 124
185 3300014968 Ga0157379_10712473 Ga0157379_107124731 124
186 3300014968 Ga0157379_11199671 Ga0157379_111996712 124
187 3300014969 Ga0157376_10000596 Ga0157376_1000059610 124
188 3300014969 Ga0157376_10155142 Ga0157376_101551422 124
189 3300014969 Ga0157376_10570864 Ga0157376_105708642 124
190 3300017792 Ga0163161_10330976 Ga0163161_103309762 124
191 3300025321 Ga0207656_10001994 Ga0207656_100019943 124
192 3300025901 Ga0207688_10013390 Ga0207688_100133901 124
193 3300025903 Ga0207680_10001497 Ga0207680_100014974 124
194 3300025903 Ga0207680_10099975 Ga0207680_100999753 124
195 3300025904 Ga0207647_10628226 Ga0207647_106282262 124
196 3300025907 Ga0207645_10000496 Ga0207645_1000049629 124
197 3300025907 Ga0207645_10000631 Ga0207645_1000063120 124
198 3300025909 Ga0207705_10004700 Ga0207705_100047007 124
199 3300025912 Ga0207707_10000611 Ga0207707_1000061118 124
200 3300025913 Ga0207695_10097031 Ga0207695_100970312 124
201 3300025913 Ga0207695_10808445 Ga0207695_108084452 124
202 3300025913 Ga0207695_11465376 Ga0207695_114653762 124
203 3300025915 Ga0207693_10268139 Ga0207693_102681393 124
204 3300025917 Ga0207660_10003274 Ga0207660_100032742 124
205 3300025919 Ga0207657_10347335 Ga0207657_103473352 124
206 3300025919 Ga0207657_10909404 Ga0207657_109094041 124
207 3300025921 Ga0207652_10032094 Ga0207652_100320943 124
208 3300025925 Ga0207650_11545057 Ga0207650_115450571 124
209 3300025926 Ga0207659_10043055 Ga0207659_100430552 124
210 3300025926 Ga0207659_10726437 Ga0207659_107264372 124
211 3300025933 Ga0207706_10006982 Ga0207706_100069822 124
212 3300025934 Ga0207686_10088801 Ga0207686_100888012 124
213 3300025938 Ga0207704_10000928 Ga0207704_100009284 124
214 3300025938 Ga0207704_10254097 Ga0207704_102540972 124
215 3300025938 Ga0207704_11030233 Ga0207704_110302331 124
216 3300025939 Ga0207665_10158032 Ga0207665_101580322 124
217 3300025940 Ga0207691_10000067 Ga0207691_1000006728 124
218 3300025940 Ga0207691_10414043 Ga0207691_104140432 124
219 3300025942 Ga0207689_10005978 Ga0207689_100059785 124
220 3300025942 Ga0207689_10017524 Ga0207689_100175242 124
221 3300025942 Ga0207689_10057764 Ga0207689_100577643 124
222 3300025945 Ga0207679_11147600 Ga0207679_111476002 124
223 3300025949 Ga0207667_10052725 Ga0207667_100527252 124
224 3300025960 Ga0207651_10094836 Ga0207651_100948362 124
225 3300025961 Ga0207712_10200305 Ga0207712_102003052 124
226 3300025961 Ga0207712_10255973 Ga0207712_102559731 124
227 3300025961 Ga0207712_10358555 Ga0207712_103585552 124
228 3300025972 Ga0207668_10000310 Ga0207668_1000031022 124
229 3300025972 Ga0207668_11349470 Ga0207668_113494702 124
230 3300025986 Ga0207658_10002592 Ga0207658_100025924 124
231 3300025986 Ga0207658_10383973 Ga0207658_103839732 124
232 3300025986 Ga0207658_10423760 Ga0207658_104237602 124
233 3300026023 Ga0207677_10000704 Ga0207677_100007044 124
234 3300026023 Ga0207677_11380335 Ga0207677_113803351 124
235 3300026035 Ga0207703_10003179 Ga0207703_100031797 124
236 3300026035 Ga0207703_10920337 Ga0207703_109203372 124
237 3300026041 Ga0207639_10037046 Ga0207639_100370464 124
238 3300026041 Ga0207639_10039961 Ga0207639_100399612 124
239 3300026041 Ga0207639_10146233 Ga0207639_101462332 124
