F425619

General Info

Members Datasets Scaffolds Average Seq Length
371 197 352 260

Family's Representative Sequence

Representative Sequence 3300002239|JGI24034J26672_10004353|JGI24034J26672_100043532
Length 297
Sequence VIQIRDIDETQAPLLDHLIELRSRLLRCVYALALTSAISYYFVDAILAILVHPLSLAFPAGHGRLIYTKLYSAFFVNLKVALFSGFLLSFPVIANQLWAFVAPGLYAKEKRAFLPFLIATPILFGMGASLAYFVVMPTAFKWFVGFQGNKGGLQLEALPGIEEYLALVMQFILAFGVSFLLPVLLMLLNRAGIVSRDALVKARRYVIVGIVALAALITPPDVVSQLMLAIPLLILFEGTLVIMRFAERADAEEKQPTDVVSQLMLAIPLLILFEGTLVIMRFAERADAEEQPTELLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
6 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
7 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
8 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
9 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
10 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
11 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
12 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
13 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
14 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
15 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
18 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
19 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
116 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
176 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
195 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.34
Metatranscriptomes 0.54
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.24
Nodule 0.27
Rhizoplane 5.39
Rhizosphere 67.39
Stem 0
Stem Tuber 0
Unclassified 16.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1588125 2162886007 Bacteria 9034
2 SwRhRL2b_contig_3033499 2162886007 Bacteria 2452
3 SwRhRL2b_contig_834655 2162886007 Bacteria 4478
4 JGI24735J21928_10004453 3300002067 Bacteria 4709
5 JGI24738J21930_10001980 3300002075 Bacteria 5507
6 JGI24034J26672_10004353 3300002239 Bacteria 2005
7 JGI24751J29686_10000133 3300002459 Bacteria 37734
8 Ga0055530_10012705 3300003791 Bacteria 2919
9 Ga0065704_10000204 3300005289 Bacteria 211587
10 Ga0065704_10001076 3300005289 Bacteria 11654
11 Ga0065704_10070689 3300005289 Bacteria 17688
12 Ga0065704_10071428 3300005289 Bacteria 11209
13 Ga0065704_10198212 3300005289 Bacteria 1158
14 Ga0065704_10212214 3300005289 Bacteria 1104
15 Ga0065707_10210048 3300005295 Bacteria 1270
16 Ga0065707_10223265 3300005295 Bacteria 1217
17 Ga0065707_10225821 3300005295 Bacteria 1207
18 Ga0070683_100298255 3300005329 Bacteria 1533
19 Ga0070670_100040569 3300005331 Bacteria 4001
20 Ga0070670_100080264 3300005331 Bacteria 2804
21 Ga0070666_10017017 3300005335 Bacteria 4657
22 Ga0070666_10031647 3300005335 Bacteria 3493
23 Ga0070666_10052475 3300005335 Bacteria 2748
24 Ga0070666_10107859 3300005335 Bacteria 1924
25 Ga0070660_100020688 3300005339 Bacteria 4841
26 Ga0070661_100274912 3300005344 Bacteria 1305
27 Ga0070668_100003099 3300005347 Bacteria 12285
28 Ga0070668_100005243 3300005347 Bacteria 9619
29 Ga0070668_100005555 3300005347 Bacteria 9357
30 Ga0070668_100018876 3300005347 Bacteria 5181
31 Ga0070668_100039704 3300005347 Bacteria 3599
32 Ga0070668_100222103 3300005347 Bacteria 1559
33 Ga0070668_100280632 3300005347 Bacteria 1391
34 Ga0070669_100001347 3300005353 Bacteria 17705
35 Ga0070669_100001489 3300005353 Bacteria 16923
36 Ga0070669_100009151 3300005353 Bacteria 7059
37 Ga0070669_100012657 3300005353 Bacteria 5988
38 Ga0070669_100082955 3300005353 Bacteria 2390
39 Ga0070671_100000040 3300005355 Bacteria 92357
40 Ga0070671_100001709 3300005355 Bacteria 16660
41 Ga0070671_100018351 3300005355 Bacteria 5682
42 Ga0070671_100086743 3300005355 Bacteria 2619
43 Ga0070671_100272293 3300005355 Bacteria 1439
44 Ga0070667_100000024 3300005367 Bacteria 191216
45 Ga0070667_100006505 3300005367 Bacteria 9714
46 Ga0070667_100031758 3300005367 Bacteria 4402
47 Ga0070667_100073279 3300005367 Bacteria 2920
48 Ga0070685_10081900 3300005466 Bacteria 1936
49 Ga0068853_100507425 3300005539 Bacteria 1139
50 Ga0070686_100367523 3300005544 Bacteria 1085
51 Ga0070665_100000878 3300005548 Bacteria 38691
52 Ga0068855_100206251 3300005563 Bacteria 2211
53 Ga0068855_100326567 3300005563 Bacteria 1694
54 Ga0068856_100021889 3300005614 Bacteria 6214
55 Ga0068859_100183415 3300005617 Bacteria 2176
56 Ga0068864_100019546 3300005618 Bacteria 5666
57 Ga0068864_100371245 3300005618 Bacteria 1354
58 Ga0068851_10234512 3300005834 Bacteria 1035
59 Ga0068863_100000082 3300005841 Bacteria 105688
60 Ga0068863_100114462 3300005841 Bacteria 2570
61 Ga0068863_100116088 3300005841 Bacteria 2551
62 Ga0068858_100022675 3300005842 Bacteria 5855
63 Ga0068858_100100204 3300005842 Bacteria 2701
64 Ga0068858_100176473 3300005842 Bacteria 2016
65 Ga0068860_100001415 3300005843 Bacteria 25996
66 Ga0068860_100017336 3300005843 Bacteria 7017
67 Ga0068860_100103659 3300005843 Bacteria 2715
68 Ga0068860_100144751 3300005843 Bacteria 2286
69 Ga0068860_100231874 3300005843 Bacteria 1794
70 Ga0068862_100003392 3300005844 Bacteria 13737
71 Ga0068862_100005835 3300005844 Bacteria 10261
72 Ga0068862_100067316 3300005844 Bacteria 3087
73 Ga0075368_10014325 3300006042 Bacteria 2926
74 Ga0075363_100007669 3300006048 Bacteria 4978
75 Ga0075364_10001169 3300006051 Bacteria 14073
76 Ga0075364_10029730 3300006051 Bacteria 3505
77 Ga0075362_10001050 3300006177 Bacteria 8530
