F425574

General Info

Members Datasets Scaffolds Average Seq Length
370 191 368 163

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_13_c1|nmdc:mga03683_13_c1_17068_17661
Length 197
Sequence MEAESIPRLASYAWIAGLYCPIILPDCIEGEPMSEFAALPYRPCVGVMLVNTQGQVFVGKRIDTRGQPSEGGDFWQMPQGGVDPGEDLEAAAYRELAEETGIAANLVAMIARTREELFYDLPDDLLGKLWGGKWRGQRQHWYLARFAGSDADVRLDAHDPAEFEDWRWVQPELLPDLIVPFKTRVYRSVLEEFRDLI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
3 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
102 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
176 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
177 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
181 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
182 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
189 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
190 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.95
Nodule 0.27
Rhizoplane 10
Rhizosphere 60.81
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2799799 2162886007 Bacteria 27953
2 SwRhRL2b_contig_533662 2162886007 Bacteria 10916
3 SwRhRL2b_contig_809626 2162886007 Bacteria 891
4 JGI24751J29686_10000242 3300002459 Bacteria 21927
5 Ga0055530_10011167 3300003791 Bacteria 3251
6 Ga0065704_10000280 3300005289 Bacteria 50510
7 Ga0065704_10115408 3300005289 Bacteria 1872
8 Ga0065704_10117616 3300005289 Bacteria 1831
9 Ga0065707_10086495 3300005295 Bacteria 5432
10 Ga0070658_10000351 3300005327 Bacteria 39857
11 Ga0070658_10022038 3300005327 Bacteria 5110
12 Ga0070658_10033854 3300005327 Bacteria 4111
13 Ga0070658_10048440 3300005327 Bacteria 3441
14 Ga0070658_10158654 3300005327 Bacteria 1897
15 Ga0070683_100039496 3300005329 Bacteria 4333
16 Ga0070683_100284928 3300005329 Bacteria 1572
17 Ga0070670_100093528 3300005331 Bacteria 2586
18 Ga0070680_100010360 3300005336 Bacteria 7186
19 Ga0070660_100004861 3300005339 Bacteria 9282
20 Ga0070660_100009476 3300005339 Bacteria 6851
21 Ga0070691_10335130 3300005341 Bacteria 836
22 Ga0070661_100024929 3300005344 Bacteria 4294
23 Ga0070668_100092165 3300005347 Bacteria 2389
24 Ga0070668_100963238 3300005347 Bacteria 765
25 Ga0070669_100000471 3300005353 Bacteria 30589
26 Ga0070669_100000661 3300005353 Bacteria 25473
27 Ga0070669_100029006 3300005353 Bacteria 3988
28 Ga0070671_100000050 3300005355 Bacteria 80843
29 Ga0070671_100001477 3300005355 Bacteria 17556
30 Ga0070671_100007392 3300005355 Bacteria 8777
31 Ga0070671_100130905 3300005355 Bacteria 2113
32 Ga0070659_100011764 3300005366 Bacteria 6475
33 Ga0070659_100539457 3300005366 Bacteria 998
34 Ga0070667_100012088 3300005367 Bacteria 7147
35 Ga0070667_100012789 3300005367 Bacteria 6935
36 Ga0070667_100015251 3300005367 Bacteria 6352
37 Ga0070667_100048374 3300005367 Bacteria 3579
38 Ga0070667_100075271 3300005367 Bacteria 2882
39 Ga0070663_100333169 3300005455 Bacteria 1224
40 Ga0070662_100001132 3300005457 Bacteria 16299
41 Ga0070681_10006109 3300005458 Bacteria 11687
42 Ga0070679_100025746 3300005530 Bacteria 5773
43 Ga0070679_100264388 3300005530 Bacteria 1675
44 Ga0068853_100095206 3300005539 Bacteria 2625
45 Ga0070665_100000634 3300005548 Bacteria 47873
46 Ga0070665_100004137 3300005548 Bacteria 15260
47 Ga0070665_100011778 3300005548 Bacteria 8833
48 Ga0070665_100168668 3300005548 Bacteria 2191
49 Ga0068855_100066663 3300005563 Bacteria 4197
50 Ga0070664_100146492 3300005564 Bacteria 2083
51 Ga0068857_100219862 3300005577 Bacteria 1735
52 Ga0068857_100966921 3300005577 Bacteria 819
53 Ga0068854_100007709 3300005578 Bacteria 6883
54 Ga0068854_100019468 3300005578 Bacteria 4575
55 Ga0068856_100000870 3300005614 Bacteria 32355
56 Ga0068856_100434391 3300005614 Bacteria 1333
57 Ga0068852_100000075 3300005616 Bacteria 69379
58 Ga0068852_100116855 3300005616 Bacteria 2435
59 Ga0068852_100364601 3300005616 Bacteria 1414
60 Ga0068859_100014962 3300005617 Bacteria 7787
61 Ga0068864_100045159 3300005618 Bacteria 3779
62 Ga0068851_10286934 3300005834 Bacteria 943
63 Ga0068863_100000052 3300005841 Bacteria 125430
64 Ga0068863_100172062 3300005841 Bacteria 2078
65 Ga0068863_100221215 3300005841 Bacteria 1824
66 Ga0068858_100005063 3300005842 Bacteria 12920
67 Ga0068858_100017450 3300005842 Bacteria 6733
68 Ga0068858_100049007 3300005842 Bacteria 3912
69 Ga0068858_100817447 3300005842 Bacteria 909
70 Ga0068860_100000007 3300005843 Bacteria 429329
71 Ga0068860_100004218 3300005843 Bacteria 14732
72 Ga0068860_100005984 3300005843 Bacteria 12245
73 Ga0068860_100023975 3300005843 Bacteria 5898
74 Ga0068860_100247845 3300005843 Bacteria 1734
75 Ga0068862_100002760 3300005844 Bacteria 15388
76 Ga0068862_100019812 3300005844 Bacteria 5618
77 Ga0068862_100199758 3300005844 Bacteria 1802
78 Ga0075363_100011794 3300006048 Bacteria 4194
79 Ga0075364_10053039 3300006051 Bacteria 2650
80 Ga0075364_10485914 3300006051 Bacteria 844
81 Ga0075432_10005555 3300006058 Bacteria 4294
82 Ga0075362_10000083 3300006177 Bacteria 26049
83 Ga0075362_10000203 3300006177 Bacteria 16577
84 Ga0075367_10002111 3300006178 Bacteria 8929
85 Ga0075367_10089709 3300006178 Bacteria 1869
86 Ga0075369_10001615 3300006186 Bacteria 7755
87 Ga0075366_10001643 3300006195 Bacteria 11223
88 Ga0075366_10002219 3300006195 Bacteria 9909
89 Ga0075370_10000017 3300006353 Bacteria 60451
90 Ga0075370_10003828 3300006353 Bacteria 7195
91 Ga0097620_100014961 3300006931 Bacteria 7787
