F425706

General Info

Members Datasets Scaffolds Average Seq Length
371 133 742 316

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10012195|Ga0099794_100121952
Length 347
Sequence VKLLLVLSLILTAALLVVSFAGAAELAPNELGRVMILEYHKIDYPEERWTRTPENFRRDLETLYAKGYRLINLGDLLDRRIALPAGTTPVVLTFDDSSPGQFRYIEANGSVQIDPKSAVGILEAFIAEKPDFGRGGTFYVLPGASKPNRLFNQPEFEGRKLQYLVSHGYEIGNHTLWHANLAKYPEATVRAQVAEAQVWIQRHVPDYRTRTLALPHGAYPADVSWVLRGSAKGMSYSHDAVLMVAGGAAPSPFSRTFDPVRLPRIQAVEQELAYWLNYFDKNPGERFVSDGDANAVTVPTARRDRLRDELPHSLRVVERGPEPPESPVVTLTQDSSARGAGRAGRAR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
87 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 99.19
Stem 0
Stem Tuber 0
Unclassified 15.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10012195 3300007265 Bacteria 3700
2 JGI25406J46586_10009224 3300003203 Bacteria 4424
3 Ga0065707_10111461 3300005295 Bacteria 2394
4 Ga0070689_100136471 3300005340 Bacteria 1970
5 Ga0070691_10022860 3300005341 Bacteria 2902
6 Ga0070669_100052364 3300005353 Bacteria 2986
7 Ga0070703_10036641 3300005406 Unclassified 1508
8 Ga0070705_100005760 3300005440 Bacteria 6053
9 Ga0070705_100026495 3300005440 Bacteria 3155
10 Ga0070705_100042305 3300005440 Bacteria 2604
11 Ga0070705_100062273 3300005440 Bacteria 2221
12 Ga0070694_100001112 3300005444 Bacteria 15385
13 Ga0070694_100021064 3300005444 Bacteria 4161
14 Ga0070708_100008989 3300005445 Bacteria 8049
15 Ga0070708_100012005 3300005445 Bacteria 7060
16 Ga0070708_100020655 3300005445 Bacteria 5558
17 Ga0070708_100046803 3300005445 Unclassified 3818
18 Ga0070708_100062918 3300005445 Unclassified 3320
19 Ga0070708_100078883 3300005445 Unclassified 2977
20 Ga0070708_100082405 3300005445 Unclassified 2914
21 Ga0070708_100195401 3300005445 Bacteria 1893
22 Ga0070662_100115756 3300005457 Bacteria 2048
23 Ga0070706_100032778 3300005467 Bacteria 4793
24 Ga0070706_100109843 3300005467 Bacteria 2566
25 Ga0070706_100164688 3300005467 Bacteria 2070
26 Ga0070706_100271334 3300005467 Unclassified 1583
27 Ga0070706_100331400 3300005467 Bacteria 1419
28 Ga0070707_100006005 3300005468 Bacteria 11331
29 Ga0070707_100091341 3300005468 Bacteria 2947
30 Ga0070707_100113647 3300005468 Unclassified 2627
31 Ga0070707_100378350 3300005468 Bacteria 1375
32 Ga0070698_100082925 3300005471 Bacteria 3197
33 Ga0070699_100004412 3300005518 Bacteria 12433
34 Ga0070699_100015339 3300005518 Bacteria 6585
35 Ga0070699_100018737 3300005518 Bacteria 5944
36 Ga0070699_100028480 3300005518 Bacteria 4817
37 Ga0070699_100043725 3300005518 Unclassified 3877
38 Ga0070699_100069037 3300005518 Bacteria 3071
39 Ga0070699_100139799 3300005518 Bacteria 2137
40 Ga0070697_100010221 3300005536 Bacteria 7317
41 Ga0070697_100018067 3300005536 Bacteria 5557
42 Ga0070697_100050600 3300005536 Bacteria 3373
43 Ga0070697_100103026 3300005536 Bacteria 2372
44 Ga0070697_100225012 3300005536 Bacteria 1599
45 Ga0070697_100366815 3300005536 Bacteria 1245
46 Ga0070672_100084265 3300005543 Bacteria 2552
47 Ga0070695_100003324 3300005545 Bacteria 9407
48 Ga0070695_100014167 3300005545 Bacteria 4804
49 Ga0070696_100008770 3300005546 Bacteria 6765
50 Ga0070696_100016327 3300005546 Bacteria 4997
51 Ga0068855_100050057 3300005563 Bacteria 4925
52 Ga0068863_100067146 3300005841 Bacteria 3392
53 Ga0068860_100167706 3300005843 Unclassified 2120
54 Ga0068860_100264272 3300005843 Bacteria 1678
55 Ga0081455_10003954 3300005937 Bacteria 16828
56 Ga0081539_10000009 3300005985 Bacteria 509286
57 Ga0075428_100000487 3300006844 Bacteria 40054
58 Ga0075428_100001603 3300006844 Bacteria 24199
59 Ga0075428_100004548 3300006844 Bacteria 15337
60 Ga0075428_100048132 3300006844 Unclassified 4681