240 3300026067 Ga0207678_10221814 Ga0207678_102218142 124
241 3300026088 Ga0207641_10001302 Ga0207641_1000130215 124
242 3300026088 Ga0207641_10026497 Ga0207641_100264972 124
243 3300026088 Ga0207641_11188159 Ga0207641_111881592 124
244 3300026088 Ga0207641_12528905 Ga0207641_125289051 124
245 3300026089 Ga0207648_10014626 Ga0207648_100146262 124
246 3300026095 Ga0207676_10030438 Ga0207676_100304382 124
247 3300026118 Ga0207675_100086981 Ga0207675_1000869812 124
248 3300026118 Ga0207675_100117197 Ga0207675_1001171972 124
249 3300026142 Ga0207698_10042752 Ga0207698_100427522 124
250 3300028379 Ga0268266_10007373 Ga0268266_100073737 124
251 3300028379 Ga0268266_11184039 Ga0268266_111840392 124
252 3300028380 Ga0268265_10497678 Ga0268265_104976782 124
253 3300028381 Ga0268264_10112315 Ga0268264_101123152 124
254 3300028381 Ga0268264_10128174 Ga0268264_101281743 124
255 3300028381 Ga0268264_10287343 Ga0268264_102873432 124
256 3300028800 Ga0265338_10002470 Ga0265338_1000247018 124
257 3300028800 Ga0265338_10052457 Ga0265338_100524575 124
258 3300028800 Ga0265338_10151099 Ga0265338_101510993 124
259 3300029957 Ga0265324_10189398 Ga0265324_101893982 124
260 3300031251 Ga0265327_10022357 Ga0265327_100223575 124
261 3300031251 Ga0265327_10029109 Ga0265327_100291092 124
262 3300031344 Ga0265316_10017015 Ga0265316_100170154 124
263 3300031344 Ga0265316_10077330 Ga0265316_100773302 124
264 3300031711 Ga0265314_10020965 Ga0265314_100209655 124
265 3300031711 Ga0265314_10090112 Ga0265314_100901122 124
266 3300031731 Ga0307405_10854819 Ga0307405_108548192 124
267 3300035084 Ga0373928_0006155 Ga0373928_0006155_1306_1686 124
268 3300035117 Ga0373953_0172317 Ga0373953_0172317_106_483 124
269 3300035172 Ga0373955_0076793 Ga0373955_0076793_546_920 124
270 3300035692 Ga0373935_0581226 Ga0373935_0581226_375_749 124
271 3300035692 Ga0373935_0752722 Ga0373935_0752722_86_463 124
272 3300035695 Ga0373927_0508254 Ga0373927_0508254_56_433 124
273 3300035724 Ga0373933_0926876 Ga0373933_0926876_101_475 124
274 3300036401 Ga0373937_0125731 Ga0373937_0125731_106_480 124
275 3300036401 Ga0373937_0261440 Ga0373937_0261440_27_401 124
276 3300036401 Ga0373937_1641828 Ga0373937_1641828_99_476 124
277 3300037068 Ga0373925_0582183 Ga0373925_0582183_328_705 124
278 3300037068 Ga0373925_0981615 Ga0373925_0981615_212_586 124
279 3300041456 Ga0451795_0383258 Ga0451795_0383258_286_660 124
280 3300042876 Ga0451577_0001056 Ga0451577_0001056_30613_30993 124
281 3300042876 Ga0451577_0002414 Ga0451577_0002414_20093_20503 124
282 3300042876 Ga0451577_0034417 Ga0451577_0034417_3266_3643 124
283 3300042876 Ga0451577_0057282 Ga0451577_0057282_2375_2761 124
284 3300042876 Ga0451577_0092989 Ga0451577_0092989_496_876 124
285 3300042876 Ga0451577_0199395 Ga0451577_0199395_1414_1791 124
286 3300042876 Ga0451577_0296636 Ga0451577_0296636_115_495 124
287 3300042876 Ga0451577_0423341 Ga0451577_0423341_411_803 124
288 3300042876 Ga0451577_0526877 Ga0451577_0526877_328_705 124
289 3300042876 Ga0451577_0726698 Ga0451577_0726698_61_441 124
290 3300044673 Ga0453683_0000002 Ga0453683_0000002_988056_988436 124
291 3300044673 Ga0453683_0000108 Ga0453683_0000108_57597_57983 124
292 3300044673 Ga0453683_0000704 Ga0453683_0000704_31159_31560 124