92 Ga0097620_100456873 3300006931 Bacteria 1373
93 Ga0075435_100339274 3300007076 Bacteria 1287
94 Ga0105251_10003099 3300009011 Bacteria 12358
95 Ga0105250_10009921 3300009092 Bacteria 3995
96 Ga0105240_10554979 3300009093 Bacteria 1270
97 Ga0105247_10296183 3300009101 Bacteria 1121
98 Ga0105243_10181209 3300009148 Bacteria 1832
99 Ga0105241_10249858 3300009174 Bacteria 1503
100 Ga0105248_10009214 3300009177 Bacteria 10858
101 Ga0105248_10026196 3300009177 Bacteria 6487
102 Ga0105248_10269156 3300009177 Bacteria 1918
103 Ga0105248_10279980 3300009177 Bacteria 1878
104 Ga0105248_10410026 3300009177 Bacteria 1526
105 Ga0105238_10104693 3300009551 Bacteria 2811
106 Ga0105249_10220640 3300009553 Bacteria 1865
107 Ga0105249_10553526 3300009553 Bacteria 1201
108 Ga0105239_10520011 3300010375 Bacteria 1354
109 Ga0157373_10395696 3300013100 Bacteria 990
110 Ga0157371_10008544 3300013102 Bacteria 8153
111 Ga0157371_10117183 3300013102 Bacteria 1893
112 Ga0157370_10165842 3300013104 Bacteria 2054
113 Ga0157370_10522890 3300013104 Bacteria 1089
114 Ga0157369_10021737 3300013105 Bacteria 7175
115 Ga0163162_10018885 3300013306 Bacteria 6760
116 Ga0163162_10077086 3300013306 Bacteria 3397
117 Ga0163162_11662261 3300013306 Bacteria 729
118 Ga0157372_10016641 3300013307 Bacteria 7893
119 Ga0163163_10329176 3300014325 Bacteria 1582
120 Ga0157380_10012133 3300014326 Bacteria 6238
121 Ga0209050_1000929 3300025298 Bacteria 38383
122 Ga0207696_1009107 3300025711 Bacteria 3720
123 Ga0207713_1007781 3300025735 Bacteria 6256
124 Ga0207680_10017405 3300025903 Bacteria 3797
125 Ga0207647_10007669 3300025904 Bacteria 7776
126 Ga0207647_10175356 3300025904 Bacteria 1247
127 Ga0207705_10000075 3300025909 Bacteria 123551
128 Ga0207705_10001684 3300025909 Bacteria 17584
129 Ga0207705_10007168 3300025909 Bacteria 8213
130 Ga0207705_10017514 3300025909 Bacteria 5129
131 Ga0207705_10238446 3300025909 Bacteria 1385
132 Ga0207654_10201656 3300025911 Bacteria 1310
133 Ga0207707_10189102 3300025912 Bacteria 1796
134 Ga0207695_10104094 3300025913 Bacteria 2828
135 Ga0207695_10461942 3300025913 Bacteria 1152
136 Ga0207660_10012251 3300025917 Bacteria 5605
137 Ga0207662_10415858 3300025918 Bacteria 914
138 Ga0207657_10000538 3300025919 Bacteria 40382
139 Ga0207657_10008726 3300025919 Bacteria 10259
140 Ga0207649_10016285 3300025920 Bacteria 4188
141 Ga0207652_10130121 3300025921 Bacteria 2244
142 Ga0207652_10938484 3300025921 Bacteria 763
143 Ga0207646_10307596 3300025922 Bacteria 1432
144 Ga0207681_10000090 3300025923 Bacteria 78944
145 Ga0207681_10000174 3300025923 Bacteria 52934
146 Ga0207681_10021094 3300025923 Bacteria 4136
147 Ga0207650_11050803 3300025925 Bacteria 693
148 Ga0207644_10000003 3300025931 Bacteria 585905
149 Ga0207644_10000456 3300025931 Bacteria 26391
150 Ga0207644_10004790 3300025931 Bacteria 8806
151 Ga0207690_10270801 3300025932 Bacteria 1319
152 Ga0207690_10854255 3300025932 Bacteria 754
153 Ga0207706_10001027 3300025933 Bacteria 28388
154 Ga0207711_10006319 3300025941 Bacteria 9993
155 Ga0207711_10221626 3300025941 Bacteria 1730
156 Ga0207711_10298007 3300025941 Bacteria 1487
157 Ga0207661_10022985 3300025944 Bacteria 4706
158 Ga0207661_10417814 3300025944 Bacteria 1218
159 Ga0207667_10015289 3300025949 Bacteria 8725
160 Ga0207667_10016606 3300025949 Bacteria 8309
161 Ga0207667_10057131 3300025949 Bacteria 4097
162 Ga0207712_10212200 3300025961 Bacteria 1542
163 Ga0207712_10315725 3300025961 Bacteria 1287
164 Ga0207712_10767953 3300025961 Bacteria 845
165 Ga0207668_10034317 3300025972 Bacteria 3368
166 Ga0207668_10072826 3300025972 Bacteria 2460
167 Ga0207668_10437778 3300025972 Bacteria 1113
168 Ga0207640_10000996 3300025981 Bacteria 15684
169 Ga0207640_10011899 3300025981 Bacteria 4941
170 Ga0207658_10001909 3300025986 Bacteria 15589
171 Ga0207658_10006709 3300025986 Bacteria 7843
172 Ga0207658_10024648 3300025986 Bacteria 4210
173 Ga0207658_10046341 3300025986 Bacteria 3175
174 Ga0207658_10132613 3300025986 Bacteria 2004
175 Ga0207703_10004776 3300026035 Bacteria 11049
176 Ga0207703_10011932 3300026035 Bacteria 6767
177 Ga0207703_10050984 3300026035 Bacteria 3352
178 Ga0207639_10034084 3300026041 Bacteria 3760
179 Ga0207702_10007361 3300026078 Bacteria 9400
180 Ga0207702_10186611 3300026078 Bacteria 1913
181 Ga0207641_10000042 3300026088 Bacteria 186384
182 Ga0207641_10021901 3300026088 Bacteria 5254
183 Ga0207641_10397351 3300026088 Bacteria 1323
184 Ga0207676_10025535 3300026095 Bacteria 4383
185 Ga0207676_10479229 3300026095 Bacteria 1178
186 Ga0207674_10101350 3300026116 Bacteria 2860
187 Ga0207674_10121768 3300026116 Bacteria 2576
188 Ga0207674_10376200 3300026116 Bacteria 1373
189 Ga0207698_10000005 3300026142 Bacteria 295687
190 Ga0207698_10513054 3300026142 Bacteria 1169
191 Ga0209281_1014330 3300027111 Bacteria 1681
192 Ga0209981_1045707 3300027378 Bacteria 659
193 Ga0209813_10000402 3300027866 Bacteria 10625
194 Ga0209974_10029737 3300027876 Bacteria 1810
195 Ga0268266_10000215 3300028379 Bacteria 100801
196 Ga0268266_10017014 3300028379 Bacteria 6212
197 Ga0268266_10020395 3300028379 Bacteria 5649
198 Ga0268266_10181184 3300028379 Bacteria 1918
199 Ga0268265_10002755 3300028380 Bacteria 12978
200 Ga0268265_10016778 3300028380 Bacteria 5040
201 Ga0268264_10000134 3300028381 Bacteria 179475
202 Ga0268264_10013574 3300028381 Bacteria 6706
