F425333

General Info

Members Datasets Scaffolds Average Seq Length
370 196 365 118

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10182729|Ga0081455_101827292
Length 139
Sequence MGFMAEASTKRPRNSCTLTSVRVSDGSTPRFLQGPFEFEGNGLDKPSLIDESLRYVVPPGAVTQPVYFRGGNSSKQMITVVLFRDGQPMRYFPIAARGATHVALRVVEDLLGDTVLELHVAAPSGCSGTVVVDLGLVEV

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
5 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
110 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
114 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.92
Nodule 0.27
Rhizoplane 14.59
Rhizosphere 51.35
Stem 0
Stem Tuber 0
Unclassified 14.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10032833 3300002239 Bacteria 851
2 rootL2_10156717 3300003322 Bacteria 1350
3 Ga0055540_1001762 3300003792 Bacteria 12361
4 Ga0070690_100487057 3300005330 Bacteria 920
5 Ga0070682_100027784 3300005337 Bacteria 3398
6 Ga0070682_100080899 3300005337 Bacteria 2102
7 Ga0070682_100861744 3300005337 Bacteria 741
8 Ga0070668_100000217 3300005347 Bacteria 37098
9 Ga0070668_100002814 3300005347 Bacteria 12806
10 Ga0070669_100002156 3300005353 Bacteria 14243
11 Ga0070674_100437275 3300005356 Bacteria 1077
12 Ga0070688_100912961 3300005365 Bacteria 693
13 Ga0070667_100000464 3300005367 Bacteria 41703
14 Ga0070667_100062648 3300005367 Bacteria 3151
15 Ga0070667_100274446 3300005367 Bacteria 1512
16 Ga0070711_101434419 3300005439 Bacteria 601
17 Ga0070685_10081452 3300005466 Bacteria 1941
18 Ga0070685_11436732 3300005466 Bacteria 530
19 Ga0070685_11513203 3300005466 Bacteria 517
20 Ga0070707_100224498 3300005468 Bacteria 1829
21 Ga0068853_100831257 3300005539 Bacteria 885
22 Ga0070665_100048331 3300005548 Bacteria 4272
23 Ga0070665_102135047 3300005548 Bacteria 564
24 Ga0068855_100146859 3300005563 Bacteria 2683
25 Ga0068854_101665942 3300005578 Bacteria 582
26 Ga0068852_100316605 3300005616 Bacteria 1514
27 Ga0068859_100000748 3300005617 Bacteria 32788
28 Ga0068859_100670342 3300005617 Bacteria 1129
29 Ga0068864_100532019 3300005618 Bacteria 1134
30 Ga0068861_100631622 3300005719 Bacteria 987
31 Ga0068863_100000397 3300005841 Bacteria 44254
32 Ga0068858_100003095 3300005842 Bacteria 16641
33 Ga0068858_100518054 3300005842 Bacteria 1153
34 Ga0068860_100000011 3300005843 Bacteria 328172
35 Ga0068860_100552763 3300005843 Bacteria 1153
36 Ga0068862_100000054 3300005844 Bacteria 143584
37 Ga0081455_10182729 3300005937 Bacteria 1586
38 Ga0075365_10024960 3300006038 Bacteria 3779
39 Ga0075365_10052898 3300006038 Bacteria 2688
40 Ga0075365_10391126 3300006038 Bacteria 981
41 Ga0075363_100072879 3300006048 Bacteria 1868
42 Ga0075363_100190239 3300006048 Bacteria 1170
43 Ga0075364_10002712 3300006051 Bacteria 9948
44 Ga0075364_10354119 3300006051 Bacteria 1001
45 Ga0075364_10385438 3300006051 Bacteria 956
46 Ga0075364_10555233 3300006051 Bacteria 785
47 Ga0070715_10284301 3300006163 Bacteria 878
48 Ga0075362_10009119 3300006177 Bacteria 3821
49 Ga0075362_10176389 3300006177 Bacteria 1034
50 Ga0075367_10160955 3300006178 Bacteria 1396
51 Ga0075367_10201946 3300006178 Bacteria 1242
52 Ga0075369_10000601 3300006186 Bacteria 11423
53 Ga0075369_10002195 3300006186 Bacteria 6900
54 Ga0075369_10018417 3300006186 Bacteria 2843
55 Ga0075369_10037531 3300006186 Bacteria 2064
56 Ga0075369_10037621 3300006186 Bacteria 2062
57 Ga0075369_10082576 3300006186 Bacteria 1426
58 Ga0075369_10106528 3300006186 Bacteria 1261
59 Ga0075369_10204806 3300006186 Bacteria 911
60 Ga0097621_100990292 3300006237 Bacteria 786
61 Ga0097621_101296695 3300006237 Bacteria 688
62 Ga0075370_10275262 3300006353 Bacteria 999
63 Ga0075428_100005134 3300006844 Bacteria 14555
64 Ga0075430_100089211 3300006846 Bacteria 2580
65 Ga0075430_100169519 3300006846 Bacteria 1816
66 Ga0075431_100034676 3300006847 Bacteria 5199
67 Ga0075429_100580488 3300006880 Bacteria 982
68 Ga0097620_100000748 3300006931 Bacteria 32788
69 Ga0097620_100670333 3300006931 Bacteria 1129
70 Ga0105250_10029694 3300009092 Bacteria 2200
71 Ga0105250_10060408 3300009092 Bacteria 1523
72 Ga0105240_10386365 3300009093 Bacteria 1580
73 Ga0105240_11166870 3300009093 Bacteria 817
74 Ga0111539_10321194 3300009094 Bacteria 1802
75 Ga0111539_13253021 3300009094 Bacteria 523
76 Ga0105245_11351207 3300009098 Bacteria 762
77 Ga0105247_10000085 3300009101 Bacteria 102010
78 Ga0105247_10108710 3300009101 Bacteria 1782
79 Ga0105247_10231582 3300009101 Bacteria 1255
80 Ga0114129_10037994 3300009147 Bacteria 6792
81 Ga0105243_10102696 3300009148 Bacteria 2376
82 Ga0105243_10247525 3300009148 Bacteria 1590
83 Ga0105248_10000233 3300009177 Bacteria 63881
84 Ga0105248_11431132 3300009177 Bacteria 782
85 Ga0105237_10001322 3300009545 Bacteria 32861
86 Ga0105237_10018239 3300009545 Bacteria 7261
87 Ga0105237_11734170 3300009545 Bacteria 632
88 Ga0105249_10000001 3300009553 Bacteria 504948
89 Ga0105249_10034654 3300009553 Bacteria 4575
90 Ga0105249_10377656 3300009553 Bacteria 1442
91 Ga0099796_10032420 3300010159 Bacteria 1712
92 Ga0105239_10030770 3300010375 Bacteria 5903
93 Ga0105239_10381832 3300010375 Bacteria 1593
94 Ga0105246_10995014 3300011119 Bacteria 759
95 Ga0105246_11149932 3300011119 Bacteria 711
96 Ga0163162_10348221 3300013306 Bacteria 1614
97 Ga0163162_10572294 3300013306 Bacteria 1257
98 Ga0157372_12999258 3300013307 Bacteria 540