78 Ga0075367_10003424 3300006178 Bacteria 7560
79 Ga0075369_10001773 3300006186 Bacteria 7503
80 Ga0075366_10014456 3300006195 Bacteria 4508
81 Ga0075370_10012833 3300006353 Bacteria 4438
82 Ga0075370_10224453 3300006353 Bacteria 1111
83 Ga0097620_100183409 3300006931 Bacteria 2176
84 Ga0105251_10016546 3300009011 Bacteria 3981
85 Ga0105250_10078083 3300009092 Bacteria 1340
86 Ga0105250_10133799 3300009092 Bacteria 1024
87 Ga0105247_10033849 3300009101 Bacteria 3110
88 Ga0105247_10104136 3300009101 Bacteria 1818
89 Ga0105241_10035184 3300009174 Bacteria 3767
90 Ga0105248_10013112 3300009177 Bacteria 9127
91 Ga0105248_10135409 3300009177 Bacteria 2779
92 Ga0105248_10214434 3300009177 Bacteria 2168
93 Ga0105248_10267444 3300009177 Bacteria 1925
94 Ga0105237_10042186 3300009545 Bacteria 4602
95 Ga0105249_10119219 3300009553 Bacteria 2506
96 Ga0105147_102399 3300009982 Bacteria 1551
97 Ga0105239_10289965 3300010375 Bacteria 1843
98 Ga0163162_10038532 3300013306 Bacteria 4770
99 Ga0157380_10025945 3300014326 Bacteria 4447
100 Ga0157379_10302822 3300014968 Bacteria 1457
101 Ga0163161_10070251 3300017792 Bacteria 2560
102 Ga0163161_10076097 3300017792 Bacteria 2463
103 Ga0163161_10126852 3300017792 Bacteria 1922
104 Ga0163161_10301500 3300017792 Bacteria 1262
105 Ga0197907_11268009 3300020069 Bacteria 1320
106 Ga0206352_10048708 3300020078 Bacteria 2228
107 Ga0209147_101040 3300025229 Bacteria 11812
108 Ga0209050_1000254 3300025298 Bacteria 114395
109 Ga0207696_1005213 3300025711 Bacteria 5436
110 Ga0207713_1020242 3300025735 Bacteria 3229
111 Ga0207713_1023796 3300025735 Bacteria 2873
112 Ga0207710_10049173 3300025900 Bacteria 1888
113 Ga0207710_10117219 3300025900 Bacteria 1269
114 Ga0207680_10106307 3300025903 Bacteria 1812
115 Ga0207680_10379848 3300025903 Bacteria 996
116 Ga0207671_10332313 3300025914 Bacteria 1204
117 Ga0207681_10000396 3300025923 Bacteria 30438
118 Ga0207681_10000466 3300025923 Bacteria 28366
119 Ga0207681_10042889 3300025923 Bacteria 3025
120 Ga0207681_10064408 3300025923 Bacteria 2531
121 Ga0207681_10144147 3300025923 Bacteria 1777
122 Ga0207681_10220954 3300025923 Bacteria 1466
123 Ga0207650_10039772 3300025925 Bacteria 3438
124 Ga0207644_10000005 3300025931 Bacteria 441948
125 Ga0207644_10004706 3300025931 Bacteria 8866
126 Ga0207644_10303012 3300025931 Bacteria 1288
127 Ga0207644_10322413 3300025931 Bacteria 1249
128 Ga0207711_10132833 3300025941 Bacteria 2233
129 Ga0207711_10239522 3300025941 Bacteria 1663
130 Ga0207711_10498377 3300025941 Bacteria 1135
131 Ga0207661_10195746 3300025944 Bacteria 1775
132 Ga0207668_10000405 3300025972 Bacteria 27108
133 Ga0207668_10004841 3300025972 Bacteria 7925
134 Ga0207658_10000022 3300025986 Bacteria 191235
135 Ga0207658_10001412 3300025986 Bacteria 18717
136 Ga0207658_10505836 3300025986 Bacteria 1076
137 Ga0207703_10142721 3300026035 Bacteria 2080
138 Ga0207639_10000213 3300026041 Bacteria 43227
139 Ga0207678_10000726 3300026067 Bacteria 30104
140 Ga0207678_10024293 3300026067 Bacteria 5294
141 Ga0207702_10006555 3300026078 Bacteria 10016
142 Ga0207641_10000139 3300026088 Bacteria 105740
143 Ga0207641_10007206 3300026088 Bacteria 9270
144 Ga0207641_10207471 3300026088 Bacteria 1810
145 Ga0207698_10185547 3300026142 Bacteria 1847
146 Ga0209281_1006558 3300027111 Bacteria 3026
147 Ga0209983_1014100 3300027665 Bacteria 1646
148 Ga0209813_10000130 3300027866 Bacteria 27121
149 Ga0268266_10001045 3300028379 Bacteria 34723
150 Ga0268266_10292736 3300028379 Bacteria 1517
151 Ga0268265_10007118 3300028380 Bacteria 7551
152 Ga0268265_10058645 3300028380 Bacteria 2940
153 Ga0268265_10775362 3300028380 Bacteria 932
154 Ga0268264_10007971 3300028381 Bacteria 8812
155 Ga0268264_10051357 3300028381 Bacteria 3435
156 Ga0268264_10075845 3300028381 Bacteria 2860
157 Ga0307408_100017392 3300031548 Bacteria 4810
158 Ga0307408_100116074 3300031548 Bacteria 2065
159 Ga0307408_100127409 3300031548 Bacteria 1981
160 Ga0307405_10004719 3300031731 Bacteria 6487
161 Ga0307405_10083831 3300031731 Bacteria 2090
162 Ga0307413_10016637 3300031824 Bacteria 3806
163 Ga0307413_10045892 3300031824 Bacteria 2594
164 Ga0307413_10086761 3300031824 Bacteria 2024
165 Ga0307413_10214572 3300031824 Bacteria 1400
166 Ga0307410_10041387 3300031852 Bacteria 3038
167 Ga0307410_10123520 3300031852 Bacteria 1891
168 Ga0307410_10349257 3300031852 Bacteria 1181
169 Ga0307407_10248486 3300031903 Bacteria 1217
170 Ga0307412_10002795 3300031911 Bacteria 9694
171 Ga0307412_10015867 3300031911 Bacteria 4475
172 Ga0307412_10066423 3300031911 Bacteria 2445
173 Ga0307412_10102786 3300031911 Bacteria 2024
174 Ga0307412_10185580 3300031911 Bacteria 1568
175 Ga0307409_100065768 3300031995 Bacteria 2855
176 Ga0307409_100067288 3300031995 Bacteria 2828
177 Ga0307409_100114106 3300031995 Bacteria 2272
178 Ga0307416_100022242 3300032002 Bacteria 4572
179 Ga0307416_100102324 3300032002 Bacteria 2497
180 Ga0307416_100133028 3300032002 Bacteria 2243
181 Ga0307416_100830008 3300032002 Bacteria 1021
182 Ga0307414_10037492 3300032004 Bacteria 3247
183 Ga0307414_10055061 3300032004 Bacteria 2783
184 Ga0307414_10167884 3300032004 Bacteria 1751
185 Ga0307414_10175376 3300032004 Bacteria 1718
186 Ga0307411_10028636 3300032005 Bacteria 3390
187 Ga0307411_10075103 3300032005 Bacteria 2306
188 Ga0307411_10125118 3300032005 Bacteria 1868
