F425805

General Info

Members Datasets Scaffolds Average Seq Length
371 235 275 339

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_151062|Ga0400483_151062_457_1572
Length 371
Sequence MHTNQDSAFNSNSHTSNQANLRHDWRRDEAEALFALPFNDLLFQAQSVHRQHFNPNQVQVSTLCSIKTGACPEDCKYCPQSAHYDTGLEKEKLMQVEKVIEEAKAAKASGATRFCMGAAWRSPHNRDLPYVVDMVKGVKSLGLETCMTLGMLNEEQSQTLAEAGLDYYNHNLDTSPEYYGEIITTRTYQDRLETLDNVRQAGMKVCSGGIVGMGEGEQDRVGLLLQLANMPVHPESVPINMLVKVEGTPFEDLEDLDPFDFIRTIAVARILMPKSHVRLSAGREEMNEQMQAMAFFAGANSIFYGEKLLTTPNPKANKDMQLFDRLGIQPEPYSAVEHRRNGDGVQEYVPASKNFSSNKLSSNPQYYDAAS

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231024 Pseudomonas sp. GM84 Isolate Nodule
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
8 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
9 2547132181 Kosakonia sacchari SP1 Isolate Stem
10 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
11 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
12 2561511199 Enterobacter sp. R4-368 Isolate Nodule
13 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
14 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
15 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
16 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
17 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
18 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
19 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
20 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
21 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
22 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
23 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
24 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
25 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
26 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
27 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
28 2643221558 Rhizobium sp. Root149 Isolate Unclassified
29 2643221568 Rhizobium sp. Root564 Isolate Unclassified
30 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
31 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
32 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
33 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
34 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
35 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
36 2765235841 Pseudomonas putida AA7 Isolate Unclassified
37 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
38 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
39 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
40 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
41 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
42 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
43 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
44 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
45 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
46 2841760612 Bosea sp. Tri-49 Isolate Nodule
47 2844104063 Bosea sp. Tri-39 Isolate Nodule
48 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
49 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
50 2847085930 Erwinia persicina B64 Isolate Bulb
51 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
52 2851246043 Bosea sp. Tri-54 Isolate Nodule
53 2865014394 Pantoea sp. R-71966 Isolate Unclassified
54 2876601092 Pantoea endophytica 596 Isolate Unclassified
55 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
56 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
57 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
58 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
59 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
60 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
61 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
62 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
63 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
64 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
65 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
66 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
67 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
68 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
69 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
70 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
71 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
72 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
73 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
74 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
75 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
76 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
77 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
78 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
79 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
80 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
81 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
82 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
119 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
145 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
152 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
153 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
158 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
161 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
162 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
163 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
164 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
165 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
217 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
221 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
222 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
223 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
224 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
225 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
226 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
227 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
228 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
229 8052494512 Pseudomonas putida LD6 Isolate Unclassified
230 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
231 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
232 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
233 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
234 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
235 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.58
Metatranscriptomes 0.54
Isolates 25.88

