F425489

General Info

Members Datasets Scaffolds Average Seq Length
370 189 740 225

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0025009|Ga0439460_0025009_898_1599
Length 233
Sequence MLVIEKWARGFSPLRIKTLLFVVIVVATAYVLYHNERFLIDPANPVWQHYKDLGVFLLIHGVAGASALILAPMQFSERLRIRFTKLHRVVGRIYVTAALVLAPFGVYAQWLDERLGLFPRSFTIETVIQASILIITTAIGLAFARKRMIPQHRQWMTRSYAAALTFIWIRVVLGVTGWDQNVEQNAVIIETVVWCFTATSVLMGDIANQIYELQPTRSRRTRAQALPEPMAAE

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
145 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
146 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
147 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
154 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
157 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
158 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
162 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
163 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
166 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
167 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
168 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
169 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
170 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
171 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
174 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
175 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
176 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
177 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
178 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
179 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
180 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 5.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.65
Stem 0
Stem Tuber 0
Unclassified 23.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0025009 3300042461 Bacteria 1659
2 SwRhRL2b_contig_2537231 2162886007 Unclassified 2506
3 MRS1b_contig_4754859 2162886011 Bacteria 3861
4 CNBas_1000482 3300000531 Bacteria 1765
5 CNAas_1000955 3300000532 Bacteria 2690
6 Ga0058860_11576212 3300004801 Bacteria 718
7 Ga0065714_10064426 3300005288 Bacteria 186606
8 Ga0065712_10067761 3300005290 Bacteria 50583
9 Ga0065715_10088983 3300005293 Bacteria 18405
10 Ga0065715_10126597 3300005293 Bacteria 2105
11 Ga0065715_10269873 3300005293 Unclassified 1109
12 Ga0065707_10003410 3300005295 Unclassified 3781
13 Ga0065707_10150257 3300005295 Bacteria 1666
14 Ga0070670_100064238 3300005331 Bacteria 3150
15 Ga0070670_100066542 3300005331 Unclassified 3092
16 Ga0068869_100090114 3300005334 Bacteria 2304
17 Ga0068869_100145697 3300005334 Bacteria 1833
18 Ga0068869_100184723 3300005334 Bacteria 1636
19 Ga0068869_100191033 3300005334 Bacteria 1610
20 Ga0068869_100550427 3300005334 Unclassified 969
21 Ga0070680_100014762 3300005336 Bacteria 6110
22 Ga0070680_100240308 3300005336 Bacteria 1531
23 Ga0070682_100006973 3300005337 Bacteria 6353
24 Ga0070682_100008137 3300005337 Bacteria 5913
25 Ga0070682_100067352 3300005337 Bacteria 2280
26 Ga0070689_100000471 3300005340 Bacteria 23777
27 Ga0070689_100014181 3300005340 Bacteria 5785
28 Ga0070692_10045670 3300005345 Bacteria 2260
29 Ga0070692_10051505 3300005345 Bacteria 2141
30 Ga0070692_10472083 3300005345 Bacteria 807
31 Ga0070668_100000971 3300005347 Bacteria 20074
32 Ga0070669_100001313 3300005353 Bacteria 17950
33 Ga0070671_100010043 3300005355 Bacteria 7603
34 Ga0070673_100045249 3300005364 Bacteria 3412
35 Ga0070673_101183125 3300005364 Bacteria 716
36 Ga0070659_100043628 3300005366 Unclassified 3507
37 Ga0070703_10022366 3300005406 Bacteria 1855
38 Ga0070714_100800652 3300005435 Unclassified 913
39 Ga0070705_100006389 3300005440 Bacteria 5778
40 Ga0070700_100000080 3300005441 Bacteria 64459
41 Ga0070700_100024726 3300005441 Bacteria 3530