189 Ga0307411_10425444 3300032005 Bacteria 1104
190 Ga0316583_10024115 3300032133 Bacteria 2172
191 Ga0307510_10081928 3300033180 Bacteria 3125
192 Ga0316582_0000702 3300036647 Bacteria 13259
193 Ga0316584_0070576 3300036712 Bacteria 2618
194 Ga0451843_0359110 3300041509 Bacteria 2460
195 Ga0439462_0016750 3300042015 Bacteria 1896
196 Ga0450912_000884 3300042116 Bacteria 1673
197 Ga0450893_0004396 3300042532 Bacteria 2246
198 Ga0495627_000094 3300046453 Bacteria 108256
199 Ga0495627_000229 3300046453 Bacteria 59494
200 Ga0495650_0001141 3300046471 Bacteria 28788
201 Ga0495650_0002187 3300046471 Bacteria 16527
202 Ga0495584_0032545 3300046491 Bacteria 2639
203 Ga0495596_0000040 3300046500 Bacteria 93322
204 Ga0495596_0002926 3300046500 Bacteria 8869
205 Ga0495607_0045785 3300046501 Bacteria 2571
206 Ga0495583_0000242 3300046506 Bacteria 90367
207 Ga0495583_0017977 3300046506 Bacteria 3737
208 Ga0495610_0000031 3300046512 Bacteria 254606
209 Ga0495610_0000043 3300046512 Bacteria 158045
210 Ga0495610_0002409 3300046512 Bacteria 15749
211 Ga0495620_0058056 3300046515 Bacteria 1621
212 Ga0495632_0000048 3300046519 Bacteria 137883
213 Ga0495632_0002003 3300046519 Bacteria 16085
214 Ga0495632_0003294 3300046519 Bacteria 11531
215 Ga0495637_0011804 3300046520 Bacteria 4188
216 Ga0495637_0013488 3300046520 Bacteria 3875
217 Ga0495643_0000030 3300046522 Bacteria 260229
218 Ga0495643_0029436 3300046522 Bacteria 3072
219 Ga0495648_0000023 3300046524 Bacteria 240174
220 Ga0495648_0011851 3300046524 Bacteria 6540
221 Ga0495663_0000003 3300046525 Bacteria 362694
222 Ga0495609_0044833 3300046538 Bacteria 1983
223 Ga0495622_0033798 3300046557 Bacteria 2387
224 Ga0495633_0000184 3300046558 Bacteria 81757
225 Ga0495633_0000211 3300046558 Bacteria 73547
226 Ga0495633_0167191 3300046558 Bacteria 1014
227 Ga0495668_0018888 3300046616 Bacteria 3982
228 Ga0495611_0157351 3300046648 Bacteria 1061
229 Ga0495625_0015725 3300046660 Bacteria 5978
230 Ga0495625_0117667 3300046660 Bacteria 1811
231 Ga0495671_0000012 3300046692 Bacteria 358632
232 Ga0495671_0000043 3300046692 Bacteria 163036
233 Ga0495671_0010652 3300046692 Bacteria 5086
234 Ga0495683_0169358 3300047323 Bacteria 1005
235 Ga0495673_0000029 3300047469 Bacteria 471019
236 Ga0495681_0000025 3300047470 Bacteria 148216
237 Ga0495681_0000060 3300047470 Bacteria 99989
238 Ga0495681_0009643 3300047470 Bacteria 5929
239 Ga0495686_0196455 3300047472 Bacteria 1160
240 Ga0495615_0000184 3300048090 Bacteria 15314
241 Ga0495626_0000139 3300048091 Bacteria 92719
242 Ga0496100_0054748 3300048903 Bacteria 2603
243 Ga0496101_0005721 3300048904 Bacteria 7939
244 Ga0496102_0001062 3300048905 Bacteria 25468
245 Ga0496103_0000439 3300048906 Bacteria 35895
246 Ga0496103_0036243 3300048906 Bacteria 3020
247 Ga0496104_0000078 3300048907 Bacteria 100203
248 Ga0496104_0076852 3300048907 Bacteria 3180
249 Ga0496104_0535796 3300048907 Bacteria 1082
250 Ga0496105_0000243 3300048908 Bacteria 36742
251 Ga0496105_0209694 3300048908 Bacteria 1588
252 Ga0496106_0001368 3300048909 Bacteria 18276
253 Ga0496107_0007002 3300048910 Bacteria 7768
254 Ga0496107_0007805 3300048910 Bacteria 7387
255 Ga0496108_0443829 3300048911 Bacteria 1133
256 Ga0496109_0111693 3300048912 Bacteria 2541
257 Ga0496110_0086040 3300048913 Bacteria 2806
258 Ga0496111_0019064 3300048914 Bacteria 4759
259 Ga0496113_0001346 3300048916 Bacteria 13596
260 Ga0496113_0003385 3300048916 Bacteria 9537
261 Ga0496113_0044945 3300048916 Bacteria 3274
262 Ga0496116_0000045 3300048919 Bacteria 324307
263 Ga0496116_0037890 3300048919 Bacteria 3356
264 Ga0496116_0203512 3300048919 Bacteria 1033
265 Ga0496117_0008536 3300048920 Bacteria 9714
266 Ga0496117_0009462 3300048920 Bacteria 9064
267 Ga0496117_0024081 3300048920 Bacteria 4828
268 Ga0496117_0081762 3300048920 Bacteria 2118
269 Ga0496117_0200036 3300048920 Bacteria 1130
270 Ga0496117_0278971 3300048920 Bacteria 896
271 Ga0496118_0000811 3300048921 Bacteria 49879
272 Ga0496118_0013060 3300048921 Bacteria 7896
273 Ga0496118_0023763 3300048921 Bacteria 5312
274 Ga0496118_0088464 3300048921 Bacteria 2142
275 Ga0496118_0172797 3300048921 Bacteria 1317
276 Ga0496119_0000114 3300048922 Bacteria 114495
277 Ga0496119_0106230 3300048922 Bacteria 1567
278 Ga0496120_0000266 3300048923 Bacteria 87412
279 Ga0496121_0000454 3300048924 Bacteria 80561
280 Ga0496121_0001923 3300048924 Bacteria 33167
281 Ga0496121_0008396 3300048924 Bacteria 12171
282 Ga0496121_0008770 3300048924 Bacteria 11796
283 Ga0496121_0033968 3300048924 Bacteria 4602
284 Ga0496122_0000990 3300048925 Bacteria 50743
285 Ga0496122_0005323 3300048925 Bacteria 15381
286 Ga0496122_0008611 3300048925 Bacteria 10953
287 Ga0496122_0009379 3300048925 Bacteria 10328
288 Ga0496122_0086205 3300048925 Bacteria 2163
289 Ga0496122_0091912 3300048925 Bacteria 2065
290 Ga0496123_0000097 3300048926 Bacteria 173894
291 Ga0496123_0000785 3300048926 Bacteria 51254
292 Ga0496123_0006251 3300048926 Bacteria 11610
293 Ga0496123_0022821 3300048926 Bacteria 4808
294 Ga0496123_0085093 3300048926 Bacteria 1904
295 Ga0496124_0002531 3300048927 Bacteria 23725
296 Ga0496124_0008392 3300048927 Bacteria 10805
297 Ga0496124_0009450 3300048927 Bacteria 10044
298 Ga0496124_0016408 3300048927 Bacteria 7043
299 Ga0496124_0062712 3300048927 Bacteria 3109
300 Ga0496124_0099916 3300048927 Bacteria 2352