293 3300044673 Ga0453683_0010715 Ga0453683_0010715_4425_4805 124
294 3300044673 Ga0453683_0011650 Ga0453683_0011650_3485_3865 124
295 3300044673 Ga0453683_0041787 Ga0453683_0041787_906_1310 124
296 3300044673 Ga0453683_0047922 Ga0453683_0047922_1635_2015 124
297 3300044673 Ga0453683_0057044 Ga0453683_0057044_1526_1906 124
298 3300044673 Ga0453683_0145650 Ga0453683_0145650_243_620 124
299 3300044673 Ga0453683_0146498 Ga0453683_0146498_822_1202 124
300 3300044673 Ga0453683_0170393 Ga0453683_0170393_799_1179 124
301 3300044673 Ga0453683_0241750 Ga0453683_0241750_756_1136 124
302 3300044673 Ga0453683_0337096 Ga0453683_0337096_471_851 124
303 3300044673 Ga0453683_0429840 Ga0453683_0429840_401_778 124
304 3300044673 Ga0453683_0646231 Ga0453683_0646231_160_540 124
305 3300044712 Ga0453684_0000457 Ga0453684_0000457_84964_85341 124
306 3300044712 Ga0453684_0001567 Ga0453684_0001567_14026_14412 124
307 3300044712 Ga0453684_0002972 Ga0453684_0002972_30537_30917 124
308 3300044712 Ga0453684_0021658 Ga0453684_0021658_7679_8059 124
309 3300044712 Ga0453684_0039133 Ga0453684_0039133_4404_4784 124
310 3300044712 Ga0453684_0083529 Ga0453684_0083529_951_1331 124
311 3300044712 Ga0453684_0105317 Ga0453684_0105317_2478_2879 124
312 3300044712 Ga0453684_0122297 Ga0453684_0122297_2218_2598 124
313 3300044712 Ga0453684_0248588 Ga0453684_0248588_1248_1628 124
314 3300044712 Ga0453684_0260397 Ga0453684_0260397_343_723 124
315 3300044712 Ga0453684_0298818 Ga0453684_0298818_897_1277 124
316 3300044712 Ga0453684_0380367 Ga0453684_0380367_594_971 124
317 3300044712 Ga0453684_0937343 Ga0453684_0937343_193_573 124
318 3300044712 Ga0453684_1315376 Ga0453684_1315376_141_518 124
319 3300045051 Ga0451576_0002739 Ga0451576_0002739_13223_13624 124
320 3300045051 Ga0451576_0006447 Ga0451576_0006447_1000_1380 124
321 3300045051 Ga0451576_0026579 Ga0451576_0026579_1055_1432 124
322 3300045051 Ga0451576_0121823 Ga0451576_0121823_1757_2137 124
323 3300045051 Ga0451576_0130613 Ga0451576_0130613_1181_1558 124
324 3300045051 Ga0451576_0209293 Ga0451576_0209293_954_1334 124
325 3300045051 Ga0451576_0269335 Ga0451576_0269335_257_637 124
326 3300045051 Ga0451576_0599120 Ga0451576_0599120_664_1047 124
327 3300045051 Ga0451576_0677497 Ga0451576_0677497_243_623 124
328 3300045051 Ga0451576_0688410 Ga0451576_0688410_423_803 124
329 3300045051 Ga0451576_1515638 Ga0451576_1515638_158_535 124
330 3300046454 Ga0495592_0125361 Ga0495592_0125361_1123_1497 124
331 3300046459 Ga0495629_0164478 Ga0495629_0164478_101_475 124
332 3300046459 Ga0495629_0854925 Ga0495629_0854925_190_570 124
333 3300046471 Ga0495650_0020707 Ga0495650_0020707_1930_2322 124
334 3300046472 Ga0495580_0942089 Ga0495580_0942089_22_399 124
335 3300046473 Ga0495582_0267070 Ga0495582_0267070_276_650 124
336 3300046517 Ga0495630_0126690 Ga0495630_0126690_1172_1546 124
337 3300046531 Ga0495665_0144822 Ga0495665_0144822_813_1190 124
338 3300046543 Ga0495645_0584088 Ga0495645_0584088_279_659 124
339 3300046663 Ga0495635_0265658 Ga0495635_0265658_738_1112 124
340 3300046663 Ga0495635_0929439 Ga0495635_0929439_77_451 124
341 3300046675 Ga0495657_0140289 Ga0495657_0140289_516_890 124
342 3300046675 Ga0495657_0187933 Ga0495657_0187933_457_834 124
343 3300046691 Ga0495670_0374847 Ga0495670_0374847_239_613 124