Biome Distribution

Category Percentage (%)
Aerial Root 1.08
Bulb 0.27
Endosphere 4.04
Nodule 2.16
Rhizoplane 3.5
Rhizosphere 63.34
Stem 0.27
Stem Tuber 0
Unclassified 25.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10016756 3300003323 Bacteria 50674
2 Ga0055536_1023996 3300003781 Bacteria 1778
3 Ga0055536_1027102 3300003781 Bacteria 1593
4 Ga0058692_1000298 3300003856 Bacteria 25460
5 Ga0058692_1000378 3300003856 Bacteria 21313
6 Ga0058692_1000659 3300003856 Bacteria 14246
7 Ga0065704_10126563 3300005289 Bacteria 1680
8 Ga0065704_10167611 3300005289 Bacteria 1312
9 Ga0070658_10217525 3300005327 Bacteria 1615
10 Ga0070682_100080342 3300005337 Bacteria 2108
11 Ga0070668_100036046 3300005347 Bacteria 3774
12 Ga0070662_100170644 3300005457 Bacteria 1708
13 Ga0075367_10124957 3300006178 Bacteria 1587
14 Ga0075370_10009138 3300006353 Bacteria 5131
15 Ga0099823_1000048 3300006944 Bacteria 58407
16 Ga0105251_10000370 3300009011 Bacteria 44149
17 Ga0105251_10000469 3300009011 Bacteria 38434
18 Ga0105251_10001971 3300009011 Bacteria 16765
19 Ga0105251_10003796 3300009011 Bacteria 10777
20 Ga0105251_10013754 3300009011 Bacteria 4509
21 Ga0105251_10097656 3300009011 Bacteria 1344
22 Ga0105244_10000183 3300009036 Bacteria 63415
23 Ga0105244_10000233 3300009036 Bacteria 57433
24 Ga0105244_10001642 3300009036 Bacteria 17707
25 Ga0105244_10009667 3300009036 Bacteria 5904
26 Ga0105244_10013739 3300009036 Bacteria 4712
27 Ga0105244_10026110 3300009036 Bacteria 3165
28 Ga0105244_10053826 3300009036 Bacteria 2044
29 Ga0105250_10021015 3300009092 Bacteria 2635
30 Ga0105243_10006642 3300009148 Bacteria 8930
31 Ga0105243_10285939 3300009148 Bacteria 1488
32 Ga0105246_10004621 3300011119 Bacteria 8379
33 Ga0105246_10016397 3300011119 Bacteria 4692
34 Ga0157373_10002765 3300013100 Bacteria 13270
35 Ga0157371_10000459 3300013102 Bacteria 49971
36 Ga0157371_10000462 3300013102 Bacteria 49728
37 Ga0157371_10006940 3300013102 Bacteria 9233
38 Ga0157371_10007043 3300013102 Bacteria 9148
39 Ga0157370_10001550 3300013104 Bacteria 28458
40 Ga0157369_10003641 3300013105 Bacteria 18277
41 Ga0157369_10139750 3300013105 Bacteria 2563
42 Ga0163162_10129336 3300013306 Bacteria 2633
43 Ga0157372_10000947 3300013307 Bacteria 31672
44 Ga0157372_10013992 3300013307 Bacteria 8571
45 Ga0157372_10063026 3300013307 Bacteria 4155
46 Ga0157372_10081100 3300013307 Bacteria 3672
47 Ga0157372_10716702 3300013307 Bacteria 1164
48 Ga0182008_10061278 3300014497 Bacteria 1855
49 Ga0182006_1004482 3300015261 Bacteria 6875
50 Ga0182007_10011157 3300015262 Bacteria 3506
51 Ga0213876_10000166 3300021384 Bacteria 69611
52 Ga0213871_10009961 3300021441 Bacteria 2143
53 Ga0209437_100035 3300025233 Bacteria 481110
54 Ga0209676_1000019 3300025292 Bacteria 620012
55 Ga0209676_1000871 3300025292 Bacteria 38692
56 Ga0209025_1019695 3300025294 Bacteria 3737
57 Ga0209256_1000338 3300025299 Bacteria 78064
58 Ga0207696_1000064 3300025711 Bacteria 238379
59 Ga0207696_1000312 3300025711 Bacteria 54441
60 Ga0207696_1005927 3300025711 Bacteria 4998
61 Ga0207655_1000023 3300025728 Bacteria 467070
62 Ga0207655_1000370 3300025728 Bacteria 63426
63 Ga0207655_1000406 3300025728 Bacteria 59327
64 Ga0207655_1000815 3300025728 Bacteria 33730
65 Ga0207655_1005665 3300025728 Bacteria 8445
66 Ga0207655_1006552 3300025728 Bacteria 7693
67 Ga0207655_1014144 3300025728 Bacteria 4528
68 Ga0207655_1014624 3300025728 Bacteria 4420
69 Ga0207655_1017751 3300025728 Bacteria 3821
70 Ga0207655_1027116 3300025728 Bacteria 2737
71 Ga0207713_1000001 3300025735 Bacteria 2295391
72 Ga0207713_1000006 3300025735 Bacteria 586163
73 Ga0207713_1002123 3300025735 Bacteria 14777
74 Ga0207713_1009676 3300025735 Bacteria 5404
75 Ga0207713_1028667 3300025735 Bacteria 2507
76 Ga0207713_1044718 3300025735 Bacteria 1816
77 Ga0207713_1072558 3300025735 Bacteria 1266
78 Ga0207706_10227856 3300025933 Bacteria 1631
79 Ga0207709_10003693 3300025935 Bacteria 9012
80 Ga0209389_1000095 3300027296 Bacteria 80518
81 Ga0209371_1000010 3300027312 Bacteria 922021
82 Ga0209371_1000047 3300027312 Bacteria 304732
83 Ga0209371_1000097 3300027312 Bacteria 159855
84 Ga0209371_1000189 3300027312 Bacteria 90005
85 Ga0209371_1000217 3300027312 Bacteria 77949
86 Ga0209371_1001163 3300027312 Bacteria 19255
87 Ga0209371_1001504 3300027312 Bacteria 15490
88 Ga0209371_1002767 3300027312 Bacteria 9390
89 Ga0209371_1006896 3300027312 Bacteria 4090
90 Ga0209371_1007138 3300027312 Bacteria 3958
91 Ga0209981_1006667 3300027378 Bacteria 1548
92 Ga0209995_1005961 3300027471 Bacteria 1961
93 Ga0209983_1013399 3300027665 Bacteria 1686
94 Ga0209998_10005368 3300027717 Bacteria 2688
95 Ga0307517_10000035 3300028786 Bacteria 172762
96 Ga0268256_1000022 3300030500 Bacteria 531115
97 Ga0268256_1000071 3300030500 Bacteria 187591
98 Ga0268256_1000157 3300030500 Bacteria 90005
99 Ga0268256_1000173 3300030500 Bacteria 77949
100 Ga0268256_1000981 3300030500 Bacteria 19387
101 Ga0268256_1002526 3300030500 Bacteria 9228
102 Ga0268256_1007315 3300030500 Bacteria 3958
103 Ga0265330_10032371 3300031235 Bacteria 2343
104 Ga0265328_10000006 3300031239 Bacteria 227698
105 Ga0265328_10000048 3300031239 Bacteria 79730
106 Ga0265328_10003816 3300031239 Bacteria 6622
107 Ga0265328_10020545 3300031239 Bacteria 2527
108 Ga0265331_10000005 3300031250 Bacteria 465192
109 Ga0265331_10001039 3300031250 Bacteria 21660
110 Ga0265331_10018749 3300031250 Bacteria 3580
111 Ga0265327_10000002 3300031251 Bacteria 856593
112 Ga0265327_10010482 3300031251 Bacteria 6509
113 Ga0265327_10016290 3300031251 Bacteria 4731
114 Ga0265327_10045708 3300031251 Bacteria 2325
115 Ga0265327_10118651 3300031251 Bacteria 1256
116 Ga0265316_10000091 3300031344 Bacteria 96882
117 Ga0307408_100000623 3300031548 Bacteria 30098