301 Ga0496124_0180935 3300048927 Bacteria 1622
302 Ga0496124_0205879 3300048927 Bacteria 1492
303 Ga0496125_0022936 3300048928 Bacteria 5782
304 Ga0496125_0023712 3300048928 Bacteria 5657
305 Ga0496125_0027801 3300048928 Bacteria 5119
306 Ga0496125_0037319 3300048928 Bacteria 4225
307 Ga0496125_0171338 3300048928 Bacteria 1459
308 Ga0496125_0224500 3300048928 Bacteria 1207
309 Ga0496126_0000173 3300048929 Bacteria 146490
310 Ga0496126_0001266 3300048929 Bacteria 40672
311 Ga0496126_0034737 3300048929 Bacteria 4731
312 Ga0496126_0133400 3300048929 Bacteria 2144
313 Ga0501034_0006999 3300049571 Bacteria 12042
314 Ga0501047_0068099 3300049581 Bacteria 3430
315 Ga0501211_001500 3300049658 Bacteria 2498
316 Ga0501223_000010 3300049663 Bacteria 106901
317 Ga0501223_000227 3300049663 Bacteria 14454
318 Ga0501224_000030 3300049664 Bacteria 45775
319 Ga0501233_002383 3300049668 Bacteria 3305
320 Ga0501235_002192 3300049669 Bacteria 4198
321 Ga0501235_002893 3300049669 Bacteria 3700
322 Ga0501235_012428 3300049669 Bacteria 1873
323 Ga0501225_0000008 3300049705 Bacteria 95521
324 Ga0501225_0000009 3300049705 Bacteria 90065
325 Ga0501225_0000114 3300049705 Bacteria 25105
326 Ga0501234_000122 3300049707 Bacteria 10154
327 Ga0501226_000054 3300049853 Bacteria 39689
328 nmdc:mga03683_618_c1 3300050489 Bacteria 10173
329 nmdc:mga00v17_10466_c1 3300050491 Bacteria 5066
330 nmdc:mga00v17_687_c1 3300050491 Bacteria 18636
331 nmdc:mga0yw44_196084_c1 3300050492 Bacteria 1333
332 nmdc:mga0k408_25662_c1 3300050493 Bacteria 3339
333 nmdc:mga04h51_269_c1 3300050495 Bacteria 13325
334 nmdc:mga07m45_90_c1 3300050496 Bacteria 34935
335 nmdc:mga09592_169433_c1 3300050508 Bacteria 1888
336 nmdc:mga0sz30_3672_c1 3300050516 Bacteria 3265
337 nmdc:mga0sz30_6163_c1 3300050516 Bacteria 4441
338 Ga0500643_000137 3300053087 Bacteria 74194
339 Ga0500643_043701 3300053087 Bacteria 1305
340 Ga0500647_0113536 3300053091 Bacteria 1286
341 Ga0500556_0000076 3300053104 Bacteria 95452
342 Ga0500607_003269 3300053121 Bacteria 11966
343 Ga0500608_001356 3300053122 Bacteria 8749
344 Ga0500642_0000001 3300053130 Bacteria 1468402
345 Ga0500559_0001044 3300053136 Bacteria 16941
346 Ga0500559_0002262 3300053136 Bacteria 10172
347 Ga0500559_0043529 3300053136 Bacteria 1961
348 Ga0500564_001664 3300053138 Bacteria 7826
349 Ga0500573_0010815 3300053140 Bacteria 5098
350 Ga0500624_000019 3300053157 Bacteria 125903
351 Ga0500567_002393 3300053723 Bacteria 8026
352 Ga0500645_000625 3300053730 Bacteria 22584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0070576 Ga0316584_0070576_532_1344 220
2 3300053136 Ga0500559_0002262 Ga0500559_0002262_7936_8739 225
3 3300046501 Ga0495607_0045785 Ga0495607_0045785_11_733 231
4 3300005295 Ga0065707_10225821 Ga0065707_102258211 232
5 3300005617 Ga0068859_100183415 Ga0068859_1001834152 232
6 3300006931 Ga0097620_100183409 Ga0097620_1001834092 232
7 3300053122 Ga0500608_001356 Ga0500608_001356_7055_7861 234
8 3300053136 Ga0500559_0043529 Ga0500559_0043529_229_1035 234
9 3300053138 Ga0500564_001664 Ga0500564_001664_5184_5990 234
10 3300053140 Ga0500573_0010815 Ga0500573_0010815_1916_2722 234
11 3300053723 Ga0500567_002393 Ga0500567_002393_2399_3205 234
12 3300048925 Ga0496122_0000990 Ga0496122_0000990_28696_29472 238
13 3300048926 Ga0496123_0000097 Ga0496123_0000097_144413_145189 238
14 3300046557 Ga0495622_0033798 Ga0495622_0033798_77_850 240
15 3300046692 Ga0495671_0010652 Ga0495671_0010652_1551_2324 240
16 3300053104 Ga0500556_0000076 Ga0500556_0000076_39803_40606 240
17 3300031824 Ga0307413_10214572 Ga0307413_102145722 242
18 3300032004 Ga0307414_10167884 Ga0307414_101678842 242
19 3300046616 Ga0495668_0018888 Ga0495668_0018888_224_1027 242
20 3300046660 Ga0495625_0015725 Ga0495625_0015725_845_1648 242
21 3300053730 Ga0500645_000625 Ga0500645_000625_297_1100 242
22 3300053121 Ga0500607_003269 Ga0500607_003269_4736_5542 243
23 3300005347 Ga0070668_100280632 Ga0070668_1002806322 244
24 3300042116 Ga0450912_000884 Ga0450912_000884_767_1648 245
25 3300005544 Ga0070686_100367523 Ga0070686_1003675231 246
26 3300005618 Ga0068864_100019546 Ga0068864_1000195463 246
27 3300005842 Ga0068858_100022675 Ga0068858_1000226754 246
28 3300025900 Ga0207710_10117219 Ga0207710_101172192 246
29 3300032004 Ga0307414_10175376 Ga0307414_101753761 246
30 3300032005 Ga0307411_10125118 Ga0307411_101251183 246
31 3300048906 Ga0496103_0036243 Ga0496103_0036243_42_842 246
32 3300048909 Ga0496106_0001368 Ga0496106_0001368_13823_14623 246
33 3300048910 Ga0496107_0007002 Ga0496107_0007002_3303_4103 246
34 3300048911 Ga0496108_0443829 Ga0496108_0443829_28_828 246
35 3300005353 Ga0070669_100001347 Ga0070669_1000013478 247
36 3300014968 Ga0157379_10302822 Ga0157379_103028221 247
37 3300025923 Ga0207681_10000396 Ga0207681_1000039616 247
38 3300031911 Ga0307412_10015867 Ga0307412_100158674 247
39 3300031995 Ga0307409_100065768 Ga0307409_1000657682 247
40 3300005844 Ga0068862_100003392 Ga0068862_1000033928 248
41 3300009101 Ga0105247_10104136 Ga0105247_101041362 248
42 3300025900 Ga0207710_10049173 Ga0207710_100491732 248
43 3300025923 Ga0207681_10220954 Ga0207681_102209542 248
44 3300028380 Ga0268265_10007118 Ga0268265_100071189 248
45 3300042015 Ga0439462_0016750 Ga0439462_0016750_768_1610 248
46 3300048920 Ga0496117_0200036 Ga0496117_0200036_224_1015 248
47 3300048920 Ga0496117_0278971 Ga0496117_0278971_12_773 248