61 Ga0075428_100059694 3300006844 Bacteria 4176
62 Ga0075428_100065753 3300006844 Bacteria 3971
63 Ga0075428_100070054 3300006844 Bacteria 3834
64 Ga0075428_100078814 3300006844 Bacteria 3596
65 Ga0075428_100216738 3300006844 Bacteria 2068
66 Ga0075430_100004528 3300006846 Bacteria 11705
67 Ga0075430_100006180 3300006846 Bacteria 10092
68 Ga0075430_100009517 3300006846 Bacteria 8215
69 Ga0075430_100012138 3300006846 Bacteria 7336
70 Ga0075430_100013833 3300006846 Bacteria 6876
71 Ga0075430_100124903 3300006846 Bacteria 2145
72 Ga0075431_100000928 3300006847 Bacteria 25874
73 Ga0075431_100018993 3300006847 Bacteria 7003
74 Ga0075431_100019529 3300006847 Bacteria 6911
75 Ga0075431_100021893 3300006847 Bacteria 6535
76 Ga0075431_100036070 3300006847 Bacteria 5093
77 Ga0075431_100061035 3300006847 Unclassified 3891
78 Ga0075431_100138773 3300006847 Bacteria 2506
79 Ga0075431_100213226 3300006847 Unclassified 1972
80 Ga0075431_100341477 3300006847 Bacteria 1507
81 Ga0075433_10002272 3300006852 Bacteria 14614
82 Ga0075433_10003881 3300006852 Bacteria 11563
83 Ga0075433_10009279 3300006852 Bacteria 7867
84 Ga0075433_10072722 3300006852 Bacteria 3024
85 Ga0075433_10106101 3300006852 Bacteria 2490
86 Ga0075433_10155110 3300006852 Bacteria 2037
87 Ga0075433_10281655 3300006852 Unclassified 1473
88 Ga0075433_10308415 3300006852 Unclassified 1401
89 Ga0075434_100002520 3300006871 Bacteria 16151
90 Ga0075434_100005047 3300006871 Bacteria 11987
91 Ga0075434_100014371 3300006871 Bacteria 7568
92 Ga0075434_100023447 3300006871 Bacteria 6015
93 Ga0075434_100078811 3300006871 Unclassified 3291
94 Ga0075434_100262761 3300006871 Bacteria 1745
95 Ga0075434_100349364 3300006871 Bacteria 1500
96 Ga0075434_100367404 3300006871 Bacteria 1460
97 Ga0075429_100000333 3300006880 Bacteria 34186
98 Ga0075429_100005487 3300006880 Bacteria 10920
99 Ga0075429_100006268 3300006880 Bacteria 10292
100 Ga0075429_100070416 3300006880 Bacteria 3045
101 Ga0075429_100076126 3300006880 Bacteria 2923
102 Ga0075429_100134965 3300006880 Unclassified 2160
103 Ga0068865_100361449 3300006881 Unclassified 1179
104 Ga0075436_100025838 3300006914 Bacteria 4042
105 Ga0075436_100038288 3300006914 Bacteria 3310
106 Ga0075436_100058724 3300006914 Bacteria 2657
107 Ga0075436_100164667 3300006914 Unclassified 1564
108 Ga0075435_100012753 3300007076 Bacteria 6227
109 Ga0075435_100017101 3300007076 Bacteria 5480
110 Ga0075435_100017810 3300007076 Bacteria 5384
111 Ga0075435_100023154 3300007076 Bacteria 4799
112 Ga0075435_100028651 3300007076 Bacteria 4368
113 Ga0075435_100244216 3300007076 Bacteria 1528
114 Ga0099794_10113777 3300007265 Unclassified 1357
115 Ga0099794_10122767 3300007265 Unclassified 1308
116 Ga0111539_10001824 3300009094 Bacteria 28361
117 Ga0111539_10002161 3300009094 Bacteria 26320
118 Ga0111539_10004094 3300009094 Bacteria 19131
119 Ga0111539_10032991 3300009094 Bacteria 6287
120 Ga0114129_10000881 3300009147 Bacteria 39092
121 Ga0114129_10001324 3300009147 Bacteria 33148
122 Ga0114129_10002094 3300009147 Bacteria 27441
123 Ga0114129_10006816 3300009147 Bacteria 16225
124 Ga0114129_10013039 3300009147 Bacteria 11839
125 Ga0114129_10017687 3300009147 Bacteria 10148
126 Ga0114129_10026683 3300009147 Bacteria 8182
127 Ga0114129_10056919 3300009147 Bacteria 5474
128 Ga0114129_10108193 3300009147 Unclassified 3839
129 Ga0114129_10183509 3300009147 Bacteria 2845
130 Ga0114129_10404290 3300009147 Unclassified 1799
131 Ga0114129_10892078 3300009147 Bacteria 1127
132 Ga0105243_10445769 3300009148 Bacteria 1213
133 Ga0105242_10141556 3300009176 Bacteria 2087
134 Ga0105249_10226894 3300009553 Bacteria 1841