118 Ga0307408_100000908 3300031548 Bacteria 23248
119 Ga0307408_100017296 3300031548 Bacteria 4824
120 Ga0316575_10034575 3300031665 Bacteria 1985
121 Ga0316575_10036826 3300031665 Bacteria 1926
122 Ga0316579_10005874 3300031691 Bacteria 4976
123 Ga0265342_10040105 3300031712 Bacteria 2841
124 Ga0316576_10053548 3300031727 Bacteria 2940
125 Ga0316576_10107967 3300031727 Bacteria 2085
126 Ga0316578_10062103 3300031728 Bacteria 2202
127 Ga0307405_10165457 3300031731 Bacteria 1571
128 Ga0316577_10004972 3300031733 Bacteria 6933
129 Ga0307413_10018053 3300031824 Bacteria 3691
130 Ga0307413_10027461 3300031824 Bacteria 3154
131 Ga0307406_10002575 3300031901 Bacteria 9877
132 Ga0307406_10332816 3300031901 Bacteria 1179
133 Ga0307412_10011602 3300031911 Bacteria 5110
134 Ga0307414_10023420 3300032004 Bacteria 3917
135 Ga0316583_10002128 3300032133 Bacteria 6813
136 Ga0316585_10001753 3300032137 Bacteria 5781
137 Ga0316593_10005597 3300032168 Bacteria 3328
138 Ga0316593_10035699 3300032168 Bacteria 1636
139 Ga0316574_0031700 3300035398 Bacteria 3208
140 Ga0316574_0033341 3300035398 Bacteria 3134
141 Ga0316574_0141278 3300035398 Bacteria 1551
142 Ga0316582_0013149 3300036647 Bacteria 4650
143 Ga0400483_075161 3300039062 Bacteria 103046
144 Ga0400483_151062 3300039062 Bacteria 4499
145 Ga0400483_255545 3300039062 Bacteria 3117
146 Ga0436365_0105401 3300039437 Bacteria 69559
147 Ga0436360_1275360 3300039438 Bacteria 2849
148 Ga0439436_0007526 3300041404 Bacteria 3351
149 Ga0439438_000001 3300041405 Bacteria 1263568
150 Ga0439438_003547 3300041405 Bacteria 6275
151 Ga0439447_000327 3300041407 Bacteria 17152
152 Ga0439447_001175 3300041407 Bacteria 9533
153 Ga0439447_006572 3300041407 Bacteria 3760
154 Ga0439447_012844 3300041407 Bacteria 2394
155 Ga0439466_0000003 3300041411 Bacteria 486229
156 Ga0439432_000607 3300042006 Bacteria 13477
157 Ga0439449_0015908 3300042007 Bacteria 2828
158 Ga0439452_000001 3300042010 Bacteria 1725439
159 Ga0450920_006121 3300042122 Bacteria 2155
160 Ga0450923_000265 3300042125 Bacteria 5201
161 Ga0450895_003360 3300042132 Bacteria 1229
162 Ga0450896_000010 3300042133 Bacteria 10059
163 Ga0450900_000056 3300042136 Bacteria 5432
164 Ga0450902_000119 3300042137 Bacteria 8338
165 Ga0450905_000172 3300042142 Bacteria 7083
166 Ga0450907_000775 3300042146 Bacteria 8028
167 Ga0439446_0002154 3300042156 Bacteria 4680
168 Ga0439446_0002953 3300042156 Bacteria 4158
169 Ga0450908_000545 3300042184 Bacteria 7229
170 Ga0439434_0001428 3300042435 Bacteria 6884
171 Ga0439434_0001444 3300042435 Bacteria 6835
172 Ga0439435_0001001 3300042436 Bacteria 4954
173 Ga0439444_0003279 3300042437 Bacteria 2278
174 Ga0439460_0029243 3300042461 Bacteria 1559
175 Ga0450901_000879 3300042533 Bacteria 3519
176 Ga0453684_0020708 3300044712 Bacteria 9897
177 Ga0495591_000080 3300046458 Bacteria 107876
178 Ga0495591_011717 3300046458 Bacteria 3301
179 Ga0495650_0000540 3300046471 Bacteria 53987
180 Ga0495585_0032662 3300046492 Bacteria 2948
181 Ga0495596_0015217 3300046500 Bacteria 3226
182 Ga0495606_0000172 3300046507 Bacteria 114645
183 Ga0495620_0000033 3300046515 Bacteria 118157
184 Ga0495632_0000411 3300046519 Bacteria 40562
185 Ga0495643_0000320 3300046522 Bacteria 66010
186 Ga0495643_0000749 3300046522 Bacteria 36809
187 Ga0495648_0001111 3300046524 Bacteria 27283
188 Ga0495648_0004443 3300046524 Bacteria 11981
189 Ga0495648_0015282 3300046524 Bacteria 5582
190 Ga0495654_0000125 3300046530 Bacteria 85809
191 Ga0495640_0196861 3300046533 Bacteria 1279
192 Ga0495598_0072464 3300046537 Bacteria 1088
193 Ga0495668_0042609 3300046616 Bacteria 2527
194 Ga0495671_0002785 3300046692 Bacteria 10942
195 Ga0495649_0016531 3300046694 Bacteria 4181
196 Ga0495660_0000074 3300046810 Bacteria 108390
197 Ga0495660_0014093 3300046810 Bacteria 4631
198 Ga0495672_0000004 3300047320 Bacteria 631810
199 Ga0495672_0000012 3300047320 Bacteria 519975
200 Ga0495673_0000023 3300047469 Bacteria 539904
201 Ga0496100_0005454 3300048903 Bacteria 6852
202 Ga0496101_0000098 3300048904 Bacteria 90945
203 Ga0496102_0215839 3300048905 Bacteria 1808
204 Ga0496105_0006949 3300048908 Bacteria 8719
205 Ga0496116_0000036 3300048919 Bacteria 388508
206 Ga0496116_0000180 3300048919 Bacteria 126589
207 Ga0496116_0000385 3300048919 Bacteria 64735
208 Ga0496116_0001717 3300048919 Bacteria 23960
209 Ga0496117_0000004 3300048920 Bacteria 877131
210 Ga0496117_0000131 3300048920 Bacteria 162788
211 Ga0496117_0000970 3300048920 Bacteria 43943
212 Ga0496117_0003990 3300048920 Bacteria 16660
213 Ga0496118_0000024 3300048921 Bacteria 385236
214 Ga0496118_0004461 3300048921 Bacteria 16596
215 Ga0496118_0007102 3300048921 Bacteria 12020
216 Ga0496118_0008595 3300048921 Bacteria 10511
217 Ga0496118_0012918 3300048921 Bacteria 7952
218 Ga0496118_0055864 3300048921 Bacteria 2973
219 Ga0496118_0164307 3300048921 Bacteria 1367
220 Ga0496119_0000056 3300048922 Bacteria 174042
221 Ga0496119_0000068 3300048922 Bacteria 158748
222 Ga0496119_0000071 3300048922 Bacteria 153652
223 Ga0496119_0010221 3300048922 Bacteria 7919
224 Ga0496119_0018013 3300048922 Bacteria 5280
225 Ga0496119_0030584 3300048922 Bacteria 3625
226 Ga0496120_0000046 3300048923 Bacteria 190675
227 Ga0496120_0000063 3300048923 Bacteria 170325
228 Ga0496120_0000193 3300048923 Bacteria 104145
229 Ga0496120_0000194 3300048923 Bacteria 104142
230 Ga0496120_0000859 3300048923 Bacteria 42978
231 Ga0496120_0001138 3300048923 Bacteria 34316
232 Ga0496120_0001162 3300048923 Bacteria 33709
233 Ga0496121_0000185 3300048924 Bacteria 138586
234 Ga0496121_0032468 3300048924 Bacteria 4744
235 Ga0496122_0001059 3300048925 Bacteria 47804
236 Ga0496122_0005476 3300048925 Bacteria 15107
237 Ga0496122_0009556 3300048925 Bacteria 10181
238 Ga0496122_0026556 3300048925 Bacteria 4986