48 3300005335 Ga0070666_10107859 Ga0070666_101078592 249
49 3300005355 Ga0070671_100000040 Ga0070671_10000004018 249
50 3300005367 Ga0070667_100073279 Ga0070667_1000732792 249
51 3300005841 Ga0068863_100114462 Ga0068863_1001144622 249
52 3300005843 Ga0068860_100017336 Ga0068860_1000173362 249
53 3300025931 Ga0207644_10000005 Ga0207644_10000005364 249
54 3300028379 Ga0268266_10292736 Ga0268266_102927361 249
55 3300028381 Ga0268264_10051357 Ga0268264_100513573 249
56 3300048907 Ga0496104_0076852 Ga0496104_0076852_1776_2576 249
57 3300048908 Ga0496105_0209694 Ga0496105_0209694_189_989 249
58 3300048912 Ga0496109_0111693 Ga0496109_0111693_301_1101 249
59 3300048914 Ga0496111_0019064 Ga0496111_0019064_3519_4319 249
60 3300048916 Ga0496113_0003385 Ga0496113_0003385_3693_4493 249
61 3300053130 Ga0500642_0000001 Ga0500642_0000001_1343866_1344657 249
62 3300005563 Ga0068855_100326567 Ga0068855_1003265672 250
63 3300026067 Ga0207678_10024293 Ga0207678_100242933 250
64 3300046500 Ga0495596_0000040 Ga0495596_0000040_8216_9055 250
65 3300046506 Ga0495583_0017977 Ga0495583_0017977_1252_2091 250
66 3300046522 Ga0495643_0029436 Ga0495643_0029436_2053_2892 250
67 3300046538 Ga0495609_0044833 Ga0495609_0044833_606_1445 250
68 3300046660 Ga0495625_0117667 Ga0495625_0117667_677_1516 250
69 3300047472 Ga0495686_0196455 Ga0495686_0196455_138_977 250
70 iso_pu_bacteria 2512564014 2512644564 250
71 iso_pu_bacteria 2808606401 2809062466 250
72 iso_pu_bacteria 2808606404 2809078194 250
73 iso_pu_bacteria 2808606405 2809082855 250
74 iso_pu_bacteria 2880518877 2880522273 250
75 iso_pu_bacteria 2919709256 2919709755 250
76 iso_pu_bacteria 3000865235 3000866609 250
77 3300005335 Ga0070666_10017017 Ga0070666_100170173 251
78 3300005347 Ga0070668_100005555 Ga0070668_10000555510 251
79 3300005347 Ga0070668_100222103 Ga0070668_1002221032 251
80 3300005353 Ga0070669_100082955 Ga0070669_1000829553 251
81 3300005367 Ga0070667_100000024 Ga0070667_100000024175 251
82 3300005841 Ga0068863_100000082 Ga0068863_10000008299 251
83 3300005843 Ga0068860_100001415 Ga0068860_1000014156 251
84 3300009177 Ga0105248_10267444 Ga0105248_102674443 251
85 3300025923 Ga0207681_10144147 Ga0207681_101441473 251
86 3300025941 Ga0207711_10498377 Ga0207711_104983771 251
87 3300025972 Ga0207668_10000405 Ga0207668_100004058 251
88 3300025986 Ga0207658_10000022 Ga0207658_100000226 251
89 3300026088 Ga0207641_10000139 Ga0207641_100001396 251
90 3300028381 Ga0268264_10007971 Ga0268264_1000797110 251
91 3300046471 Ga0495650_0001141 Ga0495650_0001141_10925_11707 251
92 3300048927 Ga0496124_0062712 Ga0496124_0062712_1283_2065 251
93 3300048928 Ga0496125_0022936 Ga0496125_0022936_87_869 251
94 2162886007 SwRhRL2b_contig_834655 SwRhRL2b_0826.00004260 252
95 3300002067 JGI24735J21928_10004453 JGI24735J21928_100044537 252
96 3300002075 JGI24738J21930_10001980 JGI24738J21930_100019808 252
97 3300005289 Ga0065704_10001076 Ga0065704_1000107614 252
98 3300005289 Ga0065704_10071428 Ga0065704_100714284 252
99 3300005289 Ga0065704_10212214 Ga0065704_102122141 252
100 3300005295 Ga0065707_10210048 Ga0065707_102100481 252
101 3300005329 Ga0070683_100298255 Ga0070683_1002982553 252
102 3300005331 Ga0070670_100080264 Ga0070670_1000802644 252
103 3300005339 Ga0070660_100020688 Ga0070660_1000206881 252
104 3300005344 Ga0070661_100274912 Ga0070661_1002749122 252
105 3300005347 Ga0070668_100018876 Ga0070668_1000188768 252
106 3300005353 Ga0070669_100012657 Ga0070669_1000126576 252
107 3300005355 Ga0070671_100086743 Ga0070671_1000867434 252
108 3300005466 Ga0070685_10081900 Ga0070685_100819002 252
109 3300005563 Ga0068855_100206251 Ga0068855_1002062514 252
110 3300005614 Ga0068856_100021889 Ga0068856_1000218895 252
111 3300005618 Ga0068864_100371245 Ga0068864_1003712452 252
112 3300005834 Ga0068851_10234512 Ga0068851_102345121 252
113 3300009011 Ga0105251_10016546 Ga0105251_100165463 252
114 3300009174 Ga0105241_10035184 Ga0105241_100351845 252
115 3300009545 Ga0105237_10042186 Ga0105237_100421865 252
116 3300009982 Ga0105147_102399 Ga0105147_1023992 252
117 3300010375 Ga0105239_10289965 Ga0105239_102899652 252
118 3300014326 Ga0157380_10025945 Ga0157380_100259456 252
119 3300017792 Ga0163161_10076097 Ga0163161_100760974 252
120 3300020069 Ga0197907_11268009 Ga0197907_112680092 252
121 3300020078 Ga0206352_10048708 Ga0206352_100487082 252
122 3300025914 Ga0207671_10332313 Ga0207671_103323132 252
123 3300025923 Ga0207681_10042889 Ga0207681_100428895 252
124 3300025925 Ga0207650_10039772 Ga0207650_100397724 252
125 3300025931 Ga0207644_10322413 Ga0207644_103224131 252
126 3300025944 Ga0207661_10195746 Ga0207661_101957462 252
127 3300026041 Ga0207639_10000213 Ga0207639_1000021329 252
128 3300026067 Ga0207678_10000726 Ga0207678_1000072621 252
129 3300026078 Ga0207702_10006555 Ga0207702_100065553 252
130 3300026142 Ga0207698_10185547 Ga0207698_101855472 252
131 3300031548 Ga0307408_100017392 Ga0307408_1000173926 252
132 3300031731 Ga0307405_10083831 Ga0307405_100838313 252
133 3300031824 Ga0307413_10045892 Ga0307413_100458924 252
134 3300031852 Ga0307410_10349257 Ga0307410_103492572 252
135 3300031911 Ga0307412_10185580 Ga0307412_101855802 252
136 3300032002 Ga0307416_100830008 Ga0307416_1008300081 252
137 3300032004 Ga0307414_10055061 Ga0307414_100550614 252
138 3300032005 Ga0307411_10075103 Ga0307411_100751033 252