99 Ga0163163_10061754 3300014325 Bacteria 3713
100 Ga0163163_10838164 3300014325 Bacteria 983
101 Ga0157380_10289676 3300014326 Bacteria 1503
102 Ga0157379_10160716 3300014968 Bacteria 2028
103 Ga0157379_10264659 3300014968 Bacteria 1563
104 Ga0157379_10433159 3300014968 Bacteria 1212
105 Ga0213876_10015168 3300021384 Bacteria 4082
106 Ga0213876_10044732 3300021384 Bacteria 2340
107 Ga0213876_10248690 3300021384 Bacteria 945
108 Ga0213875_10025950 3300021388 Bacteria 2789
109 Ga0209051_1000594 3300025303 Bacteria 42766
110 Ga0209051_1010920 3300025303 Bacteria 4532
111 Ga0207697_10471677 3300025315 Unclassified 556
112 Ga0207696_1065601 3300025711 Bacteria 1015
113 Ga0207710_10000125 3300025900 Bacteria 93726
114 Ga0207710_10329648 3300025900 Bacteria 775
115 Ga0207695_10521493 3300025913 Bacteria 1070
116 Ga0207671_10020933 3300025914 Bacteria 4972
117 Ga0207671_10076401 3300025914 Bacteria 2506
118 Ga0207646_10493587 3300025922 Bacteria 1103
119 Ga0207681_10001914 3300025923 Bacteria 13328
120 Ga0207687_10846364 3300025927 Bacteria 781
121 Ga0207664_10225810 3300025929 Bacteria 1626
122 Ga0207669_10079067 3300025937 Bacteria 2098
123 Ga0207711_10000356 3300025941 Bacteria 48645
124 Ga0207712_10000006 3300025961 Bacteria 573204
125 Ga0207712_10011934 3300025961 Bacteria 5541
126 Ga0207668_10000743 3300025972 Bacteria 19893
127 Ga0207668_10002279 3300025972 Bacteria 11196
128 Ga0207668_11208588 3300025972 Bacteria 679
129 Ga0207658_10005240 3300025986 Bacteria 8920
130 Ga0207658_10021428 3300025986 Bacteria 4487
131 Ga0207658_10747633 3300025986 Bacteria 885
132 Ga0207658_11840574 3300025986 Bacteria 552
133 Ga0207703_10008038 3300026035 Bacteria 8337
134 Ga0207639_10099549 3300026041 Bacteria 2346
135 Ga0207678_10092381 3300026067 Bacteria 2587
136 Ga0207641_10000264 3300026088 Bacteria 66489
137 Ga0207641_10723088 3300026088 Bacteria 981
138 Ga0207676_10063147 3300026095 Bacteria 2941
139 Ga0207675_100603251 3300026118 Bacteria 1101
140 Ga0207698_11369478 3300026142 Bacteria 722
141 Ga0209813_10198593 3300027866 Bacteria 741
142 Ga0268266_10034443 3300028379 Bacteria 4307
143 Ga0268265_10000032 3300028380 Bacteria 225953
144 Ga0268265_10303286 3300028380 Bacteria 1439
145 Ga0268265_11471876 3300028380 Bacteria 684
146 Ga0268264_10000026 3300028381 Bacteria 459088
147 Ga0268264_10017674 3300028381 Bacteria 5839
148 Ga0307515_10000038 3300028794 Bacteria 331376
149 Ga0307513_10348723 3300031456 Bacteria 1229
150 Ga0307509_10051588 3300031507 Bacteria 4397
151 Ga0307514_10401255 3300031649 Bacteria 700
152 Ga0307516_10000553 3300031730 Bacteria 50262
153 Ga0307406_10062667 3300031901 Bacteria 2406
154 Ga0307406_10237120 3300031901 Bacteria 1366
155 Ga0307407_11218438 3300031903 Bacteria 588
156 Ga0307409_100030523 3300031995 Bacteria 3874
157 Ga0307409_100429298 3300031995 Bacteria 1270
158 Ga0307409_101181308 3300031995 Bacteria 788
159 Ga0307409_101415120 3300031995 Bacteria 722
160 Ga0307416_100629518 3300032002 Bacteria 1156
161 Ga0307416_101391995 3300032002 Bacteria 807
162 Ga0307416_102079796 3300032002 Bacteria 670
163 Ga0307411_11440238 3300032005 Bacteria 631
164 Ga0436364_1085111 3300037853 Bacteria 8003
165 Ga0436364_1192519 3300037853 Bacteria 17220
166 Ga0436365_0161820 3300039437 Bacteria 55653
167 Ga0436365_0307104 3300039437 Bacteria 3148
168 Ga0436365_1042870 3300039437 Bacteria 2003
169 Ga0436365_1138315 3300039437 Bacteria 15926
170 Ga0436361_1174023 3300039447 Bacteria 1293
171 Ga0436363_1105110 3300039450 Bacteria 702
172 Ga0436363_1419040 3300039450 Bacteria 1541
173 Ga0439461_0001581 3300041410 Bacteria 3529
174 Ga0439461_0109459 3300041410 Bacteria 680
175 Ga0439466_0047314 3300041411 Bacteria 1418
176 Ga0439466_0057053 3300041411 Bacteria 1265
177 Ga0439466_0089387 3300041411 Bacteria 966
178 Ga0439465_0004721 3300041413 Bacteria 4396
179 Ga0439465_0007138 3300041413 Bacteria 3550
180 Ga0439465_0090828 3300041413 Bacteria 1044
181 Ga0439465_0306890 3300041413 Bacteria 594
182 Ga0439465_0414728 3300041413 Bacteria 514
183 Ga0451787_282995 3300041441 Bacteria 574
184 Ga0451789_0742976 3300041443 Bacteria 709
185 Ga0451789_0775185 3300041443 Bacteria 547
186 Ga0451789_1241128 3300041443 Bacteria 524
187 Ga0451791_1695324 3300041451 Bacteria 1033
188 Ga0451793_0068740 3300041452 Bacteria 1305
189 Ga0451797_0327483 3300041453 Bacteria 1257
190 Ga0451795_0015248 3300041456 Bacteria 1881
191 Ga0451795_0625618 3300041456 Bacteria 509
192 Ga0451802_0531777 3300041460 Bacteria 1940
193 Ga0451807_1923485 3300041486 Bacteria 1384
194 Ga0451833_0296847 3300041491 Bacteria 687
195 Ga0451837_0440423 3300041494 Bacteria 1884
196 Ga0451843_1728864 3300041509 Bacteria 511
197 Ga0451853_2686230 3300041512 Bacteria 877
198 Ga0451853_2878662 3300041512 Bacteria 631
199 Ga0439431_0003108 3300041997 Bacteria 3649
200 Ga0439445_0005801 3300042004 Bacteria 2823
201 Ga0439445_0052783 3300042004 Bacteria 1100
202 Ga0439448_0025802 3300042005 Bacteria 1845
203 Ga0439434_0004432 3300042435 Bacteria 4105
204 Ga0439459_0091239 3300042438 Bacteria 733
205 Ga0466972_0033215 3300044658 Bacteria 2531
206 Ga0466972_0066433 3300044658 Bacteria 1724
207 Ga0466972_0110242 3300044658 Bacteria 1301
208 Ga0466965_0026864 3300044683 Bacteria 2791
209 Ga0466963_0038621 3300044694 Bacteria 3123
210 Ga0466963_1176488 3300044694 Bacteria 539