135 Ga0105249_10383490 3300009553 Unclassified 1432
136 Ga0157371_10071582 3300013102 Bacteria 2454
137 Ga0157371_10073551 3300013102 Bacteria 2420
138 Ga0157378_10078801 3300013297 Unclassified 2973
139 Ga0163162_10054584 3300013306 Bacteria 4020
140 Ga0157372_10192363 3300013307 Bacteria 2363
141 Ga0157375_10266060 3300013308 Unclassified 1876
142 Ga0157380_10023536 3300014326 Bacteria 4647
143 Ga0207699_10104093 3300025906 Unclassified 1807
144 Ga0207684_10001444 3300025910 Bacteria 25714
145 Ga0207684_10005616 3300025910 Bacteria 11534
146 Ga0207684_10022150 3300025910 Bacteria 5426
147 Ga0207684_10035247 3300025910 Bacteria 4249
148 Ga0207684_10040851 3300025910 Bacteria 3932
149 Ga0207684_10046246 3300025910 Unclassified 3692
150 Ga0207684_10048541 3300025910 Bacteria 3600
151 Ga0207684_10092621 3300025910 Bacteria 2576
152 Ga0207684_10194366 3300025910 Unclassified 1750
153 Ga0207684_10309733 3300025910 Bacteria 1361
154 Ga0207652_10378971 3300025921 Bacteria 1277
155 Ga0207646_10007945 3300025922 Bacteria 10706
156 Ga0207646_10010446 3300025922 Bacteria 9073
157 Ga0207646_10013275 3300025922 Bacteria 7881
158 Ga0207646_10035484 3300025922 Bacteria 4504
159 Ga0207646_10147904 3300025922 Bacteria 2117
160 Ga0207646_10517503 3300025922 Bacteria 1074
161 Ga0207681_10030755 3300025923 Bacteria 3502
162 Ga0207704_10065225 3300025938 Bacteria 2279
163 Ga0207704_10267475 3300025938 Unclassified 1292
164 Ga0207691_10142164 3300025940 Bacteria 2114
165 Ga0207712_10095536 3300025961 Bacteria 2198
166 Ga0207648_10192720 3300026089 Bacteria 1807
167 Ga0210000_1000810 3300027462 Bacteria 4330
168 Ga0209968_1001743 3300027526 Bacteria 3293
169 Ga0209999_1004196 3300027543 Bacteria 2594
170 Ga0209982_1001584 3300027552 Bacteria 3127
171 Ga0209970_1003157 3300027614 Bacteria 2784
172 Ga0210002_1002880 3300027617 Bacteria 2514
173 Ga0209983_1000767 3300027665 Bacteria 6981
174 Ga0209971_1000022 3300027682 Bacteria 56932
175 Ga0209971_1002319 3300027682 Bacteria 4606
176 Ga0209966_1000492 3300027695 Bacteria 10543
177 Ga0209966_1031607 3300027695 Unclassified 1074
178 Ga0209998_10000199 3300027717 Bacteria 21032
179 Ga0209998_10015416 3300027717 Bacteria 1601
180 Ga0209974_10002158 3300027876 Bacteria 7189
181 Ga0207428_10000018 3300027907 Bacteria 293117
182 Ga0207428_10001909 3300027907 Bacteria 21095
183 Ga0207428_10138515 3300027907 Unclassified 1859
184 Ga0307408_100014085 3300031548 Bacteria 5313
185 Ga0307408_100169149 3300031548 Bacteria 1744
186 Ga0307405_10286282 3300031731 Bacteria 1243
187 Ga0307410_10034792 3300031852 Bacteria 3267
188 Ga0307416_100368257 3300032002 Bacteria 1462
189 Ga0307411_10020688 3300032005 Bacteria 3834
190 Ga0373949_0025014 3300035090 Bacteria 1391
191 Ga0373931_0015750 3300035691 Bacteria 3710
192 Ga0373937_0338847 3300036401 Unclassified 1424
193 Ga0395900_0030999 3300037418 Bacteria 5492
194 Ga0395900_0110850 3300037418 Bacteria 2819
195 Ga0395898_0056784 3300037466 Bacteria 3815
196 Ga0436364_1158994 3300037853 Bacteria 1438
197 Ga0395901_0001231 3300038443 Bacteria 27297
198 Ga0400483_015774 3300039062 Bacteria 12711
199 Ga0451577_0037345 3300042876 Bacteria 4372
200 Ga0451577_0134834 3300042876 Bacteria 2217
201 Ga0453683_0009424 3300044673 Bacteria 6515
202 Ga0453683_0017953 3300044673 Bacteria 4545
203 Ga0453683_0130506 3300044673 Unclassified 1583
204 Ga0451576_0019690 3300045051 Bacteria 7364
205 Ga0451576_0156790 3300045051 Bacteria 2375
206 Ga0451576_0159867 3300045051 Bacteria 2351
207 Ga0451576_0283648 3300045051 Bacteria 1731
208 Ga0466958_0025215 3300045836 Bacteria 3504
209 Ga0495603_0155123 3300046455 Unclassified 1329
210 Ga0495580_0001661 3300046472 Bacteria 19559