139 3300046648 Ga0495611_0157351 Ga0495611_0157351_264_1046 252
140 3300048907 Ga0496104_0535796 Ga0496104_0535796_136_930 252
141 3300048913 Ga0496110_0086040 Ga0496110_0086040_1439_2224 252
142 3300048916 Ga0496113_0044945 Ga0496113_0044945_1329_2114 252
143 3300048924 Ga0496121_0000454 Ga0496121_0000454_68010_68795 252
144 3300048926 Ga0496123_0085093 Ga0496123_0085093_348_1133 252
145 3300048927 Ga0496124_0016408 Ga0496124_0016408_975_1760 252
146 3300048927 Ga0496124_0099916 Ga0496124_0099916_1385_2170 252
147 3300048928 Ga0496125_0023712 Ga0496125_0023712_2657_3442 252
148 3300048929 Ga0496126_0034737 Ga0496126_0034737_2772_3557 252
149 3300048929 Ga0496126_0133400 Ga0496126_0133400_721_1506 252
150 3300049658 Ga0501211_001500 Ga0501211_001500_118_903 252
151 3300049663 Ga0501223_000010 Ga0501223_000010_71368_72153 252
152 3300049669 Ga0501235_002192 Ga0501235_002192_3357_4142 252
153 3300049669 Ga0501235_012428 Ga0501235_012428_424_1209 252
154 3300049705 Ga0501225_0000008 Ga0501225_0000008_59737_60522 252
155 3300049705 Ga0501225_0000114 Ga0501225_0000114_21628_22413 252
156 3300053087 Ga0500643_000137 Ga0500643_000137_32348_33130 252
157 3300053087 Ga0500643_043701 Ga0500643_043701_187_960 252
158 3300053091 Ga0500647_0113536 Ga0500647_0113536_479_1264 252
159 3300053136 Ga0500559_0001044 Ga0500559_0001044_1126_1908 252
160 3300005347 Ga0070668_100039704 Ga0070668_1000397045 253
161 3300005355 Ga0070671_100272293 Ga0070671_1002722932 253
162 3300005367 Ga0070667_100031758 Ga0070667_1000317585 253
163 3300005548 Ga0070665_100000878 Ga0070665_10000087823 253
164 3300005842 Ga0068858_100100204 Ga0068858_1001002045 253
165 3300005843 Ga0068860_100103659 Ga0068860_1001036591 253
166 3300005844 Ga0068862_100005835 Ga0068862_10000583512 253
167 3300005844 Ga0068862_100067316 Ga0068862_1000673163 253
168 3300009101 Ga0105247_10033849 Ga0105247_100338494 253
169 3300009177 Ga0105248_10214434 Ga0105248_102144342 253
170 3300025923 Ga0207681_10064408 Ga0207681_100644082 253
171 3300025931 Ga0207644_10303012 Ga0207644_103030122 253
172 3300025972 Ga0207668_10004841 Ga0207668_100048413 253
173 3300025986 Ga0207658_10505836 Ga0207658_105058362 253
174 3300026088 Ga0207641_10007206 Ga0207641_100072063 253
175 3300028379 Ga0268266_10001045 Ga0268266_1000104520 253
176 3300028380 Ga0268265_10058645 Ga0268265_100586452 253
177 3300031731 Ga0307405_10004719 Ga0307405_100047194 253
178 3300031911 Ga0307412_10002795 Ga0307412_100027954 253
179 3300032002 Ga0307416_100102324 Ga0307416_1001023244 253
180 3300032005 Ga0307411_10425444 Ga0307411_104254442 253
181 3300048920 Ga0496117_0009462 Ga0496117_0009462_4308_5084 253
182 3300048920 Ga0496117_0081762 Ga0496117_0081762_370_1170 253
183 3300048921 Ga0496118_0000811 Ga0496118_0000811_30171_30947 253
184 3300048921 Ga0496118_0172797 Ga0496118_0172797_280_1080 253
185 3300048924 Ga0496121_0033968 Ga0496121_0033968_2223_2999 253
186 3300048927 Ga0496124_0180935 Ga0496124_0180935_585_1385 253
187 3300048927 Ga0496124_0205879 Ga0496124_0205879_46_846 253
188 3300002459 JGI24751J29686_10000133 JGI24751J29686_1000013347 254
189 3300005842 Ga0068858_100176473 Ga0068858_1001764733 254
190 3300013306 Ga0163162_10038532 Ga0163162_100385325 254
191 3300017792 Ga0163161_10126852 Ga0163161_101268522 254
192 3300017792 Ga0163161_10301500 Ga0163161_103015002 254
193 3300025229 Ga0209147_101040 Ga0209147_10104013 254
194 3300026035 Ga0207703_10142721 Ga0207703_101427213 254
195 3300031548 Ga0307408_100116074 Ga0307408_1001160743 254
196 3300031824 Ga0307413_10016637 Ga0307413_100166373 254
197 3300031852 Ga0307410_10041387 Ga0307410_100413873 254
198 3300031911 Ga0307412_10066423 Ga0307412_100664233 254
199 3300031995 Ga0307409_100114106 Ga0307409_1001141065 254
200 3300032002 Ga0307416_100022242 Ga0307416_1000222422 254
201 3300046453 Ga0495627_000094 Ga0495627_000094_13324_14112 254
202 3300046453 Ga0495627_000229 Ga0495627_000229_31818_32597 254
203 3300046491 Ga0495584_0032545 Ga0495584_0032545_1282_2061 254
204 3300046512 Ga0495610_0000043 Ga0495610_0000043_113373_114152 254
205 3300046519 Ga0495632_0000048 Ga0495632_0000048_99051_99830 254
206 3300046520 Ga0495637_0011804 Ga0495637_0011804_3274_4053 254
207 3300046520 Ga0495637_0013488 Ga0495637_0013488_1038_1817 254
208 3300046522 Ga0495643_0000030 Ga0495643_0000030_108434_109213 254
209 3300046524 Ga0495648_0011851 Ga0495648_0011851_2050_2838 254
210 3300046525 Ga0495663_0000003 Ga0495663_0000003_281503_282282 254
211 3300046558 Ga0495633_0000184 Ga0495633_0000184_75764_76543 254
212 3300046558 Ga0495633_0000211 Ga0495633_0000211_14123_14902 254
213 3300046692 Ga0495671_0000043 Ga0495671_0000043_108434_109213 254
214 3300047470 Ga0495681_0000025 Ga0495681_0000025_34098_34877 254
215 3300047470 Ga0495681_0009643 Ga0495681_0009643_1712_2491 254
216 3300048919 Ga0496116_0037890 Ga0496116_0037890_530_1309 254
217 3300048920 Ga0496117_0024081 Ga0496117_0024081_414_1193 254
218 3300048921 Ga0496118_0023763 Ga0496118_0023763_4244_5023 254
219 3300048922 Ga0496119_0106230 Ga0496119_0106230_607_1386 254
220 3300048925 Ga0496122_0086205 Ga0496122_0086205_570_1349 254
221 3300048928 Ga0496125_0224500 Ga0496125_0224500_320_1099 254
222 3300049571 Ga0501034_0006999 Ga0501034_0006999_9229_10011 254
223 3300049663 Ga0501223_000227 Ga0501223_000227_10376_11158 254