42 Ga0070700_100081211 3300005441 Bacteria 2094
43 Ga0070700_100085185 3300005441 Bacteria 2050
44 Ga0070700_100148488 3300005441 Unclassified 1601
45 Ga0070694_100364142 3300005444 Bacteria 1123
46 Ga0070681_10000059 3300005458 Bacteria 78995
47 Ga0070681_10302313 3300005458 Bacteria 1509
48 Ga0070681_10354181 3300005458 Unclassified 1378
49 Ga0070681_10357142 3300005458 Bacteria 1371
50 Ga0070681_10640970 3300005458 Bacteria 977
51 Ga0070706_100376256 3300005467 Bacteria 1323
52 Ga0070707_100139538 3300005468 Unclassified 2359
53 Ga0070698_100008542 3300005471 Bacteria 11051
54 Ga0070698_100014231 3300005471 Bacteria 8410
55 Ga0070698_100126246 3300005471 Bacteria 2515
56 Ga0070699_100007043 3300005518 Bacteria 9766
57 Ga0070699_100518553 3300005518 Bacteria 1083
58 Ga0070679_100001781 3300005530 Bacteria 19414
59 Ga0070679_100134580 3300005530 Bacteria 2453
60 Ga0070684_100354022 3300005535 Bacteria 1351
61 Ga0070697_100000211 3300005536 Bacteria 47665
62 Ga0070697_100194601 3300005536 Unclassified 1722
63 Ga0070697_100336478 3300005536 Bacteria 1302
64 Ga0068853_100030425 3300005539 Unclassified 4560
65 Ga0068853_100057533 3300005539 Bacteria 3355
66 Ga0068853_100385919 3300005539 Bacteria 1309
67 Ga0070686_100064193 3300005544 Unclassified 2381
68 Ga0070695_100048086 3300005545 Bacteria 2727
69 Ga0070695_100371489 3300005545 Bacteria 1077
70 Ga0070695_100380650 3300005545 Bacteria 1065
71 Ga0070695_100387080 3300005545 Bacteria 1057
72 Ga0070695_100488069 3300005545 Bacteria 951
73 Ga0070695_100513033 3300005545 Bacteria 929
74 Ga0070695_100551343 3300005545 Unclassified 899
75 Ga0070695_100839853 3300005545 Unclassified 738
76 Ga0070696_100081212 3300005546 Bacteria 2297
77 Ga0070696_100098394 3300005546 Unclassified 2093
78 Ga0070696_100131276 3300005546 Bacteria 1823
79 Ga0070696_100153548 3300005546 Bacteria 1691
80 Ga0070696_100216971 3300005546 Unclassified 1434
81 Ga0070693_100003018 3300005547 Bacteria 7803
82 Ga0070693_100043560 3300005547 Unclassified 2535
83 Ga0070693_100154589 3300005547 Bacteria 1456
84 Ga0070693_100454880 3300005547 Unclassified 899
85 Ga0070693_100475593 3300005547 Bacteria 882
86 Ga0070704_100208097 3300005549 Bacteria 1583
87 Ga0068855_100520000 3300005563 Bacteria 1291
88 Ga0070664_100011336 3300005564 Bacteria 7233
89 Ga0070664_100181218 3300005564 Bacteria 1872
90 Ga0070702_100020191 3300005615 Unclassified 3486
91 Ga0070702_100055309 3300005615 Bacteria 2288
92 Ga0070702_100117764 3300005615 Unclassified 1658
93 Ga0070702_100494717 3300005615 Bacteria 897
94 Ga0068852_100531903 3300005616 Unclassified 1174
95 Ga0068859_100155206 3300005617 Bacteria 2366
96 Ga0068859_100821164 3300005617 Unclassified 1016
97 Ga0068859_100944642 3300005617 Bacteria 946
98 Ga0068859_101086036 3300005617 Unclassified 880
99 Ga0068864_100117512 3300005618 Bacteria 2374
100 Ga0068864_100166422 3300005618 Bacteria 2007
101 Ga0068864_100184205 3300005618 Unclassified 1910
102 Ga0068864_100310487 3300005618 Bacteria 1478
103 Ga0068861_100022946 3300005719 Bacteria 4500
104 Ga0068861_100588676 3300005719 Bacteria 1019
105 Ga0068851_10016379 3300005834 Bacteria 3546
106 Ga0068863_100075706 3300005841 Bacteria 3185
107 Ga0068863_100098010 3300005841 Unclassified 2784
108 Ga0068863_100102906 3300005841 Unclassified 2716
109 Ga0068863_100580719 3300005841 Bacteria 1108
110 Ga0068858_100059637 3300005842 Bacteria 3527
111 Ga0068858_100202291 3300005842 Unclassified 1878
112 Ga0068858_100323332 3300005842 Bacteria 1475
113 Ga0068858_100392608 3300005842 Unclassified 1332
114 Ga0068860_100025335 3300005843 Bacteria 5724
115 Ga0068860_100056306 3300005843 Bacteria 3738
116 Ga0068860_100086384 3300005843 Bacteria 2985
117 Ga0070716_100020331 3300006173 Bacteria 3484