211 Ga0495580_0022166 3300046472 Bacteria 4678
212 Ga0495585_0125172 3300046492 Unclassified 1357
213 Ga0495642_0035427 3300046528 Bacteria 2014
214 Ga0495659_0021564 3300046664 Bacteria 2172
215 Ga0495669_0009962 3300046684 Bacteria 4018
216 Ga0495670_0183400 3300046691 Unclassified 1106
217 Ga0495636_0085294 3300047318 Bacteria 1365
218 Ga0496113_0449696 3300048916 Bacteria 1035
219 Ga0501298_037696 3300049521 Unclassified 971
220 Ga0501031_0099447 3300049568 Unclassified 1898
221 Ga0501033_0026974 3300049570 Bacteria 4321
222 Ga0501036_0007667 3300049572 Bacteria 8813
223 Ga0501036_0185338 3300049572 Bacteria 1751
224 Ga0501038_0065669 3300049574 Bacteria 3091
225 Ga0501039_0009978 3300049575 Bacteria 7240
226 Ga0501039_0133816 3300049575 Unclassified 1946
227 Ga0501039_0348835 3300049575 Unclassified 1163
228 Ga0501040_0001726 3300049576 Bacteria 14025
229 Ga0501040_0007937 3300049576 Bacteria 6886
230 Ga0501040_0071822 3300049576 Bacteria 2390
231 Ga0501041_0088344 3300049577 Unclassified 1913
232 Ga0501042_0013295 3300049578 Bacteria 5600
233 Ga0501043_0030213 3300049579 Bacteria 4257
234 Ga0501046_0000340 3300049580 Bacteria 47112
235 Ga0501046_0011104 3300049580 Bacteria 7712
236 Ga0501046_0297468 3300049580 Unclassified 1179
237 Ga0501047_0000015 3300049581 Bacteria 307932
238 Ga0501048_0006607 3300049582 Bacteria 8812
239 Ga0501048_0044109 3300049582 Bacteria 3190
240 Ga0501048_0055837 3300049582 Bacteria 2803
241 Ga0501048_0089483 3300049582 Bacteria 2172
242 Ga0501067_0005357 3300049583 Bacteria 7123
243 Ga0501068_0017146 3300049584 Bacteria 4185
244 Ga0501068_0030998 3300049584 Bacteria 3175
245 Ga0501068_0071838 3300049584 Bacteria 2113
246 Ga0501068_0090884 3300049584 Unclassified 1884
247 Ga0501068_0210181 3300049584 Unclassified 1235
248 Ga0501068_0271284 3300049584 Unclassified 1083
249 Ga0501069_0023645 3300049585 Bacteria 3351
250 Ga0501071_0090175 3300049587 Bacteria 2251
251 Ga0501071_0140439 3300049587 Unclassified 1798
252 Ga0501071_0249233 3300049587 Bacteria 1340
253 Ga0501072_0021832 3300049588 Bacteria 4965
254 Ga0501072_0035230 3300049588 Bacteria 3923
255 Ga0501072_0107388 3300049588 Bacteria 2220
256 Ga0501074_0053736 3300049590 Bacteria 2905
257 Ga0501074_0068137 3300049590 Bacteria 2558
258 Ga0501074_0179988 3300049590 Bacteria 1508
259 Ga0501075_0017209 3300049591 Bacteria 5219
260 Ga0501075_0033054 3300049591 Bacteria 3847
261 Ga0501075_0038766 3300049591 Bacteria 3563
262 Ga0501075_0081457 3300049591 Bacteria 2450
263 Ga0501076_0001143 3300049592 Bacteria 17565
264 Ga0501076_0005585 3300049592 Bacteria 9058
265 Ga0501076_0045311 3300049592 Bacteria 3472
266 Ga0501076_0134067 3300049592 Unclassified 2010
267 Ga0501077_0003531 3300049593 Bacteria 9392
268 Ga0501077_0006028 3300049593 Bacteria 7403
269 Ga0501077_0347631 3300049593 Bacteria 946
270 Ga0501079_0003702 3300049741 Bacteria 11273
271 Ga0501079_0010226 3300049741 Bacteria 7123
272 Ga0501079_0061042 3300049741 Bacteria 2908
273 Ga0501079_0103079 3300049741 Bacteria 2213
274 Ga0501079_0580177 3300049741 Unclassified 882
275 Ga0501080_0031226 3300049742 Bacteria 4964
276 Ga0501080_0138260 3300049742 Bacteria 2253
277 Ga0501081_0000843 3300049743 Bacteria 18135
278 Ga0501081_0007724 3300049743 Bacteria 6973
279 Ga0501081_0076378 3300049743 Bacteria 2339
280 Ga0501081_0089431 3300049743 Bacteria 2164
281 Ga0501081_0155983 3300049743 Bacteria 1643
282 Ga0501083_0016141 3300049744 Bacteria 5230
283 Ga0501083_0069890 3300049744 Bacteria 2336
284 Ga0501035_0125843 3300049822 Bacteria 2237
285 Ga0501045_0001377 3300049824 Bacteria 16198
286 Ga0501045_0024006 3300049824 Bacteria 4377