239 Ga0496122_0145235 3300048925 Bacteria 1475
240 Ga0496123_0000808 3300048926 Bacteria 50515
241 Ga0496123_0003321 3300048926 Bacteria 18220
242 Ga0496123_0006086 3300048926 Bacteria 11838
243 Ga0496123_0046058 3300048926 Bacteria 2962
244 Ga0496123_0135691 3300048926 Bacteria 1354
245 Ga0496124_0003635 3300048927 Bacteria 18715
246 Ga0496124_0003869 3300048927 Bacteria 17895
247 Ga0496124_0008495 3300048927 Bacteria 10726
248 Ga0496124_0008838 3300048927 Bacteria 10458
249 Ga0496124_0012410 3300048927 Bacteria 8413
250 Ga0496124_0147664 3300048927 Bacteria 1848
251 Ga0496124_0243767 3300048927 Bacteria 1334
252 Ga0496125_0004688 3300048928 Bacteria 15574
253 Ga0496125_0010157 3300048928 Bacteria 9542
254 Ga0496125_0070611 3300048928 Bacteria 2733
255 Ga0496126_0001111 3300048929 Bacteria 45099
256 Ga0496126_0017290 3300048929 Bacteria 7186
257 Ga0496126_0074403 3300048929 Bacteria 3017
258 Ga0495678_001711 3300049459 Bacteria 16473
259 Ga0495678_032734 3300049459 Bacteria 2152
260 Ga0495682_0000026 3300049460 Bacteria 144529
261 Ga0501033_0108923 3300049570 Bacteria 2017
262 Ga0501034_0000165 3300049571 Bacteria 123084
263 Ga0501034_0045398 3300049571 Bacteria 4440
264 Ga0501037_0152207 3300049573 Bacteria 1653
265 Ga0501038_0224079 3300049574 Bacteria 1499
266 Ga0501047_0077123 3300049581 Bacteria 3207
267 Ga0501044_0000033 3300049823 Bacteria 167177
268 Ga0501044_0206599 3300049823 Bacteria 1920
269 Ga0501044_0282658 3300049823 Bacteria 1592
270 Ga0500595_008163 3300053119 Bacteria 4294
271 Ga0500621_000001 3300053126 Bacteria 1049698
272 Ga0500659_0002846 3300053135 Bacteria 10352
273 Ga0500622_0032772 3300053156 Bacteria 2724
274 Ga0500637_0095348 3300053178 Bacteria 1724
275 Ga0500552_000749 3300053733 Bacteria 3023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0196861 Ga0495640_0196861_28_939 303
2 3300046537 Ga0495598_0072464 Ga0495598_0072464_138_1049 303
3 iso_pu_bacteria 8002060224 8002061371 313
4 iso_pu_bacteria 2891088606 2891092796 314
5 3300028786 Ga0307517_10000035 Ga0307517_1000003538 317
6 3300044712 Ga0453684_0020708 Ga0453684_0020708_4764_5732 317
7 3300003781 Ga0055536_1027102 Ga0055536_10271022 320
8 3300025292 Ga0209676_1000019 Ga0209676_1000019617 320
9 3300031239 Ga0265328_10000048 Ga0265328_1000004838 320
10 3300031250 Ga0265331_10000005 Ga0265331_10000005207 320
11 3300031251 Ga0265327_10045708 Ga0265327_100457083 320
12 3300021441 Ga0213871_10009961 Ga0213871_100099612 321
13 3300039438 Ga0436360_1275360 Ga0436360_1275360_743_1723 321
14 iso_pu_bacteria 2582581316 2585330835 321
15 3300031239 Ga0265328_10003816 Ga0265328_100038163 322
16 3300031239 Ga0265328_10020545 Ga0265328_100205452 322
17 3300031727 Ga0316576_10107967 Ga0316576_101079672 322
18 3300042125 Ga0450923_000265 Ga0450923_000265_1807_2784 322
19 3300042132 Ga0450895_003360 Ga0450895_003360_37_1014 322
20 3300042133 Ga0450896_000010 Ga0450896_000010_1429_2406 322
21 3300042184 Ga0450908_000545 Ga0450908_000545_2069_3046 322
22 3300048905 Ga0496102_0215839 Ga0496102_0215839_21_989 322
23 iso_pu_bacteria 2524023207 2524454567 322
24 iso_pu_bacteria 2582581307 2585274147 322
25 iso_pu_bacteria 2585427531 2585560596 322
26 iso_pu_bacteria 2585427608 2585898806 322
27 iso_pu_bacteria 2585427609 2585903606 322
28 iso_pu_bacteria 2585428125 2587981274 322
29 iso_pu_bacteria 2841760612 2841766217 322
30 iso_pu_bacteria 2844104063 2844105983 322
31 iso_pu_bacteria 2851246043 2851246339 322
32 iso_pu_bacteria 2937843397 2937847084 322
33 3300006178 Ga0075367_10124957 Ga0075367_101249572 323
34 3300006353 Ga0075370_10009138 Ga0075370_100091384 323
35 3300013105 Ga0157369_10139750 Ga0157369_101397503 323
36 3300013307 Ga0157372_10716702 Ga0157372_107167022 323
37 3300025294 Ga0209025_1019695 Ga0209025_10196955 323
38 3300025299 Ga0209256_1000338 Ga0209256_100033829 323
39 3300027717 Ga0209998_10005368 Ga0209998_100053681 323
40 3300031665 Ga0316575_10034575 Ga0316575_100345753 323
41 3300031691 Ga0316579_10005874 Ga0316579_100058742 323
42 3300031733 Ga0316577_10004972 Ga0316577_100049725 323
43 3300032004 Ga0307414_10023420 Ga0307414_100234202 323
44 3300032133 Ga0316583_10002128 Ga0316583_100021285 323
45 3300032137 Ga0316585_10001753 Ga0316585_100017535 323
46 3300048919 Ga0496116_0000036 Ga0496116_0000036_113769_114764 323
47 3300048921 Ga0496118_0164307 Ga0496118_0164307_81_1076 323
48 3300048926 Ga0496123_0046058 Ga0496123_0046058_1419_2414 323
49 3300048929 Ga0496126_0001111 Ga0496126_0001111_9964_10959 323
50 3300049570 Ga0501033_0108923 Ga0501033_0108923_440_1426 323
51 3300049573 Ga0501037_0152207 Ga0501037_0152207_36_1022 323
52 3300049823 Ga0501044_0282658 Ga0501044_0282658_155_1141 323
53 3300053119 Ga0500595_008163 Ga0500595_008163_2874_3845 323
54 3300053178 Ga0500637_0095348 Ga0500637_0095348_477_1448 323
55 3300053733 Ga0500552_000749 Ga0500552_000749_68_1048 323
56 iso_pu_bacteria 2523231067 2523470514 323
57 iso_pu_bacteria 2643221568 2643856026 323
58 iso_pu_bacteria 2919166419 2919167208 323
59 iso_pu_bacteria 3003665799 3003666802 323
60 3300031548 Ga0307408_100017296 Ga0307408_1000172963 324
61 3300031665 Ga0316575_10036826 Ga0316575_100368263 324
62 3300031727 Ga0316576_10053548 Ga0316576_100535483 324
63 3300031728 Ga0316578_10062103 Ga0316578_100621032 324
64 3300031731 Ga0307405_10165457 Ga0307405_101654572 324
65 3300031824 Ga0307413_10027461 Ga0307413_100274612 324
66 3300031901 Ga0307406_10332816 Ga0307406_103328161 324
67 3300031911 Ga0307412_10011602 Ga0307412_100116022 324
68 3300032168 Ga0316593_10005597 Ga0316593_100055973 324
69 3300035398 Ga0316574_0033341 Ga0316574_0033341_1550_2539 324
70 3300036647 Ga0316582_0013149 Ga0316582_0013149_3606_4598 324
71 3300042122 Ga0450920_006121 Ga0450920_006121_964_1947 324