203 Ga0268264_10021234 3300028381 Bacteria 5304
204 Ga0268264_10208710 3300028381 Bacteria 1792
205 Ga0268264_10452916 3300028381 Bacteria 1244
206 Ga0265327_10044757 3300031251 Bacteria 2357
207 Ga0265327_10157303 3300031251 Bacteria 1052
208 Ga0307508_10008321 3300031616 Bacteria 9593
209 Ga0307516_10416267 3300031730 Bacteria 1002
210 Ga0316577_10100437 3300031733 Bacteria 1622
211 Ga0307410_10578922 3300031852 Bacteria 934
212 Ga0307412_11190785 3300031911 Bacteria 682
213 Ga0307414_10392271 3300032004 Bacteria 1203
214 Ga0307411_10391597 3300032005 Bacteria 1146
215 Ga0373951_0062055 3300035091 Bacteria 938
216 Ga0373962_0046036 3300035242 Bacteria 1244
217 Ga0373925_0483442 3300037068 Bacteria 1016
218 Ga0451843_1680450 3300041509 Bacteria 1140
219 Ga0450912_000100 3300042116 Bacteria 3009
220 Ga0453684_0590824 3300044712 Bacteria 1218
221 Ga0495627_000197 3300046453 Bacteria 66158
222 Ga0495638_0083698 3300046460 Bacteria 1932
223 Ga0495638_0365848 3300046460 Bacteria 757
224 Ga0495650_0001171 3300046471 Bacteria 28029
225 Ga0495596_0014347 3300046500 Bacteria 3339
226 Ga0495610_0000022 3300046512 Bacteria 317107
227 Ga0495610_0002818 3300046512 Bacteria 14175
228 Ga0495610_0041165 3300046512 Bacteria 2322
229 Ga0495632_0000445 3300046519 Bacteria 39318
230 Ga0495654_0051941 3300046530 Bacteria 1999
231 Ga0495654_0174084 3300046530 Bacteria 936
232 Ga0495625_0050630 3300046660 Bacteria 2980
233 Ga0495670_0128202 3300046691 Bacteria 1321
234 Ga0495681_0000123 3300047470 Bacteria 68069
235 Ga0495615_0000131 3300048090 Bacteria 18922
236 Ga0496100_0005473 3300048903 Bacteria 6842
237 Ga0496100_0008856 3300048903 Bacteria 5630
238 Ga0496101_0037653 3300048904 Bacteria 3432
239 Ga0496101_0047091 3300048904 Bacteria 3094
240 Ga0496101_0146579 3300048904 Bacteria 1803
241 Ga0496102_0000162 3300048905 Bacteria 89746
242 Ga0496102_0082978 3300048905 Bacteria 2957
243 Ga0496102_0172826 3300048905 Bacteria 2034
244 Ga0496103_0000190 3300048906 Bacteria 61731
245 Ga0496103_0042748 3300048906 Bacteria 2789
246 Ga0496103_0145468 3300048906 Bacteria 1517
247 Ga0496103_0267382 3300048906 Bacteria 1100
248 Ga0496104_0004696 3300048907 Bacteria 11898
249 Ga0496104_0017845 3300048907 Bacteria 6470
250 Ga0496105_0000395 3300048908 Bacteria 28676
251 Ga0496105_0000435 3300048908 Bacteria 27394
252 Ga0496105_0029589 3300048908 Bacteria 4483
253 Ga0496105_0405924 3300048908 Bacteria 1081
254 Ga0496105_1234570 3300048908 Bacteria 549
255 Ga0496106_0004254 3300048909 Bacteria 10656
256 Ga0496107_0001028 3300048910 Bacteria 16666
257 Ga0496107_0107386 3300048910 Bacteria 2050
258 Ga0496109_0053954 3300048912 Bacteria 3668
259 Ga0496110_0055762 3300048913 Bacteria 3477
260 Ga0496110_0639150 3300048913 Bacteria 963
261 Ga0496111_0041636 3300048914 Bacteria 3297
262 Ga0496111_0056441 3300048914 Bacteria 2841
263 Ga0496112_0004154 3300048915 Bacteria 12193
264 Ga0496112_0091633 3300048915 Bacteria 3008
265 Ga0496112_0919697 3300048915 Bacteria 796
266 Ga0496113_0000233 3300048916 Bacteria 26178
267 Ga0496113_0000943 3300048916 Bacteria 15457
268 Ga0496114_0013427 3300048917 Bacteria 6567
269 Ga0496114_0064943 3300048917 Bacteria 3057
270 Ga0496114_0487241 3300048917 Bacteria 1091
271 Ga0496115_0291596 3300048918 Bacteria 1338
272 Ga0496115_0728367 3300048918 Bacteria 777
273 Ga0496116_0000035 3300048919 Bacteria 402424
274 Ga0496116_0032417 3300048919 Bacteria 3723
275 Ga0496116_0062244 3300048919 Bacteria 2410
276 Ga0496117_0000323 3300048920 Bacteria 83916
277 Ga0496117_0145397 3300048920 Bacteria 1412
278 Ga0496117_0268890 3300048920 Bacteria 919
279 Ga0496117_0430156 3300048920 Bacteria 658
280 Ga0496117_0447670 3300048920 Bacteria 639
281 Ga0496118_0003389 3300048921 Bacteria 20144
282 Ga0496118_0016413 3300048921 Bacteria 6795
283 Ga0496118_0021572 3300048921 Bacteria 5663
284 Ga0496118_0032274 3300048921 Bacteria 4319
285 Ga0496118_0250779 3300048921 Bacteria 1006
286 Ga0496119_0005020 3300048922 Bacteria 12894
287 Ga0496119_0115515 3300048922 Bacteria 1483
288 Ga0496120_0005113 3300048923 Bacteria 10605
289 Ga0496120_0351577 3300048923 Bacteria 662
290 Ga0496121_0000740 3300048924 Bacteria 60212
291 Ga0496121_0006257 3300048924 Bacteria 14897
292 Ga0496121_0008423 3300048924 Bacteria 12134
293 Ga0496121_0016282 3300048924 Bacteria 7690
294 Ga0496121_0082213 3300048924 Bacteria 2547
295 Ga0496122_0002251 3300048925 Bacteria 27964
296 Ga0496122_0005224 3300048925 Bacteria 15577
297 Ga0496122_0008157 3300048925 Bacteria 11399
298 Ga0496122_0206425 3300048925 Bacteria 1143
299 Ga0496123_0001169 3300048926 Bacteria 38781
300 Ga0496123_0002605 3300048926 Bacteria 21912
301 Ga0496123_0006066 3300048926 Bacteria 11861
302 Ga0496123_0138467 3300048926 Bacteria 1335
303 Ga0496124_0003117 3300048927 Bacteria 20575
304 Ga0496124_0004328 3300048927 Bacteria 16639
305 Ga0496124_0094256 3300048927 Bacteria 2435
306 Ga0496124_0335733 3300048927 Bacteria 1075
307 Ga0496125_0003763 3300048928 Bacteria 18060
308 Ga0496125_0025119 3300048928 Bacteria 5464
309 Ga0496125_0039050 3300048928 Bacteria 4095
310 Ga0496125_0311523 3300048928 Bacteria 959
311 Ga0496126_0000044 3300048929 Bacteria 335904
312 Ga0496126_0000084 3300048929 Bacteria 217111
313 Ga0496126_0001464 3300048929 Bacteria 36818
314 Ga0496126_0052607 3300048929 Bacteria 3700
315 Ga0496126_0076715 3300048929 Bacteria 2964