211 Ga0466964_0172288 3300044706 Bacteria 1020
212 Ga0466964_0547332 3300044706 Bacteria 628
213 Ga0466971_0011555 3300044719 Bacteria 3866
214 Ga0466971_0072320 3300044719 Bacteria 1567
215 Ga0466968_0001284 3300044735 Bacteria 8944
216 Ga0466970_0666901 3300044765 Bacteria 605
217 Ga0466970_0738383 3300044765 Bacteria 575
218 Ga0466957_0032279 3300044842 Bacteria 3135
219 Ga0466957_0039932 3300044842 Bacteria 2832
220 Ga0466957_0200241 3300044842 Bacteria 1311
221 Ga0466960_0000316 3300044901 Bacteria 16570
222 Ga0466960_0084093 3300044901 Bacteria 1609
223 Ga0466960_0413380 3300044901 Bacteria 779
224 Ga0466960_0669404 3300044901 Bacteria 621
225 Ga0466959_0015456 3300045049 Bacteria 5561
226 Ga0466958_0024125 3300045836 Bacteria 3577
227 Ga0466958_0045407 3300045836 Bacteria 2650
228 Ga0466958_0146407 3300045836 Bacteria 1489
229 Ga0466967_0001731 3300045976 Bacteria 13020
230 Ga0466967_0118794 3300045976 Bacteria 2439
231 Ga0466967_0235048 3300045976 Bacteria 1746
232 Ga0495638_0014276 3300046460 Bacteria 5376
233 Ga0495638_0033519 3300046460 Bacteria 3285
234 Ga0495594_0104328 3300046499 Bacteria 1596
235 Ga0495594_0163499 3300046499 Bacteria 1266
236 Ga0495648_0011454 3300046524 Bacteria 6677
237 Ga0495648_0267521 3300046524 Bacteria 817
238 Ga0495668_0031599 3300046616 Bacteria 2984
239 Ga0495611_0025441 3300046648 Bacteria 2580
240 Ga0495671_0150985 3300046692 Bacteria 1131
241 Ga0495672_0008390 3300047320 Bacteria 7636
242 Ga0495672_0017577 3300047320 Bacteria 4780
243 Ga0495672_0137745 3300047320 Bacteria 1278
244 Ga0495673_0002084 3300047469 Bacteria 14599
245 Ga0496100_0001609 3300048903 Bacteria 11151
246 Ga0496100_0008970 3300048903 Bacteria 5597
247 Ga0496100_0068968 3300048903 Bacteria 2353
248 Ga0496100_0553869 3300048903 Bacteria 890
249 Ga0496101_0000926 3300048904 Bacteria 17310
250 Ga0496101_0028749 3300048904 Bacteria 3884
251 Ga0496101_0039721 3300048904 Bacteria 3349
252 Ga0496101_0507765 3300048904 Bacteria 952
253 Ga0496101_0969277 3300048904 Bacteria 669
254 Ga0496102_0000007 3300048905 Bacteria 417224
255 Ga0496102_0000344 3300048905 Bacteria 56680
256 Ga0496102_0003037 3300048905 Bacteria 14217
257 Ga0496102_0047762 3300048905 Bacteria 3891
258 Ga0496102_0058900 3300048905 Bacteria 3511
259 Ga0496102_0111245 3300048905 Bacteria 2553
260 Ga0496103_0000013 3300048906 Bacteria 297928
261 Ga0496103_0003827 3300048906 Bacteria 9156
262 Ga0496103_0027834 3300048906 Bacteria 3428
263 Ga0496103_0028096 3300048906 Bacteria 3412
264 Ga0496104_0002493 3300048907 Bacteria 15843
265 Ga0496104_0206840 3300048907 Bacteria 1874
266 Ga0496104_1033974 3300048907 Bacteria 725
267 Ga0496105_0069893 3300048908 Bacteria 2902
268 Ga0496106_0007606 3300048909 Bacteria 8016
269 Ga0496106_0021128 3300048909 Bacteria 4833
270 Ga0496106_0136338 3300048909 Bacteria 1928
271 Ga0496107_0003918 3300048910 Bacteria 10006
272 Ga0496107_0009156 3300048910 Bacteria 6865
273 Ga0496107_0045287 3300048910 Bacteria 3164
274 Ga0496108_0151179 3300048911 Bacteria 2003
275 Ga0496109_0109396 3300048912 Bacteria 2569
276 Ga0496109_0451820 3300048912 Bacteria 1214
277 Ga0496109_1559810 3300048912 Bacteria 595
278 Ga0496110_0067092 3300048913 Bacteria 3174
279 Ga0496110_1000877 3300048913 Bacteria 743
280 Ga0496111_0106268 3300048914 Bacteria 2066
281 Ga0496112_0120431 3300048915 Bacteria 2594
282 Ga0496112_0371019 3300048915 Bacteria 1373
283 Ga0496112_0597642 3300048915 Bacteria 1035
284 Ga0496113_0076787 3300048916 Bacteria 2552
285 Ga0496113_0379196 3300048916 Bacteria 1135
286 Ga0496114_0072138 3300048917 Bacteria 2903
287 Ga0496115_0168731 3300048918 Bacteria 1810
288 Ga0496116_0000033 3300048919 Bacteria 418191
289 Ga0496116_0005074 3300048919 Bacteria 12377
290 Ga0496117_0000025 3300048920 Bacteria 418106
291 Ga0496117_0001153 3300048920 Bacteria 39795
292 Ga0496117_0020309 3300048920 Bacteria 5418
293 Ga0496118_0000023 3300048921 Bacteria 418106
294 Ga0496118_0000516 3300048921 Bacteria 63445
295 Ga0496118_0000652 3300048921 Bacteria 56676
296 Ga0496118_0256461 3300048921 Bacteria 990
297 Ga0496119_0001166 3300048922 Bacteria 32898
298 Ga0496119_0002912 3300048922 Bacteria 18269
299 Ga0496120_0001610 3300048923 Bacteria 26185
300 Ga0496120_0012292 3300048923 Bacteria 5835
301 Ga0496120_0033824 3300048923 Bacteria 3068
302 Ga0496120_0446934 3300048923 Bacteria 563
303 Ga0496121_0000039 3300048924 Bacteria 351444
304 Ga0496121_0003201 3300048924 Bacteria 23581
305 Ga0496121_0043844 3300048924 Bacteria 3867
306 Ga0496122_0072133 3300048925 Bacteria 2456
307 Ga0496123_0004698 3300048926 Bacteria 14149
308 Ga0496124_0174214 3300048927 Bacteria 1662
309 Ga0496125_0119359 3300048928 Bacteria 1885
310 Ga0496125_0130031 3300048928 Bacteria 1774
311 Ga0496126_0000968 3300048929 Bacteria 49270
312 Ga0496126_0004146 3300048929 Bacteria 17518
313 Ga0496126_0015104 3300048929 Bacteria 7778
314 Ga0496126_0027165 3300048929 Bacteria 5471
315 Ga0496126_0686918 3300048929 Bacteria 797
316 nmdc:mga03683_539073_c1 3300050489 Bacteria 567
317 nmdc:mga03683_543447_c1 3300050489 Bacteria 565
318 nmdc:mga03683_9706_c1 3300050489 Bacteria 3432
319 nmdc:mga03n38_118588_c1 3300050490 Bacteria 1298
320 nmdc:mga03n38_523510_c1 3300050490 Bacteria 668
321 nmdc:mga03n38_863060_c1 3300050490 Bacteria 530
322 nmdc:mga03n38_88947_c1 3300050490 Bacteria 1466