287 Ga0501045_0077156 3300049824 Bacteria 2455
288 Ga0501045_0128705 3300049824 Bacteria 1882
289 nmdc:mga05p37_111478_c1 3300050507 Bacteria 3365
290 nmdc:mga05p37_138660_c1 3300050507 Bacteria 2981
291 nmdc:mga05p37_157231_c1 3300050507 Bacteria 2777
292 nmdc:mga05p37_1687_c1 3300050507 Bacteria 25692
293 nmdc:mga05p37_220945_c1 3300050507 Unclassified 2286
294 nmdc:mga05p37_2746_c1 3300050507 Bacteria 20451
295 nmdc:mga05p37_27756_c1 3300050507 Bacteria 6895
296 nmdc:mga05p37_286853_c1 3300050507 Bacteria 1961
297 nmdc:mga05p37_294043_c1 3300050507 Bacteria 1932
298 nmdc:mga05p37_413_c1 3300050507 Bacteria 46142
299 nmdc:mga05p37_49075_c1 3300050507 Bacteria 5192
300 nmdc:mga05p37_4934_c1 3300050507 Bacteria 15628
301 nmdc:mga05p37_49921_c1 3300050507 Bacteria 5146
302 nmdc:mga05p37_51266_c1 3300050507 Bacteria 5076
303 nmdc:mga05p37_717493_c1 3300050507 Bacteria 1108
304 nmdc:mga05p37_7382_c1 3300050507 Bacteria 12967
305 nmdc:mga05p37_81744_c1 3300050507 Bacteria 3980
306 nmdc:mga09592_17860_c1 3300050508 Bacteria 5811
307 nmdc:mga09592_18671_c1 3300050508 Bacteria 5688
308 nmdc:mga09592_29710_c1 3300050508 Unclassified 4545
309 nmdc:mga09592_37570_c1 3300050508 Bacteria 4062
310 nmdc:mga09592_4402_c1 3300050508 Bacteria 11397
311 nmdc:mga09592_4787_c1 3300050508 Bacteria 10965
312 nmdc:mga0qj67_167_c1 3300050509 Bacteria 44082
313 nmdc:mga0qj67_19943_c1 3300050509 Bacteria 5130
314 nmdc:mga0qj67_71087_c1 3300050509 Unclassified 2777
315 nmdc:mga0qj67_94074_c1 3300050509 Unclassified 2410
316 nmdc:mga06r32_226797_c1 3300050510 Unclassified 1856
317 nmdc:mga06r32_2383_c1 3300050510 Bacteria 16825
318 nmdc:mga06r32_29791_c1 3300050510 Bacteria 5119
319 nmdc:mga06r32_4135_c1 3300050510 Bacteria 12993
320 nmdc:mga06r32_49107_c1 3300050510 Bacteria 4035
321 nmdc:mga08y16_138_c1 3300050511 Bacteria 63184
322 nmdc:mga08y16_21033_c1 3300050511 Bacteria 6889
323 nmdc:mga08y16_372983_c1 3300050511 Bacteria 1464
324 nmdc:mga08y16_40745_c1 3300050511 Bacteria 4867
325 nmdc:mga08y16_51690_c1 3300050511 Bacteria 4300
326 nmdc:mga0n895_10860_c1 3300050512 Bacteria 8083
327 nmdc:mga0n895_127_c1 3300050512 Bacteria 45097
328 nmdc:mga0n895_41034_c1 3300050512 Bacteria 4498
329 nmdc:mga0n895_67277_c1 3300050512 Bacteria 3548
330 nmdc:mga0n895_71540_c1 3300050512 Bacteria 3440
331 nmdc:mga0rr50_17325_c1 3300050513 Bacteria 4807
332 nmdc:mga0rr50_1845_c1 3300050513 Bacteria 11732
333 nmdc:mga0rr50_22230_c1 3300050513 Bacteria 4349
334 nmdc:mga0rr50_291955_c1 3300050513 Bacteria 1363
335 nmdc:mga0rr50_56018_c1 3300050513 Unclassified 2944
336 nmdc:mga0rr50_643_c1 3300050513 Bacteria 18770
337 nmdc:mga0rr50_862_c1 3300050513 Bacteria 16359
338 nmdc:mga08x19_20407_c1 3300050514 Bacteria 4079
339 nmdc:mga08x19_2715_c1 3300050514 Bacteria 10700
340 nmdc:mga08x19_3246_c1 3300050514 Bacteria 9741
341 nmdc:mga08x19_50720_c1 3300050514 Bacteria 2663
342 nmdc:mga0a205_111716_c1 3300050515 Bacteria 2632
343 nmdc:mga0a205_117542_c1 3300050515 Unclassified 2557
344 nmdc:mga0a205_15435_c1 3300050515 Bacteria 7139
345 nmdc:mga0a205_23469_c1 3300050515 Bacteria 5852
346 nmdc:mga0a205_23872_c1 3300050515 Bacteria 5804
347 nmdc:mga0a205_2722_c1 3300050515 Bacteria 15625
348 nmdc:mga0a205_279590_c1 3300050515 Unclassified 1545
349 nmdc:mga0a205_433_c1 3300050515 Bacteria 32195
350 nmdc:mga0a205_510517_c1 3300050515 Bacteria 1059
351 nmdc:mga0a205_58551_c1 3300050515 Bacteria 3721
352 nmdc:mga0a205_693_c1 3300050515 Bacteria 26987
353 Ga0501084_0010452 3300054114 Bacteria 7673
354 Ga0501084_0020194 3300054114 Bacteria 5553
355 Ga0501084_0024668 3300054114 Bacteria 5018
356 Ga0501084_0036221 3300054114 Bacteria 4122