316 Ga0496126_0880150 3300048929 Bacteria 681
317 Ga0501042_0557642 3300049578 Bacteria 833
318 Ga0501248_040108 3300049678 Bacteria 570
319 Ga0501080_0439315 3300049742 Bacteria 1171
320 Ga0501083_0486263 3300049744 Bacteria 803
321 Ga0501044_0001099 3300049823 Bacteria 32196
322 Ga0501044_0420941 3300049823 Bacteria 1246
323 Ga0501044_0481404 3300049823 Bacteria 1144
324 Ga0501044_0727618 3300049823 Bacteria 876
325 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
326 nmdc:mga03683_289_c1 3300050489 Bacteria 14995
327 nmdc:mga03n38_3053_c1 3300050490 Bacteria 5306
328 nmdc:mga03n38_9999_c1 3300050490 Bacteria 3473
329 nmdc:mga00v17_183841_c1 3300050491 Bacteria 1349
330 nmdc:mga0yw44_189378_c1 3300050492 Bacteria 1357
331 nmdc:mga0k408_22243_c1 3300050493 Bacteria 3570
332 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
333 nmdc:mga0k408_9889_c1 3300050493 Bacteria 5147
334 nmdc:mga06z11_37216_c1 3300050494 Bacteria 2408
335 nmdc:mga06z11_573_c1 3300050494 Bacteria 13457
336 nmdc:mga04h51_76_c1 3300050495 Bacteria 31783
337 nmdc:mga07m45_177292_c1 3300050496 Bacteria 1239
338 nmdc:mga07m45_38287_c1 3300050496 Bacteria 2675
339 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
340 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
341 nmdc:mga07m45_618_c1 3300050496 Bacteria 15113
342 nmdc:mga07m45_89552_c1 3300050496 Bacteria 1762
343 nmdc:mga0sz30_13183_c1 3300050516 Bacteria 3232
344 nmdc:mga0sz30_1731_c1 3300050516 Bacteria 3475
345 Ga0500643_008388 3300053087 Bacteria 4063
346 Ga0500643_032949 3300053087 Bacteria 1569
347 Ga0500646_0152380 3300053090 Bacteria 766
348 Ga0500594_0025533 3300053118 Bacteria 1515
349 Ga0500607_000048 3300053121 Bacteria 82363
350 Ga0500608_008056 3300053122 Bacteria 4402
351 Ga0500618_003695 3300053125 Bacteria 5157
352 Ga0500559_0001340 3300053136 Bacteria 14123
353 Ga0500559_0014168 3300053136 Bacteria 3369
354 Ga0500564_010236 3300053138 Bacteria 4106
355 Ga0500573_0100187 3300053140 Bacteria 1631
356 Ga0500590_114764 3300053148 Bacteria 1272
357 Ga0500604_0056569 3300053151 Bacteria 1223
358 Ga0500604_0168644 3300053151 Bacteria 748
359 Ga0500616_0004303 3300053153 Bacteria 10214
360 Ga0500616_0259235 3300053153 Bacteria 739
361 Ga0500619_049048 3300053154 Bacteria 1361
362 Ga0500622_0001071 3300053156 Bacteria 22774
363 Ga0500636_0174926 3300053177 Bacteria 1158
364 Ga0500637_0024485 3300053178 Bacteria 3308
365 Ga0500567_001083 3300053723 Bacteria 10567
366 Ga0500625_000010 3300053729 Bacteria 154401
367 Ga0500645_004767 3300053730 Bacteria 5133
368 Ga0500645_035641 3300053730 Bacteria 1481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025909 Ga0207705_10001684 Ga0207705_1000168416 155
2 3300025919 Ga0207657_10008726 Ga0207657_100087263 155
3 iso_pu_bacteria 2919138771 2919141677 156
4 3300005327 Ga0070658_10022038 Ga0070658_100220384 158
5 3300005327 Ga0070658_10033854 Ga0070658_100338542 158
6 3300005327 Ga0070658_10048440 Ga0070658_100484403 158
7 3300005329 Ga0070683_100039496 Ga0070683_1000394963 158
8 3300005336 Ga0070680_100010360 Ga0070680_1000103603 158
9 3300005339 Ga0070660_100004861 Ga0070660_1000048617 158
10 3300005339 Ga0070660_100009476 Ga0070660_1000094767 158
11 3300005341 Ga0070691_10335130 Ga0070691_103351302 158
12 3300005344 Ga0070661_100024929 Ga0070661_1000249295 158
13 3300005366 Ga0070659_100011764 Ga0070659_1000117646 158
14 3300005366 Ga0070659_100539457 Ga0070659_1005394572 158
15 3300005455 Ga0070663_100333169 Ga0070663_1003331692 158
16 3300005457 Ga0070662_100001132 Ga0070662_10000113221 158
17 3300005458 Ga0070681_10006109 Ga0070681_100061095 158
18 3300005530 Ga0070679_100025746 Ga0070679_1000257462 158
19 3300005530 Ga0070679_100264388 Ga0070679_1002643883 158
20 3300005539 Ga0068853_100095206 Ga0068853_1000952063 158
21 3300005563 Ga0068855_100066663 Ga0068855_1000666632 158
22 3300005564 Ga0070664_100146492 Ga0070664_1001464923 158
23 3300005578 Ga0068854_100019468 Ga0068854_1000194684 158
24 3300005614 Ga0068856_100434391 Ga0068856_1004343912 158
25 3300009174 Ga0105241_10249858 Ga0105241_102498582 158
26 3300013100 Ga0157373_10395696 Ga0157373_103956962 158
27 3300013102 Ga0157371_10008544 Ga0157371_100085445 158
28 3300013102 Ga0157371_10117183 Ga0157371_101171833 158
29 3300013104 Ga0157370_10165842 Ga0157370_101658422 158
30 3300013105 Ga0157369_10021737 Ga0157369_100217376 158
31 3300013307 Ga0157372_10016641 Ga0157372_100166415 158
32 3300025904 Ga0207647_10175356 Ga0207647_101753563 158
33 3300025909 Ga0207705_10007168 Ga0207705_100071682 158
34 3300025909 Ga0207705_10017514 Ga0207705_100175146 158
35 3300025911 Ga0207654_10201656 Ga0207654_102016562 158
36 3300025912 Ga0207707_10189102 Ga0207707_101891022 158
37 3300025917 Ga0207660_10012251 Ga0207660_100122513 158
38 3300025919 Ga0207657_10000538 Ga0207657_1000053841 158
39 3300025920 Ga0207649_10016285 Ga0207649_100162852 158
40 3300025921 Ga0207652_10130121 Ga0207652_101301213 158
41 3300025921 Ga0207652_10938484 Ga0207652_109384841 158
42 3300025932 Ga0207690_10270801 Ga0207690_102708012 158
43 3300025932 Ga0207690_10854255 Ga0207690_108542551 158
44 3300025933 Ga0207706_10001027 Ga0207706_100010274 158
45 3300025944 Ga0207661_10022985 Ga0207661_100229856 158
46 3300025981 Ga0207640_10011899 Ga0207640_100118996 158
47 3300026041 Ga0207639_10034084 Ga0207639_100340842 158
48 3300026078 Ga0207702_10186611 Ga0207702_101866112 158