323 nmdc:mga00v17_1015400_c1 3300050491 Bacteria 522
324 nmdc:mga00v17_281382_c1 3300050491 Bacteria 1080
325 nmdc:mga00v17_3800_c1 3300050491 Bacteria 7789
326 nmdc:mga00v17_398662_c1 3300050491 Bacteria 894
327 nmdc:mga00v17_4718_c1 3300050491 Bacteria 7123
328 nmdc:mga00v17_628690_c1 3300050491 Bacteria 691
329 nmdc:mga00v17_823467_c1 3300050491 Bacteria 591
330 nmdc:mga0yw44_476390_c1 3300050492 Bacteria 846
331 nmdc:mga0yw44_51037_c1 3300050492 Bacteria 2503
332 nmdc:mga0yw44_514625_c1 3300050492 Bacteria 812
333 nmdc:mga0yw44_855123_c1 3300050492 Bacteria 617
334 nmdc:mga0yw44_90562_c1 3300050492 Bacteria 1932
335 nmdc:mga06z11_102933_c1 3300050494 Bacteria 1569
336 nmdc:mga04h51_155848_c1 3300050495 Bacteria 876
337 nmdc:mga07m45_614644_c1 3300050496 Bacteria 627
338 nmdc:mga05p37_26477_c1 3300050507 Bacteria 7053
339 nmdc:mga09592_1053035_c1 3300050508 Bacteria 678
340 nmdc:mga0qj67_53770_c1 3300050509 Bacteria 1821
341 nmdc:mga0qj67_80733_c1 3300050509 Bacteria 2606
342 nmdc:mga06r32_77845_c1 3300050510 Bacteria 3222
343 nmdc:mga0sz30_10346_c1 3300050516 Bacteria 3574
344 nmdc:mga0sz30_10811_c1 3300050516 Bacteria 3507
345 nmdc:mga0sz30_13861_c1 3300050516 Bacteria 3163
346 nmdc:mga0sz30_303091_c1 3300050516 Bacteria 712
347 nmdc:mga0sz30_688_c1 3300050516 Bacteria 12503
348 nmdc:mga0sz30_7454_c1 3300050516 Bacteria 4103
349 Ga0500610_0057703 3300053079 Bacteria 2026
350 Ga0500643_001472 3300053087 Bacteria 13514
351 Ga0500643_002249 3300053087 Bacteria 10167
352 Ga0500644_0068182 3300053088 Bacteria 1274
353 Ga0500641_0338739 3300053096 Bacteria 607
354 Ga0500660_256417 3300053100 Bacteria 532
355 Ga0500556_0003652 3300053104 Bacteria 4482
356 Ga0500652_007755 3300053131 Bacteria 3535
357 Ga0500652_133422 3300053131 Bacteria 1035
358 Ga0500568_0196586 3300053139 Bacteria 739
359 Ga0500616_0000223 3300053153 Bacteria 88492
360 Ga0500616_0019447 3300053153 Bacteria 3828
361 Ga0500616_0074608 3300053153 Bacteria 1719
362 Ga0500616_0315391 3300053153 Bacteria 645
363 Ga0500627_0269393 3300053158 Bacteria 750
364 Ga0500645_006409 3300053730 Bacteria 4203
365 Ga0466962_0049436 3300061719 Bacteria 2010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025315 Ga0207697_10471677 Ga0207697_104716771 112
2 iso_pu_bacteria 2643221715 2644633798 113
3 iso_pu_bacteria 2842134933 2842137545 113
4 iso_pu_bacteria 2902810491 2902810707 113
5 iso_pu_bacteria 2929212328 2929216225 113
6 iso_pu_bacteria 2643221687 2644488792 114
7 3300003322 rootL2_10156717 rootL2_101567171 115
8 3300005347 Ga0070668_100000217 Ga0070668_1000002177 115
9 3300005466 Ga0070685_11513203 Ga0070685_115132031 115
10 3300025972 Ga0207668_10002279 Ga0207668_100022791 115
11 3300028380 Ga0268265_10303286 Ga0268265_103032861 115
12 3300028794 Ga0307515_10000038 Ga0307515_10000038247 115
13 3300031456 Ga0307513_10348723 Ga0307513_103487231 115
14 3300031507 Ga0307509_10051588 Ga0307509_100515882 115
15 3300031730 Ga0307516_10000553 Ga0307516_100005537 115
16 3300031995 Ga0307409_101415120 Ga0307409_1014151202 115
17 3300032005 Ga0307411_11440238 Ga0307411_114402382 115
18 3300041443 Ga0451789_0775185 Ga0451789_0775185_51_398 115
19 3300041453 Ga0451797_0327483 Ga0451797_0327483_227_574 115
20 3300041456 Ga0451795_0625618 Ga0451795_0625618_151_498 115
21 3300041494 Ga0451837_0440423 Ga0451837_0440423_1083_1430 115
22 3300041512 Ga0451853_2878662 Ga0451853_2878662_191_538 115
23 3300053088 Ga0500644_0068182 Ga0500644_0068182_184_531 115
24 3300053100 Ga0500660_256417 Ga0500660_256417_150_497 115
25 3300011119 Ga0105246_10995014 Ga0105246_109950142 116
26 3300031649 Ga0307514_10401255 Ga0307514_104012552 116
27 3300031995 Ga0307409_101181308 Ga0307409_1011813081 116
28 3300044842 Ga0466957_0032279 Ga0466957_0032279_1060_1410 116
29 3300046499 Ga0495594_0104328 Ga0495594_0104328_318_668 116
30 3300046499 Ga0495594_0163499 Ga0495594_0163499_266_616 116
31 3300048929 Ga0496126_0015104 Ga0496126_0015104_5975_6325 116
32 3300005330 Ga0070690_100487057 Ga0070690_1004870572 117
33 3300005337 Ga0070682_100080899 Ga0070682_1000808992 117
34 3300005337 Ga0070682_100861744 Ga0070682_1008617441 117
35 3300005347 Ga0070668_100002814 Ga0070668_1000028145 117
36 3300005353 Ga0070669_100002156 Ga0070669_10000215610 117
37 3300005356 Ga0070674_100437275 Ga0070674_1004372752 117
38 3300005365 Ga0070688_100912961 Ga0070688_1009129612 117
39 3300005367 Ga0070667_100000464 Ga0070667_10000046434 117
40 3300005367 Ga0070667_100062648 Ga0070667_1000626482 117
41 3300005439 Ga0070711_101434419 Ga0070711_1014344192 117
42 3300005468 Ga0070707_100224498 Ga0070707_1002244981 117
43 3300005539 Ga0068853_100831257 Ga0068853_1008312572 117
44 3300005548 Ga0070665_100048331 Ga0070665_1000483313 117
45 3300005548 Ga0070665_102135047 Ga0070665_1021350472 117
46 3300005563 Ga0068855_100146859 Ga0068855_1001468593 117
47 3300005578 Ga0068854_101665942 Ga0068854_1016659422 117
48 3300005616 Ga0068852_100316605 Ga0068852_1003166052 117
49 3300005617 Ga0068859_100000748 Ga0068859_10000074834 117
50 3300005618 Ga0068864_100532019 Ga0068864_1005320192 117
51 3300005719 Ga0068861_100631622 Ga0068861_1006316222 117
52 3300005841 Ga0068863_100000397 Ga0068863_10000039734 117
53 3300005842 Ga0068858_100003095 Ga0068858_1000030955 117
54 3300005842 Ga0068858_100518054 Ga0068858_1005180542 117
55 3300005843 Ga0068860_100000011 Ga0068860_10000001137 117