118 Ga0070716_100307254 3300006173 Bacteria 1106
119 Ga0097621_100003392 3300006237 Bacteria 10968
120 Ga0068871_100008534 3300006358 Bacteria 7365
121 Ga0075428_100956547 3300006844 Unclassified 907
122 Ga0075431_100049506 3300006847 Bacteria 4332
123 Ga0075433_10016669 3300006852 Bacteria 6064
124 Ga0075433_10156515 3300006852 Unclassified 2027
125 Ga0075433_10424756 3300006852 Bacteria 1172
126 Ga0075433_10441697 3300006852 Bacteria 1147
127 Ga0075433_10466114 3300006852 Unclassified 1113
128 Ga0075434_100098482 3300006871 Unclassified 2929
129 Ga0075434_100100622 3300006871 Bacteria 2896
130 Ga0075434_100253460 3300006871 Bacteria 1779
131 Ga0075434_100573657 3300006871 Unclassified 1147
132 Ga0075434_100975182 3300006871 Unclassified 862
133 Ga0075429_100060352 3300006880 Bacteria 3303
134 Ga0075429_100285154 3300006880 Unclassified 1446
135 Ga0075436_100021376 3300006914 Bacteria 4443
136 Ga0097620_100001336 3300006931 Bacteria 25188
137 Ga0097620_100155203 3300006931 Bacteria 2366
138 Ga0097620_100821165 3300006931 Unclassified 1016
139 Ga0097620_100944638 3300006931 Bacteria 946
140 Ga0097620_101085863 3300006931 Unclassified 880
141 Ga0105251_10193150 3300009011 Bacteria 917
142 Ga0105240_10411873 3300009093 Bacteria 1520
143 Ga0111539_10002522 3300009094 Bacteria 24263
144 Ga0105247_10172627 3300009101 Bacteria 1438
145 Ga0105247_10390645 3300009101 Unclassified 989
146 Ga0114129_10024214 3300009147 Bacteria 8603
147 Ga0114129_10187838 3300009147 Bacteria 2807
148 Ga0114129_10994110 3300009147 Unclassified 1057
149 Ga0114129_11203561 3300009147 Bacteria 943
150 Ga0114129_11670335 3300009147 Bacteria 778
151 Ga0105243_10003226 3300009148 Bacteria 13321
152 Ga0105243_10046151 3300009148 Unclassified 3426
153 Ga0105241_10031647 3300009174 Bacteria 3961
154 Ga0105241_10112235 3300009174 Unclassified 2184
155 Ga0105242_10121898 3300009176 Bacteria 2239
156 Ga0105242_10801560 3300009176 Unclassified 932
157 Ga0105248_10019938 3300009177 Bacteria 7424
158 Ga0105248_10078235 3300009177 Bacteria 3718
159 Ga0105248_10100584 3300009177 Bacteria 3258
160 Ga0105237_10001701 3300009545 Bacteria 28475
161 Ga0105237_10278254 3300009545 Bacteria 1676
162 Ga0105237_10553129 3300009545 Unclassified 1157
163 Ga0105249_10000156 3300009553 Bacteria 83676
164 Ga0105239_10349526 3300010375 Bacteria 1669
165 Ga0105246_10044445 3300011119 Bacteria 3019
166 Ga0105246_10066467 3300011119 Bacteria 2524
167 Ga0157373_10031233 3300013100 Bacteria 3834
168 Ga0157373_10136647 3300013100 Bacteria 1724
169 Ga0157373_10280438 3300013100 Bacteria 1181
170 Ga0157374_11072932 3300013296 Bacteria 825
171 Ga0157378_10292712 3300013297 Bacteria 1573
172 Ga0163162_10000009 3300013306 Bacteria 316099
173 Ga0163162_10019252 3300013306 Bacteria 6692
174 Ga0163162_10076202 3300013306 Bacteria 3416
175 Ga0163162_10085911 3300013306 Bacteria 3223
176 Ga0157375_10180808 3300013308 Bacteria 2260
177 Ga0157375_10261964 3300013308 Bacteria 1890
178 Ga0157375_10333050 3300013308 Bacteria 1683
179 Ga0163163_10045616 3300014325 Unclassified 4303
180 Ga0163163_10104136 3300014325 Unclassified 2862
181 Ga0163163_10123553 3300014325 Bacteria 2624
182 Ga0163163_10205236 3300014325 Unclassified 2019
183 Ga0157380_10004520 3300014326 Bacteria 9650
184 Ga0157380_10038644 3300014326 Bacteria 3707
185 Ga0157380_10181913 3300014326 Bacteria 1848
186 Ga0157380_10557046 3300014326 Bacteria 1126
187 Ga0157377_10018647 3300014745 Bacteria 3609
188 Ga0207656_10050414 3300025321 Unclassified 1797
189 Ga0207653_10047529 3300025885 Unclassified 1421
190 Ga0207647_10002858 3300025904 Bacteria 13010
191 Ga0207647_10040925 3300025904 Bacteria 2916
192 Ga0207643_10010057 3300025908 Bacteria 5087
193 Ga0207643_10079730 3300025908 Bacteria 1896
194 Ga0207654_10200051 3300025911 Bacteria 1315