344 3300046809 Ga0495600_0951105 Ga0495600_0951105_59_433 124
345 3300047319 Ga0495674_0189670 Ga0495674_0189670_257_631 124
346 3300047319 Ga0495674_0346888 Ga0495674_0346888_609_986 124
347 3300048088 Ga0495602_0448542 Ga0495602_0448542_152_529 124
348 3300048088 Ga0495602_1175058 Ga0495602_1175058_46_420 124
349 3300048905 Ga0496102_0966407 Ga0496102_0966407_272_646 124
350 3300048907 Ga0496104_0353228 Ga0496104_0353228_361_735 124
351 3300048912 Ga0496109_0030100 Ga0496109_0030100_1748_2122 124
352 3300048913 Ga0496110_1082466 Ga0496110_1082466_123_497 124
353 3300048917 Ga0496114_1085630 Ga0496114_1085630_153_527 124
354 3300049569 Ga0501032_0291725 Ga0501032_0291725_528_902 124
355 3300049571 Ga0501034_0042857 Ga0501034_0042857_1822_2196 124
356 3300049581 Ga0501047_0254101 Ga0501047_0254101_565_939 124
357 3300049584 Ga0501068_0332817 Ga0501068_0332817_162_536 124
358 3300049585 Ga0501069_0191174 Ga0501069_0191174_303_677 124
359 3300049587 Ga0501071_0071404 Ga0501071_0071404_1285_1659 124
360 3300049589 Ga0501073_0010990 Ga0501073_0010990_4975_5349 124
361 3300049741 Ga0501079_0030151 Ga0501079_0030151_1495_1869 124
362 3300049742 Ga0501080_0256615 Ga0501080_0256615_240_614 124
363 3300049744 Ga0501083_0331510 Ga0501083_0331510_590_964 124
364 3300049823 Ga0501044_0045288 Ga0501044_0045288_3484_3858 124
365 3300053086 Ga0500578_0125628 Ga0500578_0125628_837_1211 124
366 3300053139 Ga0500568_0053354 Ga0500568_0053354_815_1189 124
367 3300053139 Ga0500568_0225796 Ga0500568_0225796_62_436 124
368 3300053153 Ga0500616_0004017 Ga0500616_0004017_185_559 124
369 3300053156 Ga0500622_0003424 Ga0500622_0003424_4476_4850 124
370 3300054114 Ga0501084_0721126 Ga0501084_0721126_22_396 124
371 3300060353 Ga0501082_0319521 Ga0501082_0319521_220_594 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

14

129

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.9402 4 124
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.9234 4 124
2was-assembly2.cif.gz_D structure of the fungal type i fas ppt domain 0.9228 4 123
5xu7-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9218 1 124
2was-assembly1.cif.gz_C structure of the fungal type i fas ppt domain 0.9211 4 124
ID Description Score Start End Superfamily
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9211 4 124 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9195 1 124 3.90.470.20
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9133 4 124 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9122 1 124 3.90.470.20
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8971 2 124 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A7X9K4X4-F1-model_v4 deleted 0.9787 1 124
AF-A0A4Q5RF42-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9757 1 124 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A364Y0N4-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9755 1 124 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7X9K4X4-F1-model_v4 deleted 0.971 1 124
AF-A0A2C9CKB7-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9687 4 123 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Feature Viewer

pLDDT pTM Quality
93.96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map