56 3300005844 Ga0068862_100000054 Ga0068862_100000054114 117
57 3300005937 Ga0081455_10182729 Ga0081455_101827292 117
58 3300006038 Ga0075365_10024960 Ga0075365_100249602 117
59 3300006038 Ga0075365_10052898 Ga0075365_100528983 117
60 3300006048 Ga0075363_100072879 Ga0075363_1000728793 117
61 3300006048 Ga0075363_100190239 Ga0075363_1001902392 117
62 3300006051 Ga0075364_10002712 Ga0075364_100027127 117
63 3300006051 Ga0075364_10385438 Ga0075364_103854382 117
64 3300006051 Ga0075364_10555233 Ga0075364_105552332 117
65 3300006163 Ga0070715_10284301 Ga0070715_102843012 117
66 3300006177 Ga0075362_10009119 Ga0075362_100091192 117
67 3300006177 Ga0075362_10176389 Ga0075362_101763892 117
68 3300006178 Ga0075367_10160955 Ga0075367_101609552 117
69 3300006178 Ga0075367_10201946 Ga0075367_102019462 117
70 3300006186 Ga0075369_10000601 Ga0075369_100006012 117
71 3300006186 Ga0075369_10018417 Ga0075369_100184173 117
72 3300006186 Ga0075369_10037531 Ga0075369_100375312 117
73 3300006186 Ga0075369_10037621 Ga0075369_100376212 117
74 3300006186 Ga0075369_10082576 Ga0075369_100825762 117
75 3300006237 Ga0097621_100990292 Ga0097621_1009902922 117
76 3300006237 Ga0097621_101296695 Ga0097621_1012966951 117
77 3300006353 Ga0075370_10275262 Ga0075370_102752622 117
78 3300006844 Ga0075428_100005134 Ga0075428_1000051349 117
79 3300006846 Ga0075430_100089211 Ga0075430_1000892113 117
80 3300006846 Ga0075430_100169519 Ga0075430_1001695192 117
81 3300006847 Ga0075431_100034676 Ga0075431_1000346765 117
82 3300006880 Ga0075429_100580488 Ga0075429_1005804882 117
83 3300006931 Ga0097620_100000748 Ga0097620_10000074834 117
84 3300009092 Ga0105250_10060408 Ga0105250_100604082 117
85 3300009093 Ga0105240_10386365 Ga0105240_103863652 117
86 3300009093 Ga0105240_11166870 Ga0105240_111668701 117
87 3300009094 Ga0111539_10321194 Ga0111539_103211942 117
88 3300009094 Ga0111539_13253021 Ga0111539_132530211 117
89 3300009101 Ga0105247_10000085 Ga0105247_1000008534 117
90 3300009101 Ga0105247_10108710 Ga0105247_101087102 117
91 3300009147 Ga0114129_10037994 Ga0114129_100379947 117
92 3300009148 Ga0105243_10102696 Ga0105243_101026962 117
93 3300009148 Ga0105243_10247525 Ga0105243_102475252 117
94 3300009177 Ga0105248_10000233 Ga0105248_1000023335 117
95 3300009545 Ga0105237_10001322 Ga0105237_1000132211 117
96 3300009545 Ga0105237_10018239 Ga0105237_100182392 117
97 3300009545 Ga0105237_11734170 Ga0105237_117341702 117
98 3300009553 Ga0105249_10000001 Ga0105249_1000000189 117
99 3300009553 Ga0105249_10377656 Ga0105249_103776562 117
100 3300010159 Ga0099796_10032420 Ga0099796_100324202 117
101 3300010375 Ga0105239_10030770 Ga0105239_100307702 117
102 3300010375 Ga0105239_10381832 Ga0105239_103818321 117
103 3300011119 Ga0105246_11149932 Ga0105246_111499321 117
104 3300013306 Ga0163162_10348221 Ga0163162_103482212 117
105 3300013306 Ga0163162_10572294 Ga0163162_105722942 117
106 3300014325 Ga0163163_10838164 Ga0163163_108381642 117
107 3300014326 Ga0157380_10289676 Ga0157380_102896761 117
108 3300014968 Ga0157379_10160716 Ga0157379_101607162 117
109 3300014968 Ga0157379_10264659 Ga0157379_102646592 117
110 3300021384 Ga0213876_10015168 Ga0213876_100151682 117
111 3300021384 Ga0213876_10044732 Ga0213876_100447322 117
112 3300021384 Ga0213876_10248690 Ga0213876_102486902 117
113 3300021388 Ga0213875_10025950 Ga0213875_100259502 117
114 3300025711 Ga0207696_1065601 Ga0207696_10656012 117
115 3300025900 Ga0207710_10000125 Ga0207710_1000012523 117
116 3300025913 Ga0207695_10521493 Ga0207695_105214931 117
117 3300025914 Ga0207671_10020933 Ga0207671_100209332 117
118 3300025914 Ga0207671_10076401 Ga0207671_100764012 117
119 3300025922 Ga0207646_10493587 Ga0207646_104935871 117
120 3300025923 Ga0207681_10001914 Ga0207681_100019149 117
121 3300025929 Ga0207664_10225810 Ga0207664_102258102 117
122 3300025937 Ga0207669_10079067 Ga0207669_100790672 117
123 3300025941 Ga0207711_10000356 Ga0207711_1000035634 117
124 3300025961 Ga0207712_10000006 Ga0207712_10000006405 117
125 3300025972 Ga0207668_10000743 Ga0207668_100007439 117
126 3300025986 Ga0207658_10005240 Ga0207658_100052409 117
127 3300025986 Ga0207658_10021428 Ga0207658_100214283 117
128 3300025986 Ga0207658_11840574 Ga0207658_118405742 117
129 3300026035 Ga0207703_10008038 Ga0207703_100080385 117
130 3300026041 Ga0207639_10099549 Ga0207639_100995492 117
131 3300026088 Ga0207641_10000264 Ga0207641_1000026473 117
132 3300026118 Ga0207675_100603251 Ga0207675_1006032512 117
133 3300026142 Ga0207698_11369478 Ga0207698_113694781 117
134 3300027866 Ga0209813_10198593 Ga0209813_101985931 117
135 3300028379 Ga0268266_10034443 Ga0268266_100344433 117
136 3300028380 Ga0268265_10000032 Ga0268265_10000032112 117
137 3300028380 Ga0268265_11471876 Ga0268265_114718761 117
138 3300028381 Ga0268264_10000026 Ga0268264_10000026403 117
139 3300031901 Ga0307406_10062667 Ga0307406_100626672 117
140 3300031901 Ga0307406_10237120 Ga0307406_102371202 117
141 3300031903 Ga0307407_11218438 Ga0307407_112184381 117
142 3300031995 Ga0307409_100030523 Ga0307409_1000305233 117
143 3300031995 Ga0307409_100429298 Ga0307409_1004292982 117
144 3300032002 Ga0307416_100629518 Ga0307416_1006295182 117
145 3300032002 Ga0307416_101391995 Ga0307416_1013919952 117
146 3300032002 Ga0307416_102079796 Ga0307416_1020797962 117