49 3300026116 Ga0207674_10101350 Ga0207674_101013503 158
50 3300026116 Ga0207674_10376200 Ga0207674_103762002 158
51 3300031852 Ga0307410_10578922 Ga0307410_105789222 159
52 3300042116 Ga0450912_000100 Ga0450912_000100_423_920 159
53 2162886007 SwRhRL2b_contig_2799799 SwRhRL2b_0316.00000490 160
54 2162886007 SwRhRL2b_contig_533662 SwRhRL2b_0629.00000630 160
55 2162886007 SwRhRL2b_contig_809626 SwRhRL2b_0828.00006430 160
56 3300002459 JGI24751J29686_10000242 JGI24751J29686_100002424 160
57 3300003791 Ga0055530_10011167 Ga0055530_100111672 160
58 3300005289 Ga0065704_10000280 Ga0065704_1000028012 160
59 3300005289 Ga0065704_10115408 Ga0065704_101154082 160
60 3300005289 Ga0065704_10117616 Ga0065704_101176162 160
61 3300005295 Ga0065707_10086495 Ga0065707_100864954 160
62 3300005327 Ga0070658_10000351 Ga0070658_1000035132 160
63 3300005327 Ga0070658_10158654 Ga0070658_101586542 160
64 3300005329 Ga0070683_100284928 Ga0070683_1002849281 160
65 3300005331 Ga0070670_100093528 Ga0070670_1000935283 160
66 3300005347 Ga0070668_100092165 Ga0070668_1000921653 160
67 3300005347 Ga0070668_100963238 Ga0070668_1009632382 160
68 3300005353 Ga0070669_100000471 Ga0070669_10000047121 160
69 3300005353 Ga0070669_100000661 Ga0070669_10000066118 160
70 3300005353 Ga0070669_100029006 Ga0070669_1000290062 160
71 3300005355 Ga0070671_100000050 Ga0070671_10000005038 160
72 3300005355 Ga0070671_100001477 Ga0070671_1000014773 160
73 3300005355 Ga0070671_100007392 Ga0070671_1000073928 160
74 3300005355 Ga0070671_100130905 Ga0070671_1001309052 160
75 3300005367 Ga0070667_100012088 Ga0070667_1000120884 160
76 3300005367 Ga0070667_100012789 Ga0070667_1000127894 160
77 3300005367 Ga0070667_100015251 Ga0070667_1000152516 160
78 3300005367 Ga0070667_100048374 Ga0070667_1000483742 160
79 3300005367 Ga0070667_100075271 Ga0070667_1000752713 160
80 3300005548 Ga0070665_100000634 Ga0070665_10000063422 160
81 3300005548 Ga0070665_100004137 Ga0070665_1000041375 160
82 3300005548 Ga0070665_100011778 Ga0070665_1000117787 160
83 3300005548 Ga0070665_100168668 Ga0070665_1001686682 160
84 3300005577 Ga0068857_100219862 Ga0068857_1002198622 160
85 3300005577 Ga0068857_100966921 Ga0068857_1009669211 160
86 3300005578 Ga0068854_100007709 Ga0068854_1000077094 160
87 3300005614 Ga0068856_100000870 Ga0068856_10000087028 160
88 3300005616 Ga0068852_100000075 Ga0068852_10000007515 160
89 3300005616 Ga0068852_100116855 Ga0068852_1001168552 160
90 3300005616 Ga0068852_100364601 Ga0068852_1003646012 160
91 3300005617 Ga0068859_100014962 Ga0068859_1000149622 160
92 3300005618 Ga0068864_100045159 Ga0068864_1000451592 160
93 3300005834 Ga0068851_10286934 Ga0068851_102869342 160
94 3300005841 Ga0068863_100000052 Ga0068863_100000052126 160
95 3300005841 Ga0068863_100172062 Ga0068863_1001720622 160
96 3300005841 Ga0068863_100221215 Ga0068863_1002212151 160
97 3300005842 Ga0068858_100005063 Ga0068858_1000050635 160
98 3300005842 Ga0068858_100017450 Ga0068858_1000174505 160
99 3300005842 Ga0068858_100049007 Ga0068858_1000490072 160
100 3300005842 Ga0068858_100817447 Ga0068858_1008174471 160
101 3300005843 Ga0068860_100000007 Ga0068860_100000007295 160
102 3300005843 Ga0068860_100004218 Ga0068860_1000042188 160
103 3300005843 Ga0068860_100005984 Ga0068860_10000598411 160
104 3300005843 Ga0068860_100023975 Ga0068860_1000239753 160
105 3300005843 Ga0068860_100247845 Ga0068860_1002478452 160
106 3300005844 Ga0068862_100002760 Ga0068862_10000276019 160
107 3300005844 Ga0068862_100019812 Ga0068862_1000198124 160
108 3300005844 Ga0068862_100199758 Ga0068862_1001997582 160
109 3300006048 Ga0075363_100011794 Ga0075363_1000117942 160
110 3300006051 Ga0075364_10053039 Ga0075364_100530393 160
111 3300006051 Ga0075364_10485914 Ga0075364_104859141 160
112 3300006058 Ga0075432_10005555 Ga0075432_100055554 160
113 3300006177 Ga0075362_10000083 Ga0075362_1000008315 160
114 3300006177 Ga0075362_10000203 Ga0075362_1000020313 160
115 3300006178 Ga0075367_10002111 Ga0075367_100021116 160
116 3300006178 Ga0075367_10089709 Ga0075367_100897092 160
117 3300006186 Ga0075369_10001615 Ga0075369_100016152 160
118 3300006195 Ga0075366_10001643 Ga0075366_100016438 160
119 3300006195 Ga0075366_10002219 Ga0075366_100022196 160
120 3300006353 Ga0075370_10000017 Ga0075370_1000001749 160
121 3300006353 Ga0075370_10003828 Ga0075370_100038287 160
122 3300006931 Ga0097620_100014961 Ga0097620_1000149617 160
123 3300006931 Ga0097620_100456873 Ga0097620_1004568732 160
124 3300007076 Ga0075435_100339274 Ga0075435_1003392741 160
125 3300009011 Ga0105251_10003099 Ga0105251_100030999 160
126 3300009092 Ga0105250_10009921 Ga0105250_100099213 160
127 3300009093 Ga0105240_10554979 Ga0105240_105549791 160
128 3300009101 Ga0105247_10296183 Ga0105247_102961832 160
129 3300009148 Ga0105243_10181209 Ga0105243_101812092 160
130 3300009177 Ga0105248_10009214 Ga0105248_100092143 160
131 3300009177 Ga0105248_10026196 Ga0105248_100261964 160
132 3300009177 Ga0105248_10269156 Ga0105248_102691561 160
133 3300009177 Ga0105248_10279980 Ga0105248_102799802 160
134 3300009177 Ga0105248_10410026 Ga0105248_104100262 160
135 3300009551 Ga0105238_10104693 Ga0105238_101046933 160
136 3300009553 Ga0105249_10220640 Ga0105249_102206401 160
137 3300009553 Ga0105249_10553526 Ga0105249_105535262 160
138 3300010375 Ga0105239_10520011 Ga0105239_105200112 160