72 3300042156 Ga0439446_0002953 Ga0439446_0002953_135_1118 324
73 3300042435 Ga0439434_0001428 Ga0439434_0001428_5559_6542 324
74 3300042436 Ga0439435_0001001 Ga0439435_0001001_3262_4245 324
75 3300042437 Ga0439444_0003279 Ga0439444_0003279_178_1161 324
76 iso_pu_bacteria 2738543031 2739349415 324
77 3300049823 Ga0501044_0206599 Ga0501044_0206599_815_1843 325
78 iso_pu_bacteria 2643221558 2643810258 325
79 iso_pu_bacteria 2904479285 2904479614 325
80 iso_pu_bacteria 2791355253 2793280736 326
81 iso_pu_bacteria 8005246636 8005249898 326
82 3300031235 Ga0265330_10032371 Ga0265330_100323712 327
83 3300031239 Ga0265328_10000006 Ga0265328_10000006199 327
84 3300031250 Ga0265331_10001039 Ga0265331_100010395 327
85 3300031250 Ga0265331_10018749 Ga0265331_100187494 327
86 3300031251 Ga0265327_10010482 Ga0265327_100104824 327
87 3300031251 Ga0265327_10016290 Ga0265327_100162905 327
88 3300031344 Ga0265316_10000091 Ga0265316_1000009159 327
89 3300031712 Ga0265342_10040105 Ga0265342_100401052 327
90 3300031251 Ga0265327_10118651 Ga0265327_101186511 328
91 3300032168 Ga0316593_10035699 Ga0316593_100356992 328
92 3300013102 Ga0157371_10007043 Ga0157371_1000704310 329
93 3300009011 Ga0105251_10013754 Ga0105251_100137545 330
94 3300009036 Ga0105244_10009667 Ga0105244_100096675 330
95 3300013105 Ga0157369_10003641 Ga0157369_1000364115 330
96 3300025728 Ga0207655_1027116 Ga0207655_10271162 331
97 3300042461 Ga0439460_0029243 Ga0439460_0029243_342_1337 331
98 3300003781 Ga0055536_1023996 Ga0055536_10239962 332
99 3300005289 Ga0065704_10126563 Ga0065704_101265632 332
100 3300006944 Ga0099823_1000048 Ga0099823_100004823 332
101 3300009148 Ga0105243_10006642 Ga0105243_100066428 332
102 3300009148 Ga0105243_10285939 Ga0105243_102859391 332
103 3300025292 Ga0209676_1000871 Ga0209676_100087129 332
104 3300025711 Ga0207696_1000064 Ga0207696_1000064124 332
105 3300025728 Ga0207655_1000406 Ga0207655_100040627 332
106 3300025728 Ga0207655_1000815 Ga0207655_10008159 332
107 3300025728 Ga0207655_1005665 Ga0207655_10056655 332
108 3300025728 Ga0207655_1006552 Ga0207655_10065528 332
109 3300025735 Ga0207713_1044718 Ga0207713_10447181 332
110 3300025935 Ga0207709_10003693 Ga0207709_100036938 332
111 3300027296 Ga0209389_1000095 Ga0209389_100009538 332
112 3300042006 Ga0439432_000607 Ga0439432_000607_7024_8082 332
113 3300042136 Ga0450900_000056 Ga0450900_000056_274_1389 332
114 3300042137 Ga0450902_000119 Ga0450902_000119_3022_4137 332
115 3300042142 Ga0450905_000172 Ga0450905_000172_817_1875 332
116 3300042533 Ga0450901_000879 Ga0450901_000879_1497_2555 332
117 3300046515 Ga0495620_0000033 Ga0495620_0000033_85898_86956 332
118 3300046519 Ga0495632_0000411 Ga0495632_0000411_17215_18273 332
119 3300046522 Ga0495643_0000320 Ga0495643_0000320_33918_34976 332
120 3300046522 Ga0495643_0000749 Ga0495643_0000749_30860_31918 332
121 3300046524 Ga0495648_0004443 Ga0495648_0004443_5752_6810 332
122 3300048920 Ga0496117_0000970 Ga0496117_0000970_37584_38642 332
123 3300048920 Ga0496117_0003990 Ga0496117_0003990_10448_11506 332
124 3300048921 Ga0496118_0004461 Ga0496118_0004461_4886_5944 332
125 3300048921 Ga0496118_0007102 Ga0496118_0007102_4720_5778 332
126 3300048924 Ga0496121_0032468 Ga0496121_0032468_3648_4706 332
127 3300048925 Ga0496122_0009556 Ga0496122_0009556_49_1107 332
128 3300048926 Ga0496123_0006086 Ga0496123_0006086_8363_9421 332
129 3300048927 Ga0496124_0008495 Ga0496124_0008495_4856_5914 332
130 3300048927 Ga0496124_0147664 Ga0496124_0147664_104_1162 332
131 3300048928 Ga0496125_0004688 Ga0496125_0004688_4930_5988 332
132 3300048928 Ga0496125_0070611 Ga0496125_0070611_706_1764 332
133 3300048929 Ga0496126_0074403 Ga0496126_0074403_167_1225 332
134 3300049571 Ga0501034_0000165 Ga0501034_0000165_38475_39533 332
135 3300053135 Ga0500659_0002846 Ga0500659_0002846_5320_6378 332
136 3300005289 Ga0065704_10167611 Ga0065704_101676111 333
137 3300009011 Ga0105251_10000469 Ga0105251_1000046924 333
138 3300009011 Ga0105251_10097656 Ga0105251_100976561 333
139 3300009092 Ga0105250_10021015 Ga0105250_100210151 333
140 3300025735 Ga0207713_1002123 Ga0207713_10021235 333
141 3300025735 Ga0207713_1028667 Ga0207713_10286672 333
142 3300048927 Ga0496124_0008838 Ga0496124_0008838_7035_8093 333
143 iso_pu_bacteria 2561511199 2562466635 333
144 3300009036 Ga0105244_10053826 Ga0105244_100538262 334
145 3300013307 Ga0157372_10000947 Ga0157372_100009477 334
146 3300048922 Ga0496119_0000071 Ga0496119_0000071_81572_82630 334
147 3300048923 Ga0496120_0001138 Ga0496120_0001138_12886_13944 334
148 3300027312 Ga0209371_1000217 Ga0209371_100021725 336
149 3300027378 Ga0209981_1006667 Ga0209981_10066671 336
150 3300030500 Ga0268256_1000173 Ga0268256_100017343 336
151 3300009011 Ga0105251_10000370 Ga0105251_1000037027 337
152 3300009036 Ga0105244_10000183 Ga0105244_1000018347 337
153 3300027665 Ga0209983_1013399 Ga0209983_10133992 337
154 3300031824 Ga0307413_10018053 Ga0307413_100180532 337
155 3300039437 Ga0436365_0105401 Ga0436365_0105401_55083_56099 337
156 3300046500 Ga0495596_0015217 Ga0495596_0015217_240_1271 337
157 3300035398 Ga0316574_0141278 Ga0316574_0141278_107_1144 338
158 3300041404 Ga0439436_0007526 Ga0439436_0007526_162_1220 338
159 3300041407 Ga0439447_000327 Ga0439447_000327_11243_12301 338
160 3300042156 Ga0439446_0002154 Ga0439446_0002154_728_1786 338
161 3300042435 Ga0439434_0001444 Ga0439434_0001444_754_1812 338
162 3300049574 Ga0501038_0224079 Ga0501038_0224079_38_1057 338
163 3300049581 Ga0501047_0077123 Ga0501047_0077123_1953_2972 338
164 3300049823 Ga0501044_0000033 Ga0501044_0000033_112045_113064 338
165 iso_pu_bacteria 2511231025 2511378794 339
166 iso_pu_bacteria 2511231035 2511436054 339
167 iso_pu_bacteria 2599185299 2599927313 339
168 iso_pu_bacteria 2608642108 2608668730 339