147 3300037853 Ga0436364_1085111 Ga0436364_1085111_6712_7065 117
148 3300037853 Ga0436364_1192519 Ga0436364_1192519_12233_12586 117
149 3300039437 Ga0436365_0161820 Ga0436365_0161820_27630_27983 117
150 3300039437 Ga0436365_0307104 Ga0436365_0307104_1124_1477 117
151 3300039437 Ga0436365_1042870 Ga0436365_1042870_197_550 117
152 3300039437 Ga0436365_1138315 Ga0436365_1138315_9678_10031 117
153 3300039447 Ga0436361_1174023 Ga0436361_1174023_636_989 117
154 3300039450 Ga0436363_1105110 Ga0436363_1105110_230_583 117
155 3300039450 Ga0436363_1419040 Ga0436363_1419040_387_740 117
156 3300041410 Ga0439461_0001581 Ga0439461_0001581_1321_1674 117
157 3300041410 Ga0439461_0109459 Ga0439461_0109459_273_626 117
158 3300041411 Ga0439466_0047314 Ga0439466_0047314_69_488 117
159 3300041411 Ga0439466_0057053 Ga0439466_0057053_73_426 117
160 3300041411 Ga0439466_0089387 Ga0439466_0089387_403_756 117
161 3300041413 Ga0439465_0004721 Ga0439465_0004721_2981_3334 117
162 3300041413 Ga0439465_0007138 Ga0439465_0007138_2778_3197 117
163 3300041413 Ga0439465_0090828 Ga0439465_0090828_161_514 117
164 3300041413 Ga0439465_0306890 Ga0439465_0306890_161_514 117
165 3300041413 Ga0439465_0414728 Ga0439465_0414728_16_369 117
166 3300041443 Ga0451789_0742976 Ga0451789_0742976_184_537 117
167 3300041486 Ga0451807_1923485 Ga0451807_1923485_708_1061 117
168 3300041509 Ga0451843_1728864 Ga0451843_1728864_14_367 117
169 3300041997 Ga0439431_0003108 Ga0439431_0003108_1546_1899 117
170 3300042004 Ga0439445_0005801 Ga0439445_0005801_1615_1968 117
171 3300042004 Ga0439445_0052783 Ga0439445_0052783_37_390 117
172 3300042005 Ga0439448_0025802 Ga0439448_0025802_930_1283 117
173 3300042435 Ga0439434_0004432 Ga0439434_0004432_1087_1440 117
174 3300044658 Ga0466972_0033215 Ga0466972_0033215_1477_1830 117
175 3300044658 Ga0466972_0066433 Ga0466972_0066433_760_1170 117
176 3300044658 Ga0466972_0110242 Ga0466972_0110242_146_499 117
177 3300044694 Ga0466963_0038621 Ga0466963_0038621_215_568 117
178 3300044706 Ga0466964_0547332 Ga0466964_0547332_92_445 117
179 3300044719 Ga0466971_0011555 Ga0466971_0011555_354_707 117
180 3300044765 Ga0466970_0666901 Ga0466970_0666901_156_509 117
181 3300044842 Ga0466957_0200241 Ga0466957_0200241_592_945 117
182 3300044901 Ga0466960_0000316 Ga0466960_0000316_5486_5839 117
183 3300044901 Ga0466960_0413380 Ga0466960_0413380_305_715 117
184 3300044901 Ga0466960_0669404 Ga0466960_0669404_36_389 117
185 3300045836 Ga0466958_0024125 Ga0466958_0024125_96_449 117
186 3300045836 Ga0466958_0146407 Ga0466958_0146407_249_602 117
187 3300045976 Ga0466967_0001731 Ga0466967_0001731_10593_10946 117
188 3300045976 Ga0466967_0118794 Ga0466967_0118794_451_804 117
189 3300046460 Ga0495638_0014276 Ga0495638_0014276_4574_4927 117
190 3300046460 Ga0495638_0033519 Ga0495638_0033519_621_974 117
191 3300046524 Ga0495648_0011454 Ga0495648_0011454_2474_2827 117
192 3300046524 Ga0495648_0267521 Ga0495648_0267521_156_509 117
193 3300046616 Ga0495668_0031599 Ga0495668_0031599_2275_2628 117
194 3300046692 Ga0495671_0150985 Ga0495671_0150985_120_473 117
195 3300047320 Ga0495672_0017577 Ga0495672_0017577_1687_2040 117
196 3300047320 Ga0495672_0137745 Ga0495672_0137745_20_373 117
197 3300047469 Ga0495673_0002084 Ga0495673_0002084_3784_4137 117
198 3300048903 Ga0496100_0001609 Ga0496100_0001609_3643_3996 117
199 3300048903 Ga0496100_0008970 Ga0496100_0008970_2231_2584 117
200 3300048903 Ga0496100_0068968 Ga0496100_0068968_70_423 117
201 3300048904 Ga0496101_0000926 Ga0496101_0000926_1703_2056 117
202 3300048904 Ga0496101_0028749 Ga0496101_0028749_1927_2280 117
203 3300048904 Ga0496101_0507765 Ga0496101_0507765_567_920 117
204 3300048905 Ga0496102_0000007 Ga0496102_0000007_402165_402518 117
205 3300048905 Ga0496102_0000344 Ga0496102_0000344_19062_19415 117
206 3300048905 Ga0496102_0003037 Ga0496102_0003037_9873_10226 117
207 3300048905 Ga0496102_0058900 Ga0496102_0058900_2733_3086 117
208 3300048905 Ga0496102_0111245 Ga0496102_0111245_628_981 117
209 3300048906 Ga0496103_0000013 Ga0496103_0000013_283022_283375 117
210 3300048906 Ga0496103_0003827 Ga0496103_0003827_1432_1785 117
211 3300048906 Ga0496103_0028096 Ga0496103_0028096_2902_3255 117
212 3300048907 Ga0496104_0002493 Ga0496104_0002493_6007_6360 117
213 3300048907 Ga0496104_1033974 Ga0496104_1033974_40_393 117
214 3300048909 Ga0496106_0007606 Ga0496106_0007606_5938_6291 117
215 3300048909 Ga0496106_0021128 Ga0496106_0021128_2071_2424 117
216 3300048909 Ga0496106_0136338 Ga0496106_0136338_433_786 117
217 3300048910 Ga0496107_0003918 Ga0496107_0003918_245_598 117
218 3300048910 Ga0496107_0009156 Ga0496107_0009156_1038_1391 117
219 3300048910 Ga0496107_0045287 Ga0496107_0045287_997_1350 117
220 3300048912 Ga0496109_0451820 Ga0496109_0451820_276_629 117
221 3300048912 Ga0496109_1559810 Ga0496109_1559810_104_457 117
222 3300048915 Ga0496112_0371019 Ga0496112_0371019_141_494 117
223 3300048915 Ga0496112_0597642 Ga0496112_0597642_303_656 117
224 3300048917 Ga0496114_0072138 Ga0496114_0072138_673_1026 117
225 3300048918 Ga0496115_0168731 Ga0496115_0168731_1348_1701 117
226 3300048919 Ga0496116_0000033 Ga0496116_0000033_15653_16006 117
227 3300048919 Ga0496116_0005074 Ga0496116_0005074_589_942 117
228 3300048920 Ga0496117_0000025 Ga0496117_0000025_15583_15936 117
229 3300048920 Ga0496117_0001153 Ga0496117_0001153_6294_6647 117