195 Ga0207707_10000097 3300025912 Bacteria 88081
196 Ga0207707_10030590 3300025912 Bacteria 4710
197 Ga0207707_10030662 3300025912 Bacteria 4704
198 Ga0207707_10248513 3300025912 Unclassified 1545
199 Ga0207707_10526736 3300025912 Bacteria 1006
200 Ga0207695_10110806 3300025913 Bacteria 2724
201 Ga0207671_10002552 3300025914 Bacteria 19349
202 Ga0207671_10026996 3300025914 Bacteria 4296
203 Ga0207671_10508351 3300025914 Unclassified 961
204 Ga0207660_10004747 3300025917 Bacteria 8846
205 Ga0207660_10537460 3300025917 Unclassified 950
206 Ga0207662_10218572 3300025918 Unclassified 1240
207 Ga0207652_10000179 3300025921 Bacteria 67330
208 Ga0207652_10243071 3300025921 Unclassified 1623
209 Ga0207646_10273829 3300025922 Bacteria 1526
210 Ga0207681_10013702 3300025923 Bacteria 5020
211 Ga0207681_10213513 3300025923 Unclassified 1489
212 Ga0207650_10020032 3300025925 Bacteria 4711
213 Ga0207650_10218250 3300025925 Bacteria 1534
214 Ga0207650_10351077 3300025925 Unclassified 1213
215 Ga0207644_10193104 3300025931 Bacteria 1602
216 Ga0207709_10021267 3300025935 Bacteria 3671
217 Ga0207709_10493508 3300025935 Bacteria 954
218 Ga0207670_10007247 3300025936 Bacteria 6179
219 Ga0207670_10014141 3300025936 Unclassified 4727
220 Ga0207665_10030329 3300025939 Bacteria 3573
221 Ga0207691_10047504 3300025940 Bacteria 3939
222 Ga0207711_10014532 3300025941 Bacteria 6544
223 Ga0207689_10024321 3300025942 Bacteria 5083
224 Ga0207689_10118190 3300025942 Bacteria 2180
225 Ga0207689_10141822 3300025942 Bacteria 1979
226 Ga0207689_10206492 3300025942 Bacteria 1622
227 Ga0207689_10723974 3300025942 Unclassified 839
228 Ga0207679_10238521 3300025945 Bacteria 1539
229 Ga0207651_10022359 3300025960 Bacteria 3864
230 Ga0207712_10000123 3300025961 Bacteria 83597
231 Ga0207668_10005929 3300025972 Bacteria 7199
232 Ga0207703_10256001 3300026035 Unclassified 1580
233 Ga0207703_10558772 3300026035 Bacteria 1080
234 Ga0207639_10471072 3300026041 Bacteria 1143
235 Ga0207639_10530090 3300026041 Unclassified 1079
236 Ga0207708_10001953 3300026075 Bacteria 15207
237 Ga0207708_10023145 3300026075 Bacteria 4694
238 Ga0207708_10095036 3300026075 Unclassified 2302
239 Ga0207708_10101361 3300026075 Bacteria 2229
240 Ga0207708_10643051 3300026075 Unclassified 902
241 Ga0207641_10078410 3300026088 Bacteria 2861
242 Ga0207641_10148503 3300026088 Bacteria 2121
243 Ga0207641_10435659 3300026088 Unclassified 1264
244 Ga0207641_10963525 3300026088 Bacteria 849
245 Ga0207641_11250923 3300026088 Unclassified 742
246 Ga0207641_11336429 3300026088 Unclassified 717
247 Ga0207676_10003117 3300026095 Bacteria 11825
248 Ga0207676_10046098 3300026095 Unclassified 3371
249 Ga0207676_10074529 3300026095 Bacteria 2735
250 Ga0207674_10000198 3300026116 Bacteria 74606
251 Ga0207674_10219382 3300026116 Bacteria 1850
252 Ga0207674_10531675 3300026116 Bacteria 1136
253 Ga0207674_10806797 3300026116 Bacteria 906
254 Ga0207674_10884837 3300026116 Bacteria 861
255 Ga0207675_100018838 3300026118 Bacteria 6441
256 Ga0207675_100426958 3300026118 Bacteria 1310
257 Ga0207428_10065933 3300027907 Unclassified 2854
258 Ga0207428_10156653 3300027907 Bacteria 1732
259 Ga0268264_10045597 3300028381 Bacteria 3640
260 Ga0307408_100040408 3300031548 Bacteria 3303
261 Ga0307408_100228409 3300031548 Bacteria 1522
262 Ga0307408_100462099 3300031548 Bacteria 1103
263 Ga0307405_10014848 3300031731 Bacteria 4201
264 Ga0307410_10171696 3300031852 Bacteria 1634
265 Ga0307406_10002322 3300031901 Bacteria 10334
266 Ga0307407_10105764 3300031903 Bacteria 1756
267 Ga0307412_10017353 3300031911 Bacteria 4308
268 Ga0307412_10243819 3300031911 Bacteria 1391
269 Ga0307416_100225384 3300032002 Bacteria 1802
270 Ga0307414_10001349 3300032004 Bacteria 12695
271 Ga0307414_10063230 3300032004 Bacteria 2630