224 3300049664 Ga0501224_000030 Ga0501224_000030_17722_18504 254
225 3300049668 Ga0501233_002383 Ga0501233_002383_2495_3277 254
226 3300049669 Ga0501235_002893 Ga0501235_002893_2854_3636 254
227 3300049705 Ga0501225_0000009 Ga0501225_0000009_24099_24881 254
228 3300049707 Ga0501234_000122 Ga0501234_000122_81_863 254
229 3300049853 Ga0501226_000054 Ga0501226_000054_11651_12433 254
230 3300005347 Ga0070668_100003099 Ga0070668_1000030993 255
231 3300005355 Ga0070671_100018351 Ga0070671_1000183512 255
232 3300005841 Ga0068863_100116088 Ga0068863_1001160882 255
233 3300009092 Ga0105250_10078083 Ga0105250_100780832 255
234 3300009553 Ga0105249_10119219 Ga0105249_101192192 255
235 3300025711 Ga0207696_1005213 Ga0207696_10052134 255
236 3300025735 Ga0207713_1023796 Ga0207713_10237964 255
237 3300025931 Ga0207644_10004706 Ga0207644_100047069 255
238 3300026088 Ga0207641_10207471 Ga0207641_102074712 255
239 3300028380 Ga0268265_10775362 Ga0268265_107753621 255
240 3300046506 Ga0495583_0000242 Ga0495583_0000242_12054_12845 255
241 3300046519 Ga0495632_0003294 Ga0495632_0003294_5316_6107 255
242 3300046524 Ga0495648_0000023 Ga0495648_0000023_55765_56556 255
243 3300046558 Ga0495633_0167191 Ga0495633_0167191_165_956 255
244 3300046692 Ga0495671_0000012 Ga0495671_0000012_173949_174740 255
245 3300047469 Ga0495673_0000029 Ga0495673_0000029_183893_184684 255
246 3300048904 Ga0496101_0005721 Ga0496101_0005721_4382_5221 255
247 3300048905 Ga0496102_0001062 Ga0496102_0001062_7763_8602 255
248 3300048906 Ga0496103_0000439 Ga0496103_0000439_26951_27790 255
249 3300048916 Ga0496113_0001346 Ga0496113_0001346_6055_6894 255
250 3300048920 Ga0496117_0008536 Ga0496117_0008536_7970_8809 255
251 3300048921 Ga0496118_0013060 Ga0496118_0013060_152_991 255
252 3300048927 Ga0496124_0002531 Ga0496124_0002531_2169_3008 255
253 3300050508 nmdc:mga09592_169433_c1 nmdc:mga09592_169433_c1_15_806 255
254 2162886007 SwRhRL2b_contig_3033499 SwRhRL2b_0513.00001940 256
255 3300005289 Ga0065704_10070689 Ga0065704_100706899 256
256 3300005335 Ga0070666_10031647 Ga0070666_100316473 256
257 3300005353 Ga0070669_100009151 Ga0070669_1000091514 256
258 3300005367 Ga0070667_100006505 Ga0070667_1000065056 256
259 3300005843 Ga0068860_100231874 Ga0068860_1002318741 256
260 3300009177 Ga0105248_10013112 Ga0105248_100131122 256
261 3300025903 Ga0207680_10106307 Ga0207680_101063073 256
262 3300025923 Ga0207681_10000466 Ga0207681_1000046623 256
263 3300025941 Ga0207711_10239522 Ga0207711_102395222 256
264 3300025986 Ga0207658_10001412 Ga0207658_100014126 256
265 3300048903 Ga0496100_0054748 Ga0496100_0054748_445_1284 256
266 3300048907 Ga0496104_0000078 Ga0496104_0000078_32690_33529 256
267 3300048908 Ga0496105_0000243 Ga0496105_0000243_25477_26316 256
268 3300048910 Ga0496107_0007805 Ga0496107_0007805_1880_2719 256
269 3300048919 Ga0496116_0203512 Ga0496116_0203512_103_942 256
270 3300048922 Ga0496119_0000114 Ga0496119_0000114_32690_33529 256
271 3300048923 Ga0496120_0000266 Ga0496120_0000266_65964_66803 256
272 3300048924 Ga0496121_0008396 Ga0496121_0008396_9486_10325 256
273 3300048925 Ga0496122_0009379 Ga0496122_0009379_848_1687 256
274 3300048926 Ga0496123_0022821 Ga0496123_0022821_1229_2068 256
275 3300048928 Ga0496125_0037319 Ga0496125_0037319_848_1687 256
276 3300048929 Ga0496126_0000173 Ga0496126_0000173_105872_106711 256
277 iso_pu_bacteria 2896253425 2896254534 256
278 3300006051 Ga0075364_10001169 Ga0075364_1000116915 257
279 3300042532 Ga0450893_0004396 Ga0450893_0004396_93_935 257
280 3300050491 nmdc:mga00v17_687_c1 nmdc:mga00v17_687_c1_6092_6907 257
281 3300050516 nmdc:mga0sz30_3672_c1 nmdc:mga0sz30_3672_c1_2044_2859 257
282 3300053157 Ga0500624_000019 Ga0500624_000019_57116_57916 257
283 3300005539 Ga0068853_100507425 Ga0068853_1005074251 258
284 3300041509 Ga0451843_0359110 Ga0451843_0359110_595_1464 258
285 3300005331 Ga0070670_100040569 Ga0070670_1000405692 259
286 3300005335 Ga0070666_10052475 Ga0070666_100524753 259
287 3300005347 Ga0070668_100005243 Ga0070668_1000052434 259
288 3300005353 Ga0070669_100001489 Ga0070669_10000148910 259
289 3300005355 Ga0070671_100001709 Ga0070671_10000170913 259
290 3300006353 Ga0075370_10224453 Ga0075370_102244532 259
291 3300009177 Ga0105248_10135409 Ga0105248_101354094 259
292 3300025735 Ga0207713_1020242 Ga0207713_10202422 259
293 3300025903 Ga0207680_10379848 Ga0207680_103798482 259
294 3300025941 Ga0207711_10132833 Ga0207711_101328332 259
295 3300048924 Ga0496121_0008770 Ga0496121_0008770_8386_9186 259
296 3300048925 Ga0496122_0091912 Ga0496122_0091912_960_1760 259
297 3300006042 Ga0075368_10014325 Ga0075368_100143253 260
298 3300006048 Ga0075363_100007669 Ga0075363_1000076694 260
299 3300006051 Ga0075364_10029730 Ga0075364_100297303 260
300 3300006177 Ga0075362_10001050 Ga0075362_100010506 260
301 3300006178 Ga0075367_10003424 Ga0075367_100034246 260
302 3300006186 Ga0075369_10001773 Ga0075369_100017736 260
303 3300006195 Ga0075366_10014456 Ga0075366_100144566 260
304 3300006353 Ga0075370_10012833 Ga0075370_100128336 260
305 3300017792 Ga0163161_10070251 Ga0163161_100702512 260
306 3300027866 Ga0209813_10000130 Ga0209813_1000013015 260
307 3300033180 Ga0307510_10081928 Ga0307510_100819282 260
308 3300048928 Ga0496125_0171338 Ga0496125_0171338_507_1307 260
309 3300050489 nmdc:mga03683_618_c1 nmdc:mga03683_618_c1_4222_5019 260