230 3300048920 Ga0496117_0020309 Ga0496117_0020309_892_1245 117
231 3300048921 Ga0496118_0000023 Ga0496118_0000023_402171_402524 117
232 3300048921 Ga0496118_0000516 Ga0496118_0000516_33178_33531 117
233 3300048921 Ga0496118_0000652 Ga0496118_0000652_14985_15338 117
234 3300048921 Ga0496118_0256461 Ga0496118_0256461_457_810 117
235 3300048922 Ga0496119_0001166 Ga0496119_0001166_9829_10182 117
236 3300048922 Ga0496119_0002912 Ga0496119_0002912_14952_15305 117
237 3300048923 Ga0496120_0001610 Ga0496120_0001610_22717_23070 117
238 3300048923 Ga0496120_0012292 Ga0496120_0012292_3741_4094 117
239 3300048923 Ga0496120_0033824 Ga0496120_0033824_2577_2930 117
240 3300048924 Ga0496121_0000039 Ga0496121_0000039_237050_237403 117
241 3300048924 Ga0496121_0003201 Ga0496121_0003201_15689_16042 117
242 3300048924 Ga0496121_0043844 Ga0496121_0043844_1729_2082 117
243 3300048927 Ga0496124_0174214 Ga0496124_0174214_798_1151 117
244 3300048928 Ga0496125_0119359 Ga0496125_0119359_964_1317 117
245 3300048928 Ga0496125_0130031 Ga0496125_0130031_740_1093 117
246 3300048929 Ga0496126_0000968 Ga0496126_0000968_29317_29670 117
247 3300048929 Ga0496126_0004146 Ga0496126_0004146_10296_10649 117
248 3300048929 Ga0496126_0686918 Ga0496126_0686918_259_612 117
249 3300050489 nmdc:mga03683_539073_c1 nmdc:mga03683_539073_c1_70_423 117
250 3300050489 nmdc:mga03683_543447_c1 nmdc:mga03683_543447_c1_79_432 117
251 3300050489 nmdc:mga03683_9706_c1 nmdc:mga03683_9706_c1_1753_2106 117
252 3300050490 nmdc:mga03n38_118588_c1 nmdc:mga03n38_118588_c1_548_901 117
253 3300050490 nmdc:mga03n38_523510_c1 nmdc:mga03n38_523510_c1_146_499 117
254 3300050490 nmdc:mga03n38_863060_c1 nmdc:mga03n38_863060_c1_112_465 117
255 3300050490 nmdc:mga03n38_88947_c1 nmdc:mga03n38_88947_c1_128_481 117
256 3300050491 nmdc:mga00v17_281382_c1 nmdc:mga00v17_281382_c1_416_769 117
257 3300050491 nmdc:mga00v17_3800_c1 nmdc:mga00v17_3800_c1_4888_5241 117
258 3300050491 nmdc:mga00v17_398662_c1 nmdc:mga00v17_398662_c1_259_612 117
259 3300050491 nmdc:mga00v17_4718_c1 nmdc:mga00v17_4718_c1_4055_4408 117
260 3300050491 nmdc:mga00v17_628690_c1 nmdc:mga00v17_628690_c1_279_632 117
261 3300050491 nmdc:mga00v17_823467_c1 nmdc:mga00v17_823467_c1_142_495 117
262 3300050492 nmdc:mga0yw44_476390_c1 nmdc:mga0yw44_476390_c1_409_762 117
263 3300050492 nmdc:mga0yw44_51037_c1 nmdc:mga0yw44_51037_c1_426_779 117
264 3300050492 nmdc:mga0yw44_90562_c1 nmdc:mga0yw44_90562_c1_1543_1896 117
265 3300050494 nmdc:mga06z11_102933_c1 nmdc:mga06z11_102933_c1_245_598 117
266 3300050495 nmdc:mga04h51_155848_c1 nmdc:mga04h51_155848_c1_16_369 117
267 3300050496 nmdc:mga07m45_614644_c1 nmdc:mga07m45_614644_c1_86_439 117
268 3300050507 nmdc:mga05p37_26477_c1 nmdc:mga05p37_26477_c1_6061_6414 117
269 3300050508 nmdc:mga09592_1053035_c1 nmdc:mga09592_1053035_c1_54_407 117
270 3300050509 nmdc:mga0qj67_53770_c1 nmdc:mga0qj67_53770_c1_128_481 117
271 3300050509 nmdc:mga0qj67_80733_c1 nmdc:mga0qj67_80733_c1_73_426 117
272 3300050510 nmdc:mga06r32_77845_c1 nmdc:mga06r32_77845_c1_866_1219 117
273 3300050516 nmdc:mga0sz30_10346_c1 nmdc:mga0sz30_10346_c1_2328_2681 117
274 3300050516 nmdc:mga0sz30_13861_c1 nmdc:mga0sz30_13861_c1_2518_2871 117
275 3300050516 nmdc:mga0sz30_303091_c1 nmdc:mga0sz30_303091_c1_75_428 117
276 3300050516 nmdc:mga0sz30_688_c1 nmdc:mga0sz30_688_c1_10067_10420 117
277 3300050516 nmdc:mga0sz30_7454_c1 nmdc:mga0sz30_7454_c1_802_1155 117
278 3300053079 Ga0500610_0057703 Ga0500610_0057703_1341_1694 117
279 3300053087 Ga0500643_001472 Ga0500643_001472_5484_5837 117
280 3300053087 Ga0500643_002249 Ga0500643_002249_507_860 117
281 3300053096 Ga0500641_0338739 Ga0500641_0338739_239_592 117
282 3300053104 Ga0500556_0003652 Ga0500556_0003652_515_868 117
283 3300053131 Ga0500652_007755 Ga0500652_007755_1784_2137 117
284 3300053131 Ga0500652_133422 Ga0500652_133422_358_819 117
285 3300053139 Ga0500568_0196586 Ga0500568_0196586_120_473 117
286 3300053153 Ga0500616_0000223 Ga0500616_0000223_16785_17138 117
287 3300053153 Ga0500616_0019447 Ga0500616_0019447_378_731 117
288 3300053153 Ga0500616_0074608 Ga0500616_0074608_1194_1547 117
289 3300053153 Ga0500616_0315391 Ga0500616_0315391_267_620 117
290 3300053158 Ga0500627_0269393 Ga0500627_0269393_195_548 117
291 3300053730 Ga0500645_006409 Ga0500645_006409_3378_3731 117
292 3300061719 Ga0466962_0049436 Ga0466962_0049436_570_923 117
293 3300002239 JGI24034J26672_10032833 JGI24034J26672_100328331 118
294 3300003792 Ga0055540_1001762 Ga0055540_10017623 118
295 3300005337 Ga0070682_100027784 Ga0070682_1000277842 118
296 3300005367 Ga0070667_100274446 Ga0070667_1002744461 118
297 3300005466 Ga0070685_10081452 Ga0070685_100814522 118
298 3300005466 Ga0070685_11436732 Ga0070685_114367321 118
299 3300005617 Ga0068859_100670342 Ga0068859_1006703422 118
300 3300005843 Ga0068860_100552763 Ga0068860_1005527632 118
301 3300006038 Ga0075365_10391126 Ga0075365_103911262 118
302 3300006051 Ga0075364_10354119 Ga0075364_103541191 118
303 3300006186 Ga0075369_10002195 Ga0075369_100021953 118
304 3300006186 Ga0075369_10106528 Ga0075369_101065282 118
305 3300006186 Ga0075369_10204806 Ga0075369_102048062 118
306 3300006931 Ga0097620_100670333 Ga0097620_1006703332 118
307 3300009092 Ga0105250_10029694 Ga0105250_100296942 118
308 3300009098 Ga0105245_11351207 Ga0105245_113512071 118
309 3300009101 Ga0105247_10231582 Ga0105247_102315822 118