272 Ga0307414_10245428 3300032004 Bacteria 1485
273 Ga0373941_0019270 3300035115 Bacteria 1897
274 Ga0373931_0081978 3300035691 Bacteria 1782
275 Ga0395900_0127057 3300037418 Unclassified 2615
276 Ga0395900_0567587 3300037418 Bacteria 1078
277 Ga0395901_0395851 3300038443 Bacteria 1420
278 Ga0439458_0015734 3300042157 Bacteria 1717
279 Ga0451576_0074048 3300045051 Bacteria 3544
280 Ga0495610_0142727 3300046512 Unclassified 1029
281 Ga0495663_0010741 3300046525 Bacteria 2548
282 Ga0495598_0000138 3300046537 Bacteria 12434
283 Ga0495621_0008740 3300046539 Bacteria 3046
284 Ga0496104_0158545 3300048907 Bacteria 2171
285 Ga0496108_0062986 3300048911 Bacteria 3123
286 Ga0496110_0179437 3300048913 Bacteria 1923
287 Ga0496112_0204703 3300048915 Bacteria 1932
288 Ga0501306_024311 3300049127 Bacteria 865
289 Ga0501306_040312 3300049127 Unclassified 722
290 Ga0501308_016535 3300049128 Unclassified 885
291 Ga0501309_015568 3300049129 Unclassified 1030
292 Ga0501309_016484 3300049129 Bacteria 1008
293 Ga0501309_019559 3300049129 Bacteria 943
294 Ga0501309_037118 3300049129 Unclassified 736
295 Ga0501305_019306 3300049161 Bacteria 993
296 Ga0501305_025727 3300049161 Unclassified 894
297 Ga0501305_028686 3300049161 Unclassified 858
298 Ga0501305_030735 3300049161 Bacteria 836
299 Ga0501307_019713 3300049162 Bacteria 867
300 Ga0501307_034411 3300049162 Bacteria 715
301 Ga0501292_025134 3300049515 Bacteria 980
302 Ga0501297_003153 3300049520 Bacteria 1627
303 Ga0501299_011860 3300049522 Bacteria 1478
304 Ga0501311_016206 3300049527 Unclassified 970
305 Ga0501311_024902 3300049527 Bacteria 836
306 Ga0501312_017004 3300049528 Bacteria 1046
307 Ga0501313_021719 3300049529 Unclassified 796
308 Ga0501316_009400 3300049532 Unclassified 1096
309 Ga0501320_013971 3300049536 Bacteria 863
310 Ga0501324_005255 3300049540 Bacteria 1057
311 Ga0501198_002203 3300049649 Bacteria 2605
312 Ga0501198_002859 3300049649 Bacteria 2346
313 Ga0501199_003959 3300049650 Bacteria 1443
314 Ga0501202_000913 3300049652 Bacteria 4524
315 Ga0501202_007056 3300049652 Bacteria 2024
316 Ga0501207_000454 3300049654 Bacteria 4578
317 Ga0501207_019272 3300049654 Bacteria 1080
318 Ga0501208_023503 3300049655 Bacteria 1032
319 Ga0501208_039746 3300049655 Bacteria 865
320 Ga0501216_000913 3300049660 Bacteria 3759
321 Ga0501216_057098 3300049660 Bacteria 779
322 Ga0501217_000049 3300049661 Bacteria 13643
323 Ga0501217_006414 3300049661 Bacteria 2498
324 Ga0501217_009345 3300049661 Bacteria 2131
325 Ga0501223_000459 3300049663 Bacteria 9845
326 Ga0501223_049348 3300049663 Bacteria 817
327 Ga0501224_003571 3300049664 Bacteria 2177
328 Ga0501227_000317 3300049665 Bacteria 10069
329 Ga0501230_002886 3300049667 Bacteria 2231
330 Ga0501233_003873 3300049668 Bacteria 2711
331 Ga0501235_000745 3300049669 Bacteria 6630
332 Ga0501235_009916 3300049669 Bacteria 2083
333 Ga0501235_030484 3300049669 Bacteria 1216
334 Ga0501240_000185 3300049673 Bacteria 4451
335 Ga0501243_010175 3300049675 Bacteria 1466
336 Ga0501253_036505 3300049683 Bacteria 968
337 Ga0501253_039464 3300049683 Bacteria 944
338 Ga0501257_003462 3300049686 Bacteria 3387
339 Ga0501259_002132 3300049688 Bacteria 3255
340 Ga0501221_004324 3300049704 Bacteria 2355
341 Ga0501225_0001753 3300049705 Bacteria 6799
342 Ga0501229_013208 3300049706 Bacteria 1059
343 Ga0501234_000285 3300049707 Bacteria 7416
344 Ga0501262_025876 3300049759 Bacteria 826
345 Ga0501268_005560 3300049765 Bacteria 1817
346 Ga0501272_011101 3300049769 Bacteria 1011
347 Ga0501204_009256 3300049850 Bacteria 1135
348 Ga0501212_002828 3300049851 Bacteria 2127
349 Ga0501226_000398 3300049853 Bacteria 6287
350 nmdc:mga05p37_166432_c1 3300050507 Bacteria 2690
351 nmdc:mga09592_311224_c1 3300050508 Bacteria 1365
352 nmdc:mga09592_653408_c1 3300050508 Unclassified 898