357 Ga0501084_0098015 3300054114 Bacteria 2461
358 Ga0501084_0207107 3300054114 Bacteria 1655
359 Ga0590071_015070 3300059421 Bacteria 1813
360 Ga0590077_006533 3300059426 Bacteria 2387
361 Ga0501082_0000462 3300060353 Bacteria 35910
362 Ga0501082_0003407 3300060353 Bacteria 13883
363 Ga0501082_0016771 3300060353 Bacteria 6307
364 Ga0501082_0045829 3300060353 Bacteria 3770
365 Ga0501082_0107938 3300060353 Bacteria 2409
366 Ga0501082_0420064 3300060353 Unclassified 1168
367 Ga0530510_0000836 3300061734 Bacteria 20248
368 Ga0530510_0005527 3300061734 Bacteria 8755
369 Ga0530510_0012386 3300061734 Bacteria 5991
370 Ga0530510_0070621 3300061734 Bacteria 2534
371 Ga0530510_0075591 3300061734 Unclassified 2447
372 Ga0099794_10012195
373 JGI25406J46586_10009224
374 Ga0065707_10111461
375 Ga0070689_100136471
376 Ga0070691_10022860
377 Ga0070669_100052364
378 Ga0070703_10036641
379 Ga0070705_100005760
380 Ga0070705_100026495
381 Ga0070705_100042305
382 Ga0070705_100062273
383 Ga0070694_100001112
384 Ga0070694_100021064
385 Ga0070708_100008989
386 Ga0070708_100012005
387 Ga0070708_100020655
388 Ga0070708_100046803
389 Ga0070708_100062918
390 Ga0070708_100078883
391 Ga0070708_100082405
392 Ga0070708_100195401
393 Ga0070662_100115756
394 Ga0070706_100032778
395 Ga0070706_100109843
396 Ga0070706_100164688
397 Ga0070706_100271334
398 Ga0070706_100331400
399 Ga0070707_100006005
400 Ga0070707_100091341
401 Ga0070707_100113647
402 Ga0070707_100378350
403 Ga0070698_100082925
404 Ga0070699_100004412
405 Ga0070699_100015339
406 Ga0070699_100018737
407 Ga0070699_100028480
408 Ga0070699_100043725
409 Ga0070699_100069037
410 Ga0070699_100139799
411 Ga0070697_100010221
412 Ga0070697_100018067
413 Ga0070697_100050600
414 Ga0070697_100103026
415 Ga0070697_100225012
416 Ga0070697_100366815
417 Ga0070672_100084265
418 Ga0070695_100003324
419 Ga0070695_100014167
420 Ga0070696_100008770
421 Ga0070696_100016327
422 Ga0068855_100050057
423 Ga0068863_100067146
424 Ga0068860_100167706
425 Ga0068860_100264272
426 Ga0081455_10003954
427 Ga0081539_10000009
428 Ga0075428_100000487
429 Ga0075428_100001603
430 Ga0075428_100004548
431 Ga0075428_100048132
432 Ga0075428_100059694
433 Ga0075428_100065753
434 Ga0075428_100070054
435 Ga0075428_100078814
436 Ga0075428_100216738
437 Ga0075430_100004528
438 Ga0075430_100006180
439 Ga0075430_100009517
440 Ga0075430_100012138
441 Ga0075430_100013833
442 Ga0075430_100124903
443 Ga0075431_100000928
444 Ga0075431_100018993
445 Ga0075431_100019529
446 Ga0075431_100021893
447 Ga0075431_100036070
448 Ga0075431_100061035
449 Ga0075431_100138773
450 Ga0075431_100213226
451 Ga0075431_100341477
452 Ga0075433_10002272
453 Ga0075433_10003881
454 Ga0075433_10009279
455 Ga0075433_10072722
456 Ga0075433_10106101
457 Ga0075433_10155110
458 Ga0075433_10281655
459 Ga0075433_10308415
460 Ga0075434_100002520
461 Ga0075434_100005047
462 Ga0075434_100014371
463 Ga0075434_100023447
464 Ga0075434_100078811
465 Ga0075434_100262761
466 Ga0075434_100349364
467 Ga0075434_100367404
468 Ga0075429_100000333
469 Ga0075429_100005487
470 Ga0075429_100006268
471 Ga0075429_100070416
472 Ga0075429_100076126
473 Ga0075429_100134965
474 Ga0068865_100361449
475 Ga0075436_100025838
476 Ga0075436_100038288
477 Ga0075436_100058724
478 Ga0075436_100164667
479 Ga0075435_100012753
480 Ga0075435_100017101
481 Ga0075435_100017810
482 Ga0075435_100023154
483 Ga0075435_100028651
484 Ga0075435_100244216
485 Ga0099794_10113777
486 Ga0099794_10122767
487 Ga0111539_10001824
488 Ga0111539_10002161
489 Ga0111539_10004094
490 Ga0111539_10032991
491 Ga0114129_10000881
492 Ga0114129_10001324
493 Ga0114129_10002094
494 Ga0114129_10006816
495 Ga0114129_10013039