169 iso_pu_bacteria 2648501693 2650896661 339
170 iso_pu_bacteria 2684622997 2686352659 339
171 iso_pu_bacteria 2808606414 2809127547 339
172 iso_pu_bacteria 2844528606 2844531515 339
173 iso_pu_bacteria 2847085930 2847088412 339
174 iso_pu_bacteria 2847797336 2847800662 339
175 iso_pu_bacteria 2865014394 2865017685 339
176 iso_pu_bacteria 2876601092 2876602671 339
177 iso_pu_bacteria 2908669403 2908670941 339
178 iso_pu_bacteria 2939602548 2939602833 339
179 iso_pu_bacteria 2945951305 2945953756 339
180 iso_pu_bacteria 2978975091 2978976255 339
181 iso_pu_bacteria 2984494565 2984495879 339
182 iso_pu_bacteria 2990261002 2990262567 339
183 iso_pu_bacteria 8016733728 8016736660 339
184 iso_pu_bacteria 8019499862 8019501896 339
185 iso_pu_bacteria 2565956521 2566037671 340
186 iso_pu_bacteria 2547132181 2547694561 341
187 iso_pu_bacteria 2554235234 2555261508 341
188 iso_pu_bacteria 2600255256 2601532150 341
189 iso_pu_bacteria 2600255257 2601537520 341
190 iso_pu_bacteria 2600255310 2601755867 341
191 iso_pu_bacteria 2600255311 2601761236 341
192 iso_pu_bacteria 2602042046 2603638739 341
193 iso_pu_bacteria 2791355010 2792312441 341
194 iso_pu_bacteria 2811995292 2813729798 341
195 iso_pu_bacteria 2814123068 2814697293 341
196 iso_pu_bacteria 2846540461 2846542171 341
197 iso_pu_bacteria 2884086401 2884089783 341
198 iso_pu_bacteria 2919108558 2919111886 341
199 iso_pu_bacteria 2971820967 2971824759 341
200 iso_pu_bacteria 8054357960 8054360151 341
201 iso_pu_bacteria 2687453129 2687578695 342
202 iso_pu_bacteria 8057160832 8057161497 342
203 3300003856 Ga0058692_1000298 Ga0058692_100029818 343
204 3300003856 Ga0058692_1000378 Ga0058692_10003786 343
205 3300003856 Ga0058692_1000659 Ga0058692_10006599 343
206 3300005347 Ga0070668_100036046 Ga0070668_1000360464 343
207 3300005457 Ga0070662_100170644 Ga0070662_1001706442 343
208 3300009011 Ga0105251_10001971 Ga0105251_1000197113 343
209 3300009011 Ga0105251_10003796 Ga0105251_100037969 343
210 3300009036 Ga0105244_10000233 Ga0105244_1000023322 343
211 3300009036 Ga0105244_10013739 Ga0105244_100137391 343
212 3300011119 Ga0105246_10004621 Ga0105246_100046218 343
213 3300011119 Ga0105246_10016397 Ga0105246_100163972 343
214 3300013100 Ga0157373_10002765 Ga0157373_1000276512 343
215 3300013102 Ga0157371_10000459 Ga0157371_1000045941 343
216 3300013102 Ga0157371_10000462 Ga0157371_1000046226 343
217 3300013102 Ga0157371_10006940 Ga0157371_100069402 343
218 3300013104 Ga0157370_10001550 Ga0157370_1000155021 343
219 3300013306 Ga0163162_10129336 Ga0163162_101293362 343
220 3300013307 Ga0157372_10013992 Ga0157372_100139921 343
221 3300013307 Ga0157372_10063026 Ga0157372_100630263 343
222 3300013307 Ga0157372_10081100 Ga0157372_100811002 343
223 3300014497 Ga0182008_10061278 Ga0182008_100612782 343
224 3300015261 Ga0182006_1004482 Ga0182006_10044824 343
225 3300015262 Ga0182007_10011157 Ga0182007_100111572 343
226 3300025233 Ga0209437_100035 Ga0209437_10003524 343
227 3300025711 Ga0207696_1000312 Ga0207696_100031224 343
228 3300025711 Ga0207696_1005927 Ga0207696_10059274 343
229 3300025728 Ga0207655_1000023 Ga0207655_1000023135 343
230 3300025728 Ga0207655_1014144 Ga0207655_10141442 343
231 3300025728 Ga0207655_1014624 Ga0207655_10146245 343
232 3300025728 Ga0207655_1017751 Ga0207655_10177512 343
233 3300025735 Ga0207713_1000001 Ga0207713_1000001365 343
234 3300025735 Ga0207713_1009676 Ga0207713_10096763 343
235 3300025735 Ga0207713_1072558 Ga0207713_10725581 343
236 3300025933 Ga0207706_10227856 Ga0207706_102278562 343
237 3300027312 Ga0209371_1000010 Ga0209371_1000010491 343
238 3300027312 Ga0209371_1000097 Ga0209371_10000977 343
239 3300027312 Ga0209371_1000189 Ga0209371_100018977 343
240 3300027312 Ga0209371_1001163 Ga0209371_100116313 343
241 3300027312 Ga0209371_1001504 Ga0209371_10015045 343
242 3300027312 Ga0209371_1002767 Ga0209371_10027677 343
243 3300027312 Ga0209371_1006896 Ga0209371_10068963 343
244 3300027312 Ga0209371_1007138 Ga0209371_10071384 343
245 3300030500 Ga0268256_1000022 Ga0268256_1000022374 343
246 3300030500 Ga0268256_1000157 Ga0268256_100015777 343
247 3300030500 Ga0268256_1000981 Ga0268256_10009817 343
248 3300030500 Ga0268256_1002526 Ga0268256_10025264 343
249 3300030500 Ga0268256_1007315 Ga0268256_10073154 343
250 3300041405 Ga0439438_000001 Ga0439438_000001_163773_164807 343
251 3300041407 Ga0439447_001175 Ga0439447_001175_1236_2267 343
252 3300041407 Ga0439447_006572 Ga0439447_006572_2337_3371 343
253 3300041411 Ga0439466_0000003 Ga0439466_0000003_366821_367852 343
254 3300042007 Ga0439449_0015908 Ga0439449_0015908_1470_2501 343
255 3300042010 Ga0439452_000001 Ga0439452_000001_104629_105660 343
256 3300042146 Ga0450907_000775 Ga0450907_000775_5455_6486 343
257 3300046458 Ga0495591_000080 Ga0495591_000080_49667_50698 343
258 3300046458 Ga0495591_011717 Ga0495591_011717_309_1340 343
259 3300046492 Ga0495585_0032662 Ga0495585_0032662_816_1847 343
260 3300046524 Ga0495648_0001111 Ga0495648_0001111_21583_22614 343
261 3300046530 Ga0495654_0000125 Ga0495654_0000125_49664_50695 343
262 3300046616 Ga0495668_0042609 Ga0495668_0042609_1063_2094 343
263 3300046810 Ga0495660_0014093 Ga0495660_0014093_569_1600 343
264 3300047320 Ga0495672_0000004 Ga0495672_0000004_127257_128288 343
265 3300047320 Ga0495672_0000012 Ga0495672_0000012_154452_155483 343
266 3300048903 Ga0496100_0005454 Ga0496100_0005454_5285_6316 343
267 3300048904 Ga0496101_0000098 Ga0496101_0000098_32292_33323 343
268 3300048908 Ga0496105_0006949 Ga0496105_0006949_2446_3477 343
269 3300048919 Ga0496116_0000180 Ga0496116_0000180_98425_99456 343
270 3300048919 Ga0496116_0000385 Ga0496116_0000385_37172_38203 343
271 3300048920 Ga0496117_0000004 Ga0496117_0000004_649635_650666 343
272 3300048920 Ga0496117_0000131 Ga0496117_0000131_152132_153163 343