310 3300050491 nmdc:mga00v17_10466_c1 nmdc:mga00v17_10466_c1_956_1753 260
311 3300050492 nmdc:mga0yw44_196084_c1 nmdc:mga0yw44_196084_c1_505_1302 260
312 3300050493 nmdc:mga0k408_25662_c1 nmdc:mga0k408_25662_c1_119_916 260
313 3300050495 nmdc:mga04h51_269_c1 nmdc:mga04h51_269_c1_32_829 260
314 3300050496 nmdc:mga07m45_90_c1 nmdc:mga07m45_90_c1_12282_13079 260
315 3300050516 nmdc:mga0sz30_6163_c1 nmdc:mga0sz30_6163_c1_685_1482 260
316 3300005843 Ga0068860_100144751 Ga0068860_1001447513 261
317 3300027665 Ga0209983_1014100 Ga0209983_10141002 261
318 3300028381 Ga0268264_10075845 Ga0268264_100758454 261
319 3300031548 Ga0307408_100127409 Ga0307408_1001274092 261
320 3300031824 Ga0307413_10086761 Ga0307413_100867612 261
321 3300031852 Ga0307410_10123520 Ga0307410_101235202 261
322 3300031903 Ga0307407_10248486 Ga0307407_102484862 261
323 3300031911 Ga0307412_10102786 Ga0307412_101027862 261
324 3300031995 Ga0307409_100067288 Ga0307409_1000672883 261
325 3300032002 Ga0307416_100133028 Ga0307416_1001330283 261
326 3300032004 Ga0307414_10037492 Ga0307414_100374923 261
327 3300032005 Ga0307411_10028636 Ga0307411_100286363 261
328 3300032133 Ga0316583_10024115 Ga0316583_100241152 261
329 3300036647 Ga0316582_0000702 Ga0316582_0000702_3019_3834 261
330 3300005295 Ga0065707_10223265 Ga0065707_102232652 262
331 3300027111 Ga0209281_1006558 Ga0209281_10065584 262
332 3300049581 Ga0501047_0068099 Ga0501047_0068099_1874_2686 262
333 iso_pu_bacteria 2738541275 2738711637 262
334 iso_pu_bacteria 2738541301 2738850062 262
335 iso_pu_bacteria 2738541304 2738865791 262
336 iso_pu_bacteria 2738543022 2739298309 262
337 iso_pu_bacteria 2738543033 2739359987 262
338 iso_pu_bacteria 2928100450 2928103790 262
339 iso_pu_bacteria 2928959182 2928961718 262
340 3300005289 Ga0065704_10198212 Ga0065704_101982121 263
341 iso_pu_bacteria 2818991438 2819551360 263
342 3300002239 JGI24034J26672_10004353 JGI24034J26672_100043532 264
343 iso_pu_bacteria 2643221588 2643950375 264
344 3300003791 Ga0055530_10012705 Ga0055530_100127053 266
345 3300009092 Ga0105250_10133799 Ga0105250_101337991 266
346 3300025298 Ga0209050_1000254 Ga0209050_100025482 266
347 3300048919 Ga0496116_0000045 Ga0496116_0000045_240179_240997 266
348 3300048921 Ga0496118_0088464 Ga0496118_0088464_113_931 266
349 3300048924 Ga0496121_0001923 Ga0496121_0001923_17828_18646 266
350 3300048925 Ga0496122_0008611 Ga0496122_0008611_3808_4626 266
351 3300048926 Ga0496123_0000785 Ga0496123_0000785_34038_34856 266
352 3300048927 Ga0496124_0008392 Ga0496124_0008392_5462_6280 266
353 3300048927 Ga0496124_0009450 Ga0496124_0009450_7897_8715 266
354 3300048928 Ga0496125_0027801 Ga0496125_0027801_2623_3441 266
355 3300048929 Ga0496126_0001266 Ga0496126_0001266_27728_28546 266
356 iso_pu_bacteria 2510917021 2511129289 266
357 iso_pu_bacteria 8054302542 8054307432 266
358 3300046500 Ga0495596_0002926 Ga0495596_0002926_760_1581 267
359 3300046512 Ga0495610_0002409 Ga0495610_0002409_722_1543 267
360 3300048091 Ga0495626_0000139 Ga0495626_0000139_31211_32032 267
361 2162886007 SwRhRL2b_contig_1588125 SwRhRL2b_0540.00000810 269
362 3300005289 Ga0065704_10000204 Ga0065704_10000204216 269
363 3300046471 Ga0495650_0002187 Ga0495650_0002187_6408_7238 269
364 3300046512 Ga0495610_0000031 Ga0495610_0000031_166811_167641 269
365 3300046515 Ga0495620_0058056 Ga0495620_0058056_437_1267 269
366 3300046519 Ga0495632_0002003 Ga0495632_0002003_6410_7240 269
367 3300047323 Ga0495683_0169358 Ga0495683_0169358_133_963 269
368 3300047470 Ga0495681_0000060 Ga0495681_0000060_68856_69686 269
369 3300048090 Ga0495615_0000184 Ga0495615_0000184_10964_11794 269
370 3300048925 Ga0496122_0005323 Ga0496122_0005323_11040_11870 269
371 3300048926 Ga0496123_0006251 Ga0496123_0006251_3593_4423 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

16

231

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.6147 18 238
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.6062 18 241
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.6029 18 238
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.5947 18 241
5ohe-assembly4.cif.gz_G globin sensor domain of afgchk (feiii form) in complex with cyanide 0.3481 89 243
ID Description Score Start End Superfamily
af_Q8N755_102_198_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4873 153 245 1.20.1280.290
af_Q8C6U2_90_202_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4605 131 249 1.20.1280.290
af_Q8N755_102_198_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4587 153 245 1.20.1280.290
af_Q8C6U2_90_202_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4449 131 249 1.20.1280.290
af_I1LMQ8_37_182_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4435 118 254 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2E3NY47-F1-model_v4 Twin-arginine translocase subunit TatC 0.9337 151 241 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A352HAH8-F1-model_v4 deleted 0.9035 109 259
AF-A0A2E3NY47-F1-model_v4 Twin-arginine translocase subunit TatC 0.8958 151 241 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A352HAH8-F1-model_v4 deleted 0.887 109 259
AF-A0A2E6NQB0-F1-model_v4 Twin-arginine translocase subunit TatC 0.8768 118 255 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Feature Viewer

pLDDT pTM Quality
67.83 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map