496 Ga0114129_10017687
497 Ga0114129_10026683
498 Ga0114129_10056919
499 Ga0114129_10108193
500 Ga0114129_10183509
501 Ga0114129_10404290
502 Ga0114129_10892078
503 Ga0105243_10445769
504 Ga0105242_10141556
505 Ga0105249_10226894
506 Ga0105249_10383490
507 Ga0157371_10071582
508 Ga0157371_10073551
509 Ga0157378_10078801
510 Ga0163162_10054584
511 Ga0157372_10192363
512 Ga0157375_10266060
513 Ga0157380_10023536
514 Ga0207699_10104093
515 Ga0207684_10001444
516 Ga0207684_10005616
517 Ga0207684_10022150
518 Ga0207684_10035247
519 Ga0207684_10040851
520 Ga0207684_10046246
521 Ga0207684_10048541
522 Ga0207684_10092621
523 Ga0207684_10194366
524 Ga0207684_10309733
525 Ga0207652_10378971
526 Ga0207646_10007945
527 Ga0207646_10010446
528 Ga0207646_10013275
529 Ga0207646_10035484
530 Ga0207646_10147904
531 Ga0207646_10517503
532 Ga0207681_10030755
533 Ga0207704_10065225
534 Ga0207704_10267475
535 Ga0207691_10142164
536 Ga0207712_10095536
537 Ga0207648_10192720
538 Ga0210000_1000810
539 Ga0209968_1001743
540 Ga0209999_1004196
541 Ga0209982_1001584
542 Ga0209970_1003157
543 Ga0210002_1002880
544 Ga0209983_1000767
545 Ga0209971_1000022
546 Ga0209971_1002319
547 Ga0209966_1000492
548 Ga0209966_1031607
549 Ga0209998_10000199
550 Ga0209998_10015416
551 Ga0209974_10002158
552 Ga0207428_10000018
553 Ga0207428_10001909
554 Ga0207428_10138515
555 Ga0307408_100014085
556 Ga0307408_100169149
557 Ga0307405_10286282
558 Ga0307410_10034792
559 Ga0307416_100368257
560 Ga0307411_10020688
561 Ga0373949_0025014
562 Ga0373931_0015750
563 Ga0373937_0338847
564 Ga0395900_0030999
565 Ga0395900_0110850
566 Ga0395898_0056784
567 Ga0436364_1158994
568 Ga0395901_0001231
569 Ga0400483_015774
570 Ga0451577_0037345
571 Ga0451577_0134834
572 Ga0453683_0009424
573 Ga0453683_0017953
574 Ga0453683_0130506
575 Ga0451576_0019690
576 Ga0451576_0156790
577 Ga0451576_0159867
578 Ga0451576_0283648
579 Ga0466958_0025215
580 Ga0495603_0155123
581 Ga0495580_0001661
582 Ga0495580_0022166
583 Ga0495585_0125172
584 Ga0495642_0035427
585 Ga0495659_0021564
586 Ga0495669_0009962
587 Ga0495670_0183400
588 Ga0495636_0085294
589 Ga0496113_0449696
590 Ga0501298_037696
591 Ga0501031_0099447
592 Ga0501033_0026974
593 Ga0501036_0007667
594 Ga0501036_0185338
595 Ga0501038_0065669
596 Ga0501039_0009978
597 Ga0501039_0133816
598 Ga0501039_0348835
599 Ga0501040_0001726
600 Ga0501040_0007937
601 Ga0501040_0071822
602 Ga0501041_0088344
603 Ga0501042_0013295
604 Ga0501043_0030213
605 Ga0501046_0000340
606 Ga0501046_0011104
607 Ga0501046_0297468
608 Ga0501047_0000015
609 Ga0501048_0006607
610 Ga0501048_0044109
611 Ga0501048_0055837
612 Ga0501048_0089483
613 Ga0501067_0005357
614 Ga0501068_0017146
615 Ga0501068_0030998
616 Ga0501068_0071838
617 Ga0501068_0090884
618 Ga0501068_0210181
619 Ga0501068_0271284
620 Ga0501069_0023645
621 Ga0501071_0090175
622 Ga0501071_0140439
623 Ga0501071_0249233
624 Ga0501072_0021832
625 Ga0501072_0035230
626 Ga0501072_0107388
627 Ga0501074_0053736
628 Ga0501074_0068137
629 Ga0501074_0179988
630 Ga0501075_0017209
631 Ga0501075_0033054
632 Ga0501075_0038766
633 Ga0501075_0081457
634 Ga0501076_0001143
635 Ga0501076_0005585
636 Ga0501076_0045311
637 Ga0501076_0134067
638 Ga0501077_0003531
639 Ga0501077_0006028
640 Ga0501077_0347631
641 Ga0501079_0003702
642 Ga0501079_0010226
643 Ga0501079_0061042
644 Ga0501079_0103079
645 Ga0501079_0580177
646 Ga0501080_0031226
647 Ga0501080_0138260
648 Ga0501081_0000843
649 Ga0501081_0007724
650 Ga0501081_0076378
651 Ga0501081_0089431
652 Ga0501081_0155983
653 Ga0501083_0016141
654 Ga0501083_0069890
655 Ga0501035_0125843
656 Ga0501045_0001377
657 Ga0501045_0024006
658 Ga0501045_0077156