139 3300013104 Ga0157370_10522890 Ga0157370_105228901 160
140 3300013306 Ga0163162_10018885 Ga0163162_100188852 160
141 3300013306 Ga0163162_10077086 Ga0163162_100770862 160
142 3300013306 Ga0163162_11662261 Ga0163162_116622612 160
143 3300014325 Ga0163163_10329176 Ga0163163_103291762 160
144 3300014326 Ga0157380_10012133 Ga0157380_100121334 160
145 3300025298 Ga0209050_1000929 Ga0209050_100092922 160
146 3300025711 Ga0207696_1009107 Ga0207696_10091074 160
147 3300025735 Ga0207713_1007781 Ga0207713_10077814 160
148 3300025903 Ga0207680_10017405 Ga0207680_100174052 160
149 3300025904 Ga0207647_10007669 Ga0207647_100076695 160
150 3300025909 Ga0207705_10000075 Ga0207705_1000007591 160
151 3300025909 Ga0207705_10238446 Ga0207705_102384461 160
152 3300025913 Ga0207695_10104094 Ga0207695_101040943 160
153 3300025913 Ga0207695_10461942 Ga0207695_104619421 160
154 3300025918 Ga0207662_10415858 Ga0207662_104158582 160
155 3300025922 Ga0207646_10307596 Ga0207646_103075962 160
156 3300025923 Ga0207681_10000090 Ga0207681_1000009049 160
157 3300025923 Ga0207681_10000174 Ga0207681_1000017446 160
158 3300025923 Ga0207681_10021094 Ga0207681_100210944 160
159 3300025925 Ga0207650_11050803 Ga0207650_110508032 160
160 3300025931 Ga0207644_10000003 Ga0207644_1000000338 160
161 3300025931 Ga0207644_10000456 Ga0207644_100004567 160
162 3300025931 Ga0207644_10004790 Ga0207644_100047903 160
163 3300025941 Ga0207711_10006319 Ga0207711_100063198 160
164 3300025941 Ga0207711_10221626 Ga0207711_102216262 160
165 3300025941 Ga0207711_10298007 Ga0207711_102980072 160
166 3300025944 Ga0207661_10417814 Ga0207661_104178142 160
167 3300025949 Ga0207667_10015289 Ga0207667_100152898 160
168 3300025949 Ga0207667_10016606 Ga0207667_100166062 160
169 3300025949 Ga0207667_10057131 Ga0207667_100571314 160
170 3300025961 Ga0207712_10212200 Ga0207712_102122003 160
171 3300025961 Ga0207712_10315725 Ga0207712_103157251 160
172 3300025961 Ga0207712_10767953 Ga0207712_107679532 160
173 3300025972 Ga0207668_10034317 Ga0207668_100343172 160
174 3300025972 Ga0207668_10072826 Ga0207668_100728262 160
175 3300025972 Ga0207668_10437778 Ga0207668_104377781 160
176 3300025981 Ga0207640_10000996 Ga0207640_100009964 160
177 3300025986 Ga0207658_10001909 Ga0207658_1000190911 160
178 3300025986 Ga0207658_10006709 Ga0207658_100067098 160
179 3300025986 Ga0207658_10024648 Ga0207658_100246484 160
180 3300025986 Ga0207658_10046341 Ga0207658_100463412 160
181 3300025986 Ga0207658_10132613 Ga0207658_101326132 160
182 3300026035 Ga0207703_10004776 Ga0207703_100047768 160
183 3300026035 Ga0207703_10011932 Ga0207703_100119324 160
184 3300026035 Ga0207703_10050984 Ga0207703_100509842 160
185 3300026078 Ga0207702_10007361 Ga0207702_100073613 160
186 3300026088 Ga0207641_10000042 Ga0207641_10000042126 160
187 3300026088 Ga0207641_10021901 Ga0207641_100219014 160
188 3300026088 Ga0207641_10397351 Ga0207641_103973512 160
189 3300026095 Ga0207676_10025535 Ga0207676_100255353 160
190 3300026095 Ga0207676_10479229 Ga0207676_104792292 160
191 3300026116 Ga0207674_10121768 Ga0207674_101217682 160
192 3300026142 Ga0207698_10000005 Ga0207698_10000005155 160
193 3300026142 Ga0207698_10513054 Ga0207698_105130541 160
194 3300027111 Ga0209281_1014330 Ga0209281_10143302 160
195 3300027378 Ga0209981_1045707 Ga0209981_10457071 160
196 3300027866 Ga0209813_10000402 Ga0209813_100004027 160
197 3300027876 Ga0209974_10029737 Ga0209974_100297372 160
198 3300028379 Ga0268266_10000215 Ga0268266_1000021532 160
199 3300028379 Ga0268266_10017014 Ga0268266_100170145 160
200 3300028379 Ga0268266_10020395 Ga0268266_100203954 160
201 3300028379 Ga0268266_10181184 Ga0268266_101811842 160
202 3300028380 Ga0268265_10002755 Ga0268265_100027553 160
203 3300028380 Ga0268265_10016778 Ga0268265_100167783 160
204 3300028381 Ga0268264_10000134 Ga0268264_10000134120 160
205 3300028381 Ga0268264_10013574 Ga0268264_100135743 160
206 3300028381 Ga0268264_10021234 Ga0268264_100212343 160
207 3300028381 Ga0268264_10208710 Ga0268264_102087102 160
208 3300028381 Ga0268264_10452916 Ga0268264_104529163 160
209 3300031251 Ga0265327_10044757 Ga0265327_100447572 160
210 3300031251 Ga0265327_10157303 Ga0265327_101573032 160
211 3300031616 Ga0307508_10008321 Ga0307508_100083219 160
212 3300031730 Ga0307516_10416267 Ga0307516_104162671 160
213 3300031733 Ga0316577_10100437 Ga0316577_101004372 160
214 3300031911 Ga0307412_11190785 Ga0307412_111907852 160
215 3300032004 Ga0307414_10392271 Ga0307414_103922712 160
216 3300032005 Ga0307411_10391597 Ga0307411_103915971 160
217 3300035091 Ga0373951_0062055 Ga0373951_0062055_26_580 160
218 3300035242 Ga0373962_0046036 Ga0373962_0046036_495_1049 160
219 3300037068 Ga0373925_0483442 Ga0373925_0483442_245_730 160
220 3300041509 Ga0451843_1680450 Ga0451843_1680450_423_905 160
221 3300044712 Ga0453684_0590824 Ga0453684_0590824_295_795 160
222 3300046453 Ga0495627_000197 Ga0495627_000197_65574_66056 160
223 3300046460 Ga0495638_0083698 Ga0495638_0083698_924_1406 160
224 3300046460 Ga0495638_0365848 Ga0495638_0365848_159_659 160
225 3300046471 Ga0495650_0001171 Ga0495650_0001171_122_604 160
226 3300046500 Ga0495596_0014347 Ga0495596_0014347_943_1497 160
227 3300046512 Ga0495610_0000022 Ga0495610_0000022_310157_310639 160
228 3300046512 Ga0495610_0002818 Ga0495610_0002818_8365_8919 160
229 3300046512 Ga0495610_0041165 Ga0495610_0041165_1614_2096 160