310 3300009177 Ga0105248_11431132 Ga0105248_114311321 118
311 3300009553 Ga0105249_10034654 Ga0105249_100346542 118
312 3300013307 Ga0157372_12999258 Ga0157372_129992581 118
313 3300014325 Ga0163163_10061754 Ga0163163_100617542 118
314 3300014968 Ga0157379_10433159 Ga0157379_104331592 118
315 3300025303 Ga0209051_1000594 Ga0209051_10005943 118
316 3300025303 Ga0209051_1010920 Ga0209051_10109201 118
317 3300025900 Ga0207710_10329648 Ga0207710_103296482 118
318 3300025927 Ga0207687_10846364 Ga0207687_108463641 118
319 3300025961 Ga0207712_10011934 Ga0207712_100119345 118
320 3300025972 Ga0207668_11208588 Ga0207668_112085881 118
321 3300025986 Ga0207658_10747633 Ga0207658_107476332 118
322 3300026067 Ga0207678_10092381 Ga0207678_100923812 118
323 3300026088 Ga0207641_10723088 Ga0207641_107230882 118
324 3300026095 Ga0207676_10063147 Ga0207676_100631472 118
325 3300028381 Ga0268264_10017674 Ga0268264_100176742 118
326 3300041441 Ga0451787_282995 Ga0451787_282995_79_435 118
327 3300041443 Ga0451789_1241128 Ga0451789_1241128_141_497 118
328 3300041451 Ga0451791_1695324 Ga0451791_1695324_511_867 118
329 3300041452 Ga0451793_0068740 Ga0451793_0068740_636_992 118
330 3300041456 Ga0451795_0015248 Ga0451795_0015248_929_1285 118
331 3300041460 Ga0451802_0531777 Ga0451802_0531777_291_647 118
332 3300041491 Ga0451833_0296847 Ga0451833_0296847_16_372 118
333 3300041512 Ga0451853_2686230 Ga0451853_2686230_62_418 118
334 3300042438 Ga0439459_0091239 Ga0439459_0091239_336_692 118
335 3300044683 Ga0466965_0026864 Ga0466965_0026864_1653_2009 118
336 3300044694 Ga0466963_1176488 Ga0466963_1176488_80_436 118
337 3300044706 Ga0466964_0172288 Ga0466964_0172288_495_851 118
338 3300044719 Ga0466971_0072320 Ga0466971_0072320_950_1306 118
339 3300044735 Ga0466968_0001284 Ga0466968_0001284_3962_4318 118
340 3300044765 Ga0466970_0738383 Ga0466970_0738383_151_507 118
341 3300044842 Ga0466957_0039932 Ga0466957_0039932_1652_2008 118
342 3300044901 Ga0466960_0084093 Ga0466960_0084093_638_994 118
343 3300045049 Ga0466959_0015456 Ga0466959_0015456_5077_5433 118
344 3300045836 Ga0466958_0045407 Ga0466958_0045407_254_610 118
345 3300045976 Ga0466967_0235048 Ga0466967_0235048_1195_1551 118
346 3300046648 Ga0495611_0025441 Ga0495611_0025441_958_1314 118
347 3300047320 Ga0495672_0008390 Ga0495672_0008390_5893_6249 118
348 3300048903 Ga0496100_0553869 Ga0496100_0553869_370_726 118
349 3300048904 Ga0496101_0039721 Ga0496101_0039721_2930_3286 118
350 3300048904 Ga0496101_0969277 Ga0496101_0969277_126_482 118
351 3300048905 Ga0496102_0047762 Ga0496102_0047762_930_1286 118
352 3300048906 Ga0496103_0027834 Ga0496103_0027834_2820_3176 118
353 3300048907 Ga0496104_0206840 Ga0496104_0206840_959_1315 118
354 3300048908 Ga0496105_0069893 Ga0496105_0069893_1610_1966 118
355 3300048911 Ga0496108_0151179 Ga0496108_0151179_918_1274 118
356 3300048912 Ga0496109_0109396 Ga0496109_0109396_1906_2262 118
357 3300048913 Ga0496110_0067092 Ga0496110_0067092_1854_2210 118
358 3300048913 Ga0496110_1000877 Ga0496110_1000877_354_710 118
359 3300048914 Ga0496111_0106268 Ga0496111_0106268_298_654 118
360 3300048915 Ga0496112_0120431 Ga0496112_0120431_532_888 118
361 3300048916 Ga0496113_0076787 Ga0496113_0076787_28_384 118
362 3300048916 Ga0496113_0379196 Ga0496113_0379196_504_860 118
363 3300048923 Ga0496120_0446934 Ga0496120_0446934_121_477 118
364 3300048925 Ga0496122_0072133 Ga0496122_0072133_1181_1537 118
365 3300048926 Ga0496123_0004698 Ga0496123_0004698_10732_11088 118
366 3300048929 Ga0496126_0027165 Ga0496126_0027165_757_1113 118
367 3300050491 nmdc:mga00v17_1015400_c1 nmdc:mga00v17_1015400_c1_58_414 118
368 3300050492 nmdc:mga0yw44_514625_c1 nmdc:mga0yw44_514625_c1_199_555 118
369 3300050492 nmdc:mga0yw44_855123_c1 nmdc:mga0yw44_855123_c1_158_514 118
370 3300050516 nmdc:mga0sz30_10811_c1 nmdc:mga0sz30_10811_c1_1441_1797 118

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j31-assembly1.cif.gz_P life in the extremes: atomic structure of sulfolobus turreted icosahedral virus 0.6208 6 116
4qqp-assembly1.cif.gz_A crystal structure of c1ql3 mutant d207a 0.6205 7 111
4qqo-assembly1.cif.gz_A crystal structure of c1ql3 mutant d205a 0.6128 7 111
4jdo-assembly2.cif.gz_E secreted chlamydial protein pgp3, coiled-coil deletion 0.6114 3 117
6gjt-assembly1.cif.gz_A chlamydia protein pgp3 studied at high resolution in a new crystal form 0.6058 2 117
ID Description Score Start End Superfamily
af_Q7YX71_33_209_2.60.120.380 Mainly Beta;Sandwich;Jelly Rolls; 0.6505 13 114 2.60.120.380
af_E7FG77_499_637_2.60.120.40 Mainly Beta;Sandwich;Jelly Rolls; 0.6263 1 112 2.60.120.40
af_Q8R066_174_317_2.60.120.40 Mainly Beta;Sandwich;Jelly Rolls; 0.6239 7 113 2.60.120.40
af_Q8MUJ1_270_415_2.60.120.40 Mainly Beta;Sandwich;Jelly Rolls; 0.6087 1 117 2.60.120.40
af_Q5RJ80_780_914_2.60.120.40 Mainly Beta;Sandwich;Jelly Rolls; 0.6034 1 114 2.60.120.40
ID Description Score Start End GO Terms
AF-I4BKT9-F1-model_v4 Molybdopterin oxidoreductase 0.998 1 117
AF-A0A318HTT6-F1-model_v4 Molybdopterin oxidoreductase 0.9971 1 117
AF-A0A428YPD9-F1-model_v4 Molybdopterin oxidoreductase 0.9919 2 117
AF-A0A4Q2U8J3-F1-model_v4 Molybdopterin oxidoreductase 0.9891 5 117
AF-A0A7Y0PUS6-F1-model_v4 Uncharacterized protein 0.9878 2 117

Feature Viewer

pLDDT pTM Quality
95.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map