353 nmdc:mga0qj67_77405_c1 3300050509 Unclassified 2661
354 nmdc:mga06r32_201499_c1 3300050510 Bacteria 1978
355 nmdc:mga08y16_1198_c1 3300050511 Bacteria 25587
356 nmdc:mga08y16_561230_c1 3300050511 Unclassified 1154
357 nmdc:mga08y16_738465_c1 3300050511 Bacteria 981
358 nmdc:mga0n895_161036_c1 3300050512 Unclassified 2276
359 nmdc:mga0n895_439250_c1 3300050512 Unclassified 1318
360 nmdc:mga0n895_577699_c1 3300050512 Bacteria 1128
361 nmdc:mga0n895_609158_c1 3300050512 Bacteria 1094
362 nmdc:mga0n895_876990_c1 3300050512 Unclassified 884
363 nmdc:mga08x19_118545_c1 3300050514 Bacteria 1772
364 nmdc:mga0a205_19096_c1 3300050515 Bacteria 6461
365 nmdc:mga0a205_269132_c1 3300050515 Bacteria 1581
366 nmdc:mga0a205_50016_c1 3300050515 Unclassified 4036
367 nmdc:mga0a205_702048_c1 3300050515 Bacteria 861
368 nmdc:mga0a205_97610_c1 3300050515 Bacteria 2837
369 Ga0530510_0370262 3300061734 Unclassified 1078
370 Ga0530510_0629885 3300061734 Unclassified 816
371 Ga0439460_0025009
372 SwRhRL2b_contig_2537231
373 MRS1b_contig_4754859
374 CNBas_1000482
375 CNAas_1000955
376 Ga0058860_11576212
377 Ga0065714_10064426
378 Ga0065712_10067761
379 Ga0065715_10088983
380 Ga0065715_10126597
381 Ga0065715_10269873
382 Ga0065707_10003410
383 Ga0065707_10150257
384 Ga0070670_100064238
385 Ga0070670_100066542
386 Ga0068869_100090114
387 Ga0068869_100145697
388 Ga0068869_100184723
389 Ga0068869_100191033
390 Ga0068869_100550427
391 Ga0070680_100014762
392 Ga0070680_100240308
393 Ga0070682_100006973
394 Ga0070682_100008137
395 Ga0070682_100067352
396 Ga0070689_100000471
397 Ga0070689_100014181
398 Ga0070692_10045670
399 Ga0070692_10051505
400 Ga0070692_10472083
401 Ga0070668_100000971
402 Ga0070669_100001313
403 Ga0070671_100010043
404 Ga0070673_100045249
405 Ga0070673_101183125
406 Ga0070659_100043628
407 Ga0070703_10022366
408 Ga0070714_100800652
409 Ga0070705_100006389
410 Ga0070700_100000080
411 Ga0070700_100024726
412 Ga0070700_100081211
413 Ga0070700_100085185
414 Ga0070700_100148488
415 Ga0070694_100364142
416 Ga0070681_10000059
417 Ga0070681_10302313
418 Ga0070681_10354181
419 Ga0070681_10357142
420 Ga0070681_10640970
421 Ga0070706_100376256
422 Ga0070707_100139538
423 Ga0070698_100008542
424 Ga0070698_100014231
425 Ga0070698_100126246
426 Ga0070699_100007043
427 Ga0070699_100518553
428 Ga0070679_100001781
429 Ga0070679_100134580
430 Ga0070684_100354022
431 Ga0070697_100000211
432 Ga0070697_100194601
433 Ga0070697_100336478
434 Ga0068853_100030425
435 Ga0068853_100057533
436 Ga0068853_100385919
437 Ga0070686_100064193
438 Ga0070695_100048086
439 Ga0070695_100371489
440 Ga0070695_100380650
441 Ga0070695_100387080
442 Ga0070695_100488069
443 Ga0070695_100513033
444 Ga0070695_100551343
445 Ga0070695_100839853
446 Ga0070696_100081212
447 Ga0070696_100098394
448 Ga0070696_100131276
449 Ga0070696_100153548
450 Ga0070696_100216971
451 Ga0070693_100003018
452 Ga0070693_100043560
453 Ga0070693_100154589
454 Ga0070693_100454880
455 Ga0070693_100475593
456 Ga0070704_100208097
457 Ga0068855_100520000
458 Ga0070664_100011336
459 Ga0070664_100181218
460 Ga0070702_100020191
461 Ga0070702_100055309
462 Ga0070702_100117764
463 Ga0070702_100494717
464 Ga0068852_100531903
465 Ga0068859_100155206
466 Ga0068859_100821164
467 Ga0068859_100944642
468 Ga0068859_101086036
469 Ga0068864_100117512
470 Ga0068864_100166422
471 Ga0068864_100184205
472 Ga0068864_100310487
473 Ga0068861_100022946
474 Ga0068861_100588676
475 Ga0068851_10016379
476 Ga0068863_100075706
477 Ga0068863_100098010
478 Ga0068863_100102906
479 Ga0068863_100580719
480 Ga0068858_100059637
481 Ga0068858_100202291
482 Ga0068858_100323332
483 Ga0068858_100392608
484 Ga0068860_100025335
485 Ga0068860_100056306
486 Ga0068860_100086384
487 Ga0070716_100020331
488 Ga0070716_100307254
489 Ga0097621_100003392