273 3300048921 Ga0496118_0000024 Ga0496118_0000024_157740_158771 343
274 3300048921 Ga0496118_0008595 Ga0496118_0008595_5781_6812 343
275 3300048921 Ga0496118_0012918 Ga0496118_0012918_78_1109 343
276 3300048921 Ga0496118_0055864 Ga0496118_0055864_952_1983 343
277 3300048922 Ga0496119_0000056 Ga0496119_0000056_146226_147257 343
278 3300048922 Ga0496119_0000068 Ga0496119_0000068_131783_132814 343
279 3300048922 Ga0496119_0018013 Ga0496119_0018013_3977_5008 343
280 3300048922 Ga0496119_0030584 Ga0496119_0030584_301_1332 343
281 3300048923 Ga0496120_0000046 Ga0496120_0000046_162445_163476 343
282 3300048923 Ga0496120_0000063 Ga0496120_0000063_140025_141056 343
283 3300048923 Ga0496120_0000194 Ga0496120_0000194_25935_26966 343
284 3300048923 Ga0496120_0000859 Ga0496120_0000859_28269_29300 343
285 3300048923 Ga0496120_0001162 Ga0496120_0001162_25064_26095 343
286 3300048924 Ga0496121_0000185 Ga0496121_0000185_47826_48857 343
287 3300048925 Ga0496122_0001059 Ga0496122_0001059_39621_40652 343
288 3300048925 Ga0496122_0005476 Ga0496122_0005476_5083_6114 343
289 3300048925 Ga0496122_0145235 Ga0496122_0145235_78_1109 343
290 3300048926 Ga0496123_0003321 Ga0496123_0003321_9764_10795 343
291 3300048926 Ga0496123_0135691 Ga0496123_0135691_259_1290 343
292 3300048927 Ga0496124_0003869 Ga0496124_0003869_12916_13947 343
293 3300048927 Ga0496124_0012410 Ga0496124_0012410_113_1144 343
294 3300048927 Ga0496124_0243767 Ga0496124_0243767_99_1130 343
295 3300048928 Ga0496125_0010157 Ga0496125_0010157_3457_4488 343
296 3300048929 Ga0496126_0017290 Ga0496126_0017290_2505_3536 343
297 3300049459 Ga0495678_032734 Ga0495678_032734_754_1785 343
298 iso_pu_bacteria 2919493220 2919495483 343
299 iso_pu_bacteria 2923525760 2923527744 343
300 3300035398 Ga0316574_0031700 Ga0316574_0031700_705_1784 344
301 iso_pu_bacteria 2510065053 2510283001 344
302 iso_pu_bacteria 2510065055 2510293675 344
303 iso_pu_bacteria 2510065058 2510310719 344
304 iso_pu_bacteria 2773857672 2774131304 344
305 iso_pu_bacteria 2917832318 2917836936 344
306 iso_pu_bacteria 2919125081 2919129809 344
307 iso_pu_bacteria 2974298342 2974302630 344
308 iso_pu_bacteria 2984499530 2984499784 344
309 iso_pu_bacteria 2984504281 2984506208 344
310 iso_pu_bacteria 8016728285 8016731805 344
311 3300009036 Ga0105244_10026110 Ga0105244_100261102 345
312 3300021384 Ga0213876_10000166 Ga0213876_1000016653 345
313 3300025728 Ga0207655_1000370 Ga0207655_100037047 345
314 3300025735 Ga0207713_1000006 Ga0207713_1000006422 345
315 3300027312 Ga0209371_1000047 Ga0209371_1000047221 345
316 3300030500 Ga0268256_1000071 Ga0268256_1000071150 345
317 3300048925 Ga0496122_0026556 Ga0496122_0026556_274_1314 345
318 3300048926 Ga0496123_0000808 Ga0496123_0000808_26202_27242 345
319 3300053156 Ga0500622_0032772 Ga0500622_0032772_1370_2425 346
320 iso_pu_bacteria 2990196909 2990199534 346
321 iso_pu_bacteria 2511231024 2511375737 347
322 iso_pu_bacteria 2554235231 2555247843 347
323 iso_pu_bacteria 2606217733 2608383336 347
324 iso_pu_bacteria 2728369097 2729148656 347
325 iso_pu_bacteria 2765235841 2765586390 347
326 iso_pu_bacteria 2806310737 2807410632 347
327 iso_pu_bacteria 2806310745 2807458973 347
328 iso_pu_bacteria 2811994881 2812369246 347
329 iso_pu_bacteria 2919155634 2919155707 347
330 iso_pu_bacteria 2919543075 2919546121 347
331 iso_pu_bacteria 2923519811 2923523331 347
332 iso_pu_bacteria 3007803356 3007804741 347
333 iso_pu_bacteria 3007872151 3007872810 347
334 iso_pu_bacteria 640427133 640489808 347
335 iso_pu_bacteria 651053060 651177831 347
336 iso_pu_bacteria 8011350971 8011354510 347
337 iso_pu_bacteria 8052494512 8052499601 347
338 iso_pu_bacteria 8054929484 8054934221 347
339 iso_pu_bacteria 8056115690 8056115924 347
340 iso_pu_bacteria 8056120720 8056121121 347
341 iso_pu_bacteria 8056137416 8056137839 347
342 3300039062 Ga0400483_255545 Ga0400483_255545_1901_2947 348
343 iso_pu_bacteria 2738541276 2738713622 348
344 3300009036 Ga0105244_10001642 Ga0105244_1000164217 351
345 3300048919 Ga0496116_0001717 Ga0496116_0001717_11135_12190 351
346 3300048922 Ga0496119_0010221 Ga0496119_0010221_1590_2645 351
347 3300048923 Ga0496120_0000193 Ga0496120_0000193_89940_90995 351
348 3300048927 Ga0496124_0003635 Ga0496124_0003635_4069_5124 351
349 3300027471 Ga0209995_1005961 Ga0209995_10059612 352
350 3300031548 Ga0307408_100000623 Ga0307408_10000062315 352
351 3300031548 Ga0307408_100000908 Ga0307408_10000090811 352
352 3300031901 Ga0307406_10002575 Ga0307406_1000257510 352
353 3300049571 Ga0501034_0045398 Ga0501034_0045398_1409_2467 352
354 3300005327 Ga0070658_10217525 Ga0070658_102175252 353
355 3300005337 Ga0070682_100080342 Ga0070682_1000803422 353
356 3300041405 Ga0439438_003547 Ga0439438_003547_1974_3038 353
357 3300041407 Ga0439447_012844 Ga0439447_012844_1028_2092 353
358 3300046471 Ga0495650_0000540 Ga0495650_0000540_44224_45288 353
359 3300046507 Ga0495606_0000172 Ga0495606_0000172_99167_100231 353
360 3300046524 Ga0495648_0015282 Ga0495648_0015282_4409_5473 353
361 3300046692 Ga0495671_0002785 Ga0495671_0002785_7118_8182 353
362 3300046694 Ga0495649_0016531 Ga0495649_0016531_2130_3194 353
363 3300046810 Ga0495660_0000074 Ga0495660_0000074_94394_95458 353
364 3300047469 Ga0495673_0000023 Ga0495673_0000023_43283_44347 353
365 3300049459 Ga0495678_001711 Ga0495678_001711_10836_11900 353
366 3300049460 Ga0495682_0000026 Ga0495682_0000026_98779_99843 353
367 3300053126 Ga0500621_000001 Ga0500621_000001_537361_538425 353
368 3300031251 Ga0265327_10000002 Ga0265327_10000002711 355
369 3300039062 Ga0400483_075161 Ga0400483_075161_15002_16090 356
370 3300039062 Ga0400483_151062 Ga0400483_151062_457_1572 356
371 3300003323 rootH1_10016756 rootH1_1001675645 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06968