230 3300046519 Ga0495632_0000445 Ga0495632_0000445_13174_13656 160
231 3300046530 Ga0495654_0051941 Ga0495654_0051941_809_1291 160
232 3300046530 Ga0495654_0174084 Ga0495654_0174084_91_576 160
233 3300046660 Ga0495625_0050630 Ga0495625_0050630_739_1221 160
234 3300046691 Ga0495670_0128202 Ga0495670_0128202_331_813 160
235 3300047470 Ga0495681_0000123 Ga0495681_0000123_67458_67940 160
236 3300048090 Ga0495615_0000131 Ga0495615_0000131_11984_12466 160
237 3300048903 Ga0496100_0005473 Ga0496100_0005473_4144_4632 160
238 3300048903 Ga0496100_0008856 Ga0496100_0008856_716_1198 160
239 3300048904 Ga0496101_0037653 Ga0496101_0037653_1765_2253 160
240 3300048904 Ga0496101_0047091 Ga0496101_0047091_2016_2498 160
241 3300048904 Ga0496101_0146579 Ga0496101_0146579_1149_1745 160
242 3300048905 Ga0496102_0000162 Ga0496102_0000162_78954_79442 160
243 3300048905 Ga0496102_0082978 Ga0496102_0082978_1491_1979 160
244 3300048905 Ga0496102_0172826 Ga0496102_0172826_368_850 160
245 3300048906 Ga0496103_0000190 Ga0496103_0000190_43709_44197 160
246 3300048906 Ga0496103_0042748 Ga0496103_0042748_1443_1925 160
247 3300048906 Ga0496103_0145468 Ga0496103_0145468_904_1386 160
248 3300048906 Ga0496103_0267382 Ga0496103_0267382_23_505 160
249 3300048907 Ga0496104_0004696 Ga0496104_0004696_5846_6334 160
250 3300048907 Ga0496104_0017845 Ga0496104_0017845_3295_3783 160
251 3300048908 Ga0496105_0000395 Ga0496105_0000395_24147_24635 160
252 3300048908 Ga0496105_0000435 Ga0496105_0000435_16728_17216 160
253 3300048908 Ga0496105_0029589 Ga0496105_0029589_2402_2884 160
254 3300048908 Ga0496105_0405924 Ga0496105_0405924_505_987 160
255 3300048908 Ga0496105_1234570 Ga0496105_1234570_52_534 160
256 3300048909 Ga0496106_0004254 Ga0496106_0004254_8569_9051 160
257 3300048910 Ga0496107_0001028 Ga0496107_0001028_7786_8268 160
258 3300048910 Ga0496107_0107386 Ga0496107_0107386_95_583 160
259 3300048912 Ga0496109_0053954 Ga0496109_0053954_1355_1837 160
260 3300048913 Ga0496110_0055762 Ga0496110_0055762_1789_2271 160
261 3300048913 Ga0496110_0639150 Ga0496110_0639150_162_644 160
262 3300048914 Ga0496111_0041636 Ga0496111_0041636_611_1099 160
263 3300048914 Ga0496111_0056441 Ga0496111_0056441_705_1187 160
264 3300048915 Ga0496112_0004154 Ga0496112_0004154_10934_11422 160
265 3300048915 Ga0496112_0091633 Ga0496112_0091633_2085_2567 160
266 3300048915 Ga0496112_0919697 Ga0496112_0919697_161_643 160
267 3300048916 Ga0496113_0000233 Ga0496113_0000233_9998_10486 160
268 3300048916 Ga0496113_0000943 Ga0496113_0000943_7702_8184 160
269 3300048917 Ga0496114_0013427 Ga0496114_0013427_2725_3210 160
270 3300048917 Ga0496114_0064943 Ga0496114_0064943_207_689 160
271 3300048917 Ga0496114_0487241 Ga0496114_0487241_455_937 160
272 3300048918 Ga0496115_0291596 Ga0496115_0291596_544_1032 160
273 3300048918 Ga0496115_0728367 Ga0496115_0728367_181_663 160
274 3300048919 Ga0496116_0000035 Ga0496116_0000035_124670_125266 160
275 3300048919 Ga0496116_0032417 Ga0496116_0032417_2211_2699 160
276 3300048919 Ga0496116_0062244 Ga0496116_0062244_276_758 160
277 3300048920 Ga0496117_0000323 Ga0496117_0000323_72180_72668 160
278 3300048920 Ga0496117_0145397 Ga0496117_0145397_438_920 160
279 3300048920 Ga0496117_0268890 Ga0496117_0268890_45_530 160
280 3300048920 Ga0496117_0430156 Ga0496117_0430156_85_567 160
281 3300048920 Ga0496117_0447670 Ga0496117_0447670_144_626 160
282 3300048921 Ga0496118_0003389 Ga0496118_0003389_8968_9456 160
283 3300048921 Ga0496118_0016413 Ga0496118_0016413_1294_1857 160
284 3300048921 Ga0496118_0021572 Ga0496118_0021572_1814_2296 160
285 3300048921 Ga0496118_0032274 Ga0496118_0032274_77_673 160
286 3300048921 Ga0496118_0250779 Ga0496118_0250779_262_744 160
287 3300048922 Ga0496119_0005020 Ga0496119_0005020_3074_3562 160
288 3300048922 Ga0496119_0115515 Ga0496119_0115515_560_1048 160
289 3300048923 Ga0496120_0005113 Ga0496120_0005113_9333_9821 160
290 3300048923 Ga0496120_0351577 Ga0496120_0351577_153_635 160
291 3300048924 Ga0496121_0000740 Ga0496121_0000740_53437_54000 160
292 3300048924 Ga0496121_0006257 Ga0496121_0006257_13835_14317 160
293 3300048924 Ga0496121_0008423 Ga0496121_0008423_3914_4402 160
294 3300048924 Ga0496121_0016282 Ga0496121_0016282_6676_7272 160
295 3300048924 Ga0496121_0082213 Ga0496121_0082213_561_1049 160
296 3300048925 Ga0496122_0002251 Ga0496122_0002251_9999_10487 160
297 3300048925 Ga0496122_0005224 Ga0496122_0005224_14446_15042 160
298 3300048925 Ga0496122_0008157 Ga0496122_0008157_149_631 160
299 3300048925 Ga0496122_0206425 Ga0496122_0206425_518_1000 160
300 3300048926 Ga0496123_0001169 Ga0496123_0001169_19898_20494 160
301 3300048926 Ga0496123_0002605 Ga0496123_0002605_15579_16067 160
302 3300048926 Ga0496123_0006066 Ga0496123_0006066_54_536 160
303 3300048926 Ga0496123_0138467 Ga0496123_0138467_177_659 160
304 3300048927 Ga0496124_0003117 Ga0496124_0003117_6516_7112 160
305 3300048927 Ga0496124_0004328 Ga0496124_0004328_11747_12235 160
306 3300048927 Ga0496124_0094256 Ga0496124_0094256_1893_2375 160
307 3300048927 Ga0496124_0335733 Ga0496124_0335733_440_922 160
308 3300048928 Ga0496125_0003763 Ga0496125_0003763_15124_15612 160
309 3300048928 Ga0496125_0025119 Ga0496125_0025119_1381_1977 160
310 3300048928 Ga0496125_0039050 Ga0496125_0039050_365_847 160
311 3300048928 Ga0496125_0311523 Ga0496125_0311523_55_537 160
312 3300048929 Ga0496126_0000044 Ga0496126_0000044_110402_110890 160