659 Ga0501045_0128705
660 nmdc:mga05p37_111478_c1
661 nmdc:mga05p37_138660_c1
662 nmdc:mga05p37_157231_c1
663 nmdc:mga05p37_1687_c1
664 nmdc:mga05p37_220945_c1
665 nmdc:mga05p37_2746_c1
666 nmdc:mga05p37_27756_c1
667 nmdc:mga05p37_286853_c1
668 nmdc:mga05p37_294043_c1
669 nmdc:mga05p37_413_c1
670 nmdc:mga05p37_49075_c1
671 nmdc:mga05p37_4934_c1
672 nmdc:mga05p37_49921_c1
673 nmdc:mga05p37_51266_c1
674 nmdc:mga05p37_717493_c1
675 nmdc:mga05p37_7382_c1
676 nmdc:mga05p37_81744_c1
677 nmdc:mga09592_17860_c1
678 nmdc:mga09592_18671_c1
679 nmdc:mga09592_29710_c1
680 nmdc:mga09592_37570_c1
681 nmdc:mga09592_4402_c1
682 nmdc:mga09592_4787_c1
683 nmdc:mga0qj67_167_c1
684 nmdc:mga0qj67_19943_c1
685 nmdc:mga0qj67_71087_c1
686 nmdc:mga0qj67_94074_c1
687 nmdc:mga06r32_226797_c1
688 nmdc:mga06r32_2383_c1
689 nmdc:mga06r32_29791_c1
690 nmdc:mga06r32_4135_c1
691 nmdc:mga06r32_49107_c1
692 nmdc:mga08y16_138_c1
693 nmdc:mga08y16_21033_c1
694 nmdc:mga08y16_372983_c1
695 nmdc:mga08y16_40745_c1
696 nmdc:mga08y16_51690_c1
697 nmdc:mga0n895_10860_c1
698 nmdc:mga0n895_127_c1
699 nmdc:mga0n895_41034_c1
700 nmdc:mga0n895_67277_c1
701 nmdc:mga0n895_71540_c1
702 nmdc:mga0rr50_17325_c1
703 nmdc:mga0rr50_1845_c1
704 nmdc:mga0rr50_22230_c1
705 nmdc:mga0rr50_291955_c1
706 nmdc:mga0rr50_56018_c1
707 nmdc:mga0rr50_643_c1
708 nmdc:mga0rr50_862_c1
709 nmdc:mga08x19_20407_c1
710 nmdc:mga08x19_2715_c1
711 nmdc:mga08x19_3246_c1
712 nmdc:mga08x19_50720_c1
713 nmdc:mga0a205_111716_c1
714 nmdc:mga0a205_117542_c1
715 nmdc:mga0a205_15435_c1
716 nmdc:mga0a205_23469_c1
717 nmdc:mga0a205_23872_c1
718 nmdc:mga0a205_2722_c1
719 nmdc:mga0a205_279590_c1
720 nmdc:mga0a205_433_c1
721 nmdc:mga0a205_510517_c1
722 nmdc:mga0a205_58551_c1
723 nmdc:mga0a205_693_c1
724 Ga0501084_0010452
725 Ga0501084_0020194
726 Ga0501084_0024668
727 Ga0501084_0036221
728 Ga0501084_0098015
729 Ga0501084_0207107
730 Ga0590071_015070
731 Ga0590077_006533
732 Ga0501082_0000462
733 Ga0501082_0003407
734 Ga0501082_0016771
735 Ga0501082_0045829
736 Ga0501082_0107938
737 Ga0501082_0420064
738 Ga0530510_0000836
739 Ga0530510_0005527
740 Ga0530510_0012386
741 Ga0530510_0070621
742 Ga0530510_0075591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

131

233

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.7726 33 277
4v33-assembly2.cif.gz_B crystal structure of the putative polysaccharide deacetylase ba0330 from bacillus anthracis 0.7602 33 275
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.7539 88 212
6h8n-assembly1.cif.gz_A structure of peptidoglycan deacetylase pdac from bacillus subtilis - mutant d285s 0.75 88 223
6h8l-assembly1.cif.gz_A structure of peptidoglycan deacetylase pdac from bacillus subtilis 0.7492 88 223
ID Description Score Start End Superfamily
af_Q9VPI3_1693_1928_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7679 133 212 3.20.20.370
4v33B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7421 33 275 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7405 88 225 3.20.20.370
4v33B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7329 33 275 3.20.20.370
2iw0A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7289 122 212 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A1F7NDY8-F1-model_v4 NodB homology domain-containing protein 0.9832 35 316 GO:0005975
GO:0016810
AF-A0A2V6ZLM6-F1-model_v4 Polysaccharide deacetylase 0.9785 20 316 GO:0005975
GO:0016810
AF-A0A257RQ54-F1-model_v4 Polysaccharide deacetylase 0.9719 36 125 GO:0005975
AF-A0A355I6D8-F1-model_v4 Polysaccharide deacetylase 0.9714 26 318 GO:0005975
GO:0016810
AF-A0A2V7FDB7-F1-model_v4 Polysaccharide deacetylase 0.9701 1 318 GO:0005975
GO:0016020
GO:0016810

Map