BATS

Biotin and Thiamin Synthesis associated domain

238

329

0.99

PF04055

Radical_SAM

Radical SAM superfamily

65

227

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r30-assembly1.cif.gz_A the crystal structure of biotin synthase, an s-adenosylmethionine-dependent radical enzyme 0.974 16 327
1r30-assembly1.cif.gz_A the crystal structure of biotin synthase, an s-adenosylmethionine-dependent radical enzyme 0.9709 16 327
5ff4-assembly1.cif.gz_A hyde from t. maritima in complex with (2r,4r)-tmetda 0.8819 20 326
3iix-assembly1.cif.gz_A x-ray structure of the fefe-hydrogenase maturase hyde from t. maritima in complex with methionine and 5'deoxyadenosine 0.8816 20 326
5fep-assembly1.cif.gz_A hyde from t. maritima in complex with (2r,4r)-metda 0.881 20 326
ID Description Score Start End Superfamily
af_O59778_20_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9773 16 327 3.20.20.70
af_O59778_20_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9622 16 327 3.20.20.70
af_A0A1D6M1W1_19_103_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9511 248 317 3.40.50.10800
af_Q2FVJ7_11_319_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9354 18 326 3.20.20.70
af_Q2FVJ7_11_319_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9296 18 326 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A379WY99-F1-model_v4 Biotin synthetase (EC 2.8.1.6) 1.001 123 225 GO:0004076
GO:0009102
GO:0046872
GO:0051537
GO:0051539
AF-A0A7U8WRY7-F1-model_v4 deleted 0.9962 136 299
AF-A0A356IQT1-F1-model_v4 biotin synthase (EC 2.8.1.6) 0.9959 123 264 GO:0004076
GO:0009102
GO:0046872
GO:0051537
GO:0051539
AF-A0A6L3X339-F1-model_v4 biotin synthase (EC 2.8.1.6) 0.9929 126 294 GO:0004076
GO:0009102
GO:0046872
GO:0051537
GO:0051539
AF-A0A522ACY0-F1-model_v4 Biotin synthase (EC 2.8.1.6) 0.9901 16 325 GO:0004076
GO:0005506
GO:0009102
GO:0051537
GO:0051539

Feature Viewer

pLDDT pTM Quality
85.25 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map