313 3300048929 Ga0496126_0000084 Ga0496126_0000084_108791_109387 160
314 3300048929 Ga0496126_0001464 Ga0496126_0001464_15307_15789 160
315 3300048929 Ga0496126_0052607 Ga0496126_0052607_2463_2948 160
316 3300048929 Ga0496126_0076715 Ga0496126_0076715_1431_1913 160
317 3300048929 Ga0496126_0880150 Ga0496126_0880150_80_649 160
318 3300049578 Ga0501042_0557642 Ga0501042_0557642_133_615 160
319 3300049678 Ga0501248_040108 Ga0501248_040108_63_545 160
320 3300049742 Ga0501080_0439315 Ga0501080_0439315_114_596 160
321 3300049744 Ga0501083_0486263 Ga0501083_0486263_200_682 160
322 3300049823 Ga0501044_0001099 Ga0501044_0001099_3588_4070 160
323 3300049823 Ga0501044_0420941 Ga0501044_0420941_587_1069 160
324 3300049823 Ga0501044_0481404 Ga0501044_0481404_159_644 160
325 3300049823 Ga0501044_0727618 Ga0501044_0727618_12_497 160
326 3300050489 nmdc:mga03683_13_c1 nmdc:mga03683_13_c1_17068_17661 160
327 3300050489 nmdc:mga03683_289_c1 nmdc:mga03683_289_c1_6448_6930 160
328 3300050490 nmdc:mga03n38_3053_c1 nmdc:mga03n38_3053_c1_688_1281 160
329 3300050490 nmdc:mga03n38_9999_c1 nmdc:mga03n38_9999_c1_2023_2505 160
330 3300050491 nmdc:mga00v17_183841_c1 nmdc:mga00v17_183841_c1_795_1277 160
331 3300050492 nmdc:mga0yw44_189378_c1 nmdc:mga0yw44_189378_c1_426_908 160
332 3300050493 nmdc:mga0k408_22243_c1 nmdc:mga0k408_22243_c1_1804_2286 160
333 3300050493 nmdc:mga0k408_8_c1 nmdc:mga0k408_8_c1_27509_28006 160
334 3300050493 nmdc:mga0k408_9889_c1 nmdc:mga0k408_9889_c1_2984_3466 160
335 3300050494 nmdc:mga06z11_37216_c1 nmdc:mga06z11_37216_c1_780_1277 160
336 3300050494 nmdc:mga06z11_573_c1 nmdc:mga06z11_573_c1_3046_3528 160
337 3300050495 nmdc:mga04h51_76_c1 nmdc:mga04h51_76_c1_29144_29626 160
338 3300050496 nmdc:mga07m45_177292_c1 nmdc:mga07m45_177292_c1_659_1141 160
339 3300050496 nmdc:mga07m45_38287_c1 nmdc:mga07m45_38287_c1_1820_2311 160
340 3300050496 nmdc:mga07m45_38_c1 nmdc:mga07m45_38_c1_13191_13673 160
341 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_14923_15420 160
342 3300050496 nmdc:mga07m45_618_c1 nmdc:mga07m45_618_c1_14492_14974 160
343 3300050496 nmdc:mga07m45_89552_c1 nmdc:mga07m45_89552_c1_755_1237 160
344 3300050516 nmdc:mga0sz30_13183_c1 nmdc:mga0sz30_13183_c1_1533_2015 160
345 3300050516 nmdc:mga0sz30_1731_c1 nmdc:mga0sz30_1731_c1_1145_1738 160
346 3300053087 Ga0500643_008388 Ga0500643_008388_1676_2158 160
347 3300053087 Ga0500643_032949 Ga0500643_032949_100_591 160
348 3300053090 Ga0500646_0152380 Ga0500646_0152380_268_750 160
349 3300053118 Ga0500594_0025533 Ga0500594_0025533_285_770 160
350 3300053121 Ga0500607_000048 Ga0500607_000048_49486_49977 160
351 3300053122 Ga0500608_008056 Ga0500608_008056_2530_3015 160
352 3300053125 Ga0500618_003695 Ga0500618_003695_2701_3291 160
353 3300053136 Ga0500559_0001340 Ga0500559_0001340_12469_12960 160
354 3300053136 Ga0500559_0014168 Ga0500559_0014168_1382_1864 160
355 3300053138 Ga0500564_010236 Ga0500564_010236_2021_2506 160
356 3300053140 Ga0500573_0100187 Ga0500573_0100187_565_1050 160
357 3300053148 Ga0500590_114764 Ga0500590_114764_673_1164 160
358 3300053151 Ga0500604_0056569 Ga0500604_0056569_422_919 160
359 3300053151 Ga0500604_0168644 Ga0500604_0168644_147_629 160
360 3300053153 Ga0500616_0004303 Ga0500616_0004303_8652_9146 160
361 3300053153 Ga0500616_0259235 Ga0500616_0259235_73_558 160
362 3300053154 Ga0500619_049048 Ga0500619_049048_135_620 160
363 3300053156 Ga0500622_0001071 Ga0500622_0001071_20277_20759 160
364 3300053177 Ga0500636_0174926 Ga0500636_0174926_590_1075 160
365 3300053178 Ga0500637_0024485 Ga0500637_0024485_1482_1973 160
366 3300053723 Ga0500567_001083 Ga0500567_001083_6743_7228 160
367 3300053729 Ga0500625_000010 Ga0500625_000010_92765_93250 160
368 3300053730 Ga0500645_004767 Ga0500645_004767_3461_3952 160
369 3300053730 Ga0500645_035641 Ga0500645_035641_818_1300 160
370 iso_pu_bacteria 2818991438 2819552609 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

40

189

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.9673 9 159
4s2x-assembly1.cif.gz_A structure of e. coli rpph bound to rna and two magnesium ions 0.9506 9 159
6vcp-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with utp 0.9499 9 159
6vco-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpa 0.9486 9 159
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9469 1 159
ID Description Score Start End Superfamily
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9673 9 159 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9112 23 160 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8979 1 160 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8925 1 160 3.90.79.10
af_Q54FR0_1_169_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8891 6 158 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A031K3P6-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9949 2 160 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A561HMQ5-F1-model_v4 deleted 0.9932 1 160
AF-A0A437H1F7-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9931 9 160 GO:0016462
AF-D4Z1W0-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9921 1 160 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-T0KA05-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.991 1 160 GO:0006753
GO:0008893
GO:0019693
GO:0034432

Feature Viewer

pLDDT pTM Quality
91.4 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map