490 Ga0068871_100008534
491 Ga0075428_100956547
492 Ga0075431_100049506
493 Ga0075433_10016669
494 Ga0075433_10156515
495 Ga0075433_10424756
496 Ga0075433_10441697
497 Ga0075433_10466114
498 Ga0075434_100098482
499 Ga0075434_100100622
500 Ga0075434_100253460
501 Ga0075434_100573657
502 Ga0075434_100975182
503 Ga0075429_100060352
504 Ga0075429_100285154
505 Ga0075436_100021376
506 Ga0097620_100001336
507 Ga0097620_100155203
508 Ga0097620_100821165
509 Ga0097620_100944638
510 Ga0097620_101085863
511 Ga0105251_10193150
512 Ga0105240_10411873
513 Ga0111539_10002522
514 Ga0105247_10172627
515 Ga0105247_10390645
516 Ga0114129_10024214
517 Ga0114129_10187838
518 Ga0114129_10994110
519 Ga0114129_11203561
520 Ga0114129_11670335
521 Ga0105243_10003226
522 Ga0105243_10046151
523 Ga0105241_10031647
524 Ga0105241_10112235
525 Ga0105242_10121898
526 Ga0105242_10801560
527 Ga0105248_10019938
528 Ga0105248_10078235
529 Ga0105248_10100584
530 Ga0105237_10001701
531 Ga0105237_10278254
532 Ga0105237_10553129
533 Ga0105249_10000156
534 Ga0105239_10349526
535 Ga0105246_10044445
536 Ga0105246_10066467
537 Ga0157373_10031233
538 Ga0157373_10136647
539 Ga0157373_10280438
540 Ga0157374_11072932
541 Ga0157378_10292712
542 Ga0163162_10000009
543 Ga0163162_10019252
544 Ga0163162_10076202
545 Ga0163162_10085911
546 Ga0157375_10180808
547 Ga0157375_10261964
548 Ga0157375_10333050
549 Ga0163163_10045616
550 Ga0163163_10104136
551 Ga0163163_10123553
552 Ga0163163_10205236
553 Ga0157380_10004520
554 Ga0157380_10038644
555 Ga0157380_10181913
556 Ga0157380_10557046
557 Ga0157377_10018647
558 Ga0207656_10050414
559 Ga0207653_10047529
560 Ga0207647_10002858
561 Ga0207647_10040925
562 Ga0207643_10010057
563 Ga0207643_10079730
564 Ga0207654_10200051
565 Ga0207707_10000097
566 Ga0207707_10030590
567 Ga0207707_10030662
568 Ga0207707_10248513
569 Ga0207707_10526736
570 Ga0207695_10110806
571 Ga0207671_10002552
572 Ga0207671_10026996
573 Ga0207671_10508351
574 Ga0207660_10004747
575 Ga0207660_10537460
576 Ga0207662_10218572
577 Ga0207652_10000179
578 Ga0207652_10243071
579 Ga0207646_10273829
580 Ga0207681_10013702
581 Ga0207681_10213513
582 Ga0207650_10020032
583 Ga0207650_10218250
584 Ga0207650_10351077
585 Ga0207644_10193104
586 Ga0207709_10021267
587 Ga0207709_10493508
588 Ga0207670_10007247
589 Ga0207670_10014141
590 Ga0207665_10030329
591 Ga0207691_10047504
592 Ga0207711_10014532
593 Ga0207689_10024321
594 Ga0207689_10118190
595 Ga0207689_10141822
596 Ga0207689_10206492
597 Ga0207689_10723974
598 Ga0207679_10238521
599 Ga0207651_10022359
600 Ga0207712_10000123
601 Ga0207668_10005929
602 Ga0207703_10256001
603 Ga0207703_10558772
604 Ga0207639_10471072
605 Ga0207639_10530090
606 Ga0207708_10001953
607 Ga0207708_10023145
608 Ga0207708_10095036
609 Ga0207708_10101361
610 Ga0207708_10643051
611 Ga0207641_10078410
612 Ga0207641_10148503
613 Ga0207641_10435659
614 Ga0207641_10963525
615 Ga0207641_11250923
616 Ga0207641_11336429
617 Ga0207676_10003117
618 Ga0207676_10046098
619 Ga0207676_10074529
620 Ga0207674_10000198
621 Ga0207674_10219382
622 Ga0207674_10531675
623 Ga0207674_10806797
624 Ga0207674_10884837
625 Ga0207675_100018838
626 Ga0207675_100426958
627 Ga0207428_10065933
628 Ga0207428_10156653
629 Ga0268264_10045597
630 Ga0307408_100040408
631 Ga0307408_100228409
632 Ga0307408_100462099
633 Ga0307405_10014848
634 Ga0307410_10171696
635 Ga0307406_10002322
636 Ga0307407_10105764
637 Ga0307412_10017353
638 Ga0307412_10243819
639 Ga0307416_100225384
640 Ga0307414_10001349
641 Ga0307414_10063230
642 Ga0307414_10245428
643 Ga0373941_0019270
644 Ga0373931_0081978
645 Ga0395900_0127057
646 Ga0395900_0567587
647 Ga0395901_0395851
648 Ga0439458_0015734
649 Ga0451576_0074048
650 Ga0495610_0142727
651 Ga0495663_0010741
652 Ga0495598_0000138
653 Ga0495621_0008740
654 Ga0496104_0158545
655 Ga0496108_0062986
656 Ga0496110_0179437
657 Ga0496112_0204703
658 Ga0501306_024311
659 Ga0501306_040312
660 Ga0501308_016535
661 Ga0501309_015568
662 Ga0501309_016484
663 Ga0501309_019559
664 Ga0501309_037118
665 Ga0501305_019306
666 Ga0501305_025727
667 Ga0501305_028686
668 Ga0501305_030735
669 Ga0501307_019713
670 Ga0501307_034411
671 Ga0501292_025134
672 Ga0501297_003153
673 Ga0501299_011860
674 Ga0501311_016206
675 Ga0501311_024902
676 Ga0501312_017004
677 Ga0501313_021719
678 Ga0501316_009400
679 Ga0501320_013971
680 Ga0501324_005255
681 Ga0501198_002203
682 Ga0501198_002859
683 Ga0501199_003959
684 Ga0501202_000913
685 Ga0501202_007056
686 Ga0501207_000454
687 Ga0501207_019272
688 Ga0501208_023503
689 Ga0501208_039746
690 Ga0501216_000913
691 Ga0501216_057098
692 Ga0501217_000049
693 Ga0501217_006414
694 Ga0501217_009345
695 Ga0501223_000459
696 Ga0501223_049348
697 Ga0501224_003571
698 Ga0501227_000317
699 Ga0501230_002886
700 Ga0501233_003873
701 Ga0501235_000745
702 Ga0501235_009916
703 Ga0501235_030484
704 Ga0501240_000185
705 Ga0501243_010175
706 Ga0501253_036505
707 Ga0501253_039464
708 Ga0501257_003462
709 Ga0501259_002132
710 Ga0501221_004324
711 Ga0501225_0001753
712 Ga0501229_013208
713 Ga0501234_000285
714 Ga0501262_025876
715 Ga0501268_005560
716 Ga0501272_011101
717 Ga0501204_009256
718 Ga0501212_002828
719 Ga0501226_000398
720 nmdc:mga05p37_166432_c1
721 nmdc:mga09592_311224_c1
722 nmdc:mga09592_653408_c1
723 nmdc:mga0qj67_77405_c1
724 nmdc:mga06r32_201499_c1
725 nmdc:mga08y16_1198_c1
726 nmdc:mga08y16_561230_c1
727 nmdc:mga08y16_738465_c1
728 nmdc:mga0n895_161036_c1
729 nmdc:mga0n895_439250_c1
730 nmdc:mga0n895_577699_c1
731 nmdc:mga0n895_609158_c1
732 nmdc:mga0n895_876990_c1
733 nmdc:mga08x19_118545_c1
734 nmdc:mga0a205_19096_c1
735 nmdc:mga0a205_269132_c1
736 nmdc:mga0a205_50016_c1
737 nmdc:mga0a205_702048_c1
738 nmdc:mga0a205_97610_c1
739 Ga0530510_0370262
740 Ga0530510_0629885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10067

DUF2306

Predicted membrane protein (DUF2306)

57

206

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kc9-assembly1.cif.gz_A structure of hhari, a ring-ibr-ring ubiquitin ligase: autoinhibition of an ariadne-family e3 and insights into ligation mechanism 0.4565 64 202
8fbi-assembly1.cif.gz_A-3 improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains 0.3891 10 205
6wwz-assembly1.cif.gz_R cryo-em structure of the human chemokine receptor ccr6 in complex with ccl20 and a go protein 0.3629 5 210
6h7j-assembly2.cif.gz_B activated turkey beta1 adrenoceptor with bound agonist isoprenaline and nanobody nb80 0.3445 4 203
4buo-assembly1.cif.gz_A high resolution structure of thermostable agonist-bound neurotensin receptor 1 mutant without lysozyme fusion 0.3423 6 202
ID Description Score Start End Superfamily
af_Q93319_9_241_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.662 6 134 1.20.1070.10
af_A0A2R8RK24_6_216_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6545 6 156 1.20.1070.10
af_Q86XQ3_42_162_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.642 58 131 1.20.120.350
af_K7LKV5_39_184_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5182 79 186 1.20.140.40
af_B0V158_1_212_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5028 80 192 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2V9B2J8-F1-model_v4 DUF2306 domain-containing protein 0.8981 3 182 GO:0016020
AF-A0A2V9Z996-F1-model_v4 DUF2306 domain-containing protein 0.883 3 203 GO:0016020
AF-A0A2V9SHX7-F1-model_v4 DUF2306 domain-containing protein 0.8677 9 204 GO:0016020
AF-A0A1Q7N6K2-F1-model_v4 DUF2306 domain-containing protein 0.8595 18 204 GO:0016020
AF-A0A2V8QEX7-F1-model_v4 DUF2306 domain-containing protein 0.8536 1 222 GO:0016020

Map