F425296

General Info

Members Datasets Scaffolds Average Seq Length
370 190 370 335

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100000157|Ga0070700_10000015727
Length 375
Sequence MSRLAIPQPPALTILRLSVDIVEPPKRDSMPLMRQKLFLIVPVLIIVSLLLSCRSGSGNKNRLLIYTPHGQDLLKDFVARYNQQHPDVEVQFLDMGSRQILERVRVERNRPQADLWWGASHTTFQTAAEENLLLEFRPTWADKVPETARDPKDLWYGTYETPQVIAYNSEAVSAQDAPHDWDDVLDPKWRDKVLIRNPNPSDTMRAIFGAMILRFYKDTGSPDKGYEWLRKLDANVHEYTADGTLLMQKLARREGLITLWDMPDVRLFKEQKNLPVGYTVPSSGTPVIVDGIAIIRGGPNVEEAKRFYEFVTTPESLAYAAEKYYRIPVRTDLDRAKLPGWMNEPFTRLSLDWDLLRKNGNDWLRYWDTEIRDRR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
168 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
169 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
173 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
176 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
177 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
178 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
183 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
184 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.24
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000098 3300002459 Bacteria 48084
2 JGI25406J46586_10000959 3300003203 Bacteria 13554
3 Ga0065714_10064594 3300005288 Bacteria 30899
4 Ga0065704_10078582 3300005289 Bacteria 4388
5 Ga0065712_10000121 3300005290 Bacteria 103063
6 Ga0065712_10079872 3300005290 Bacteria 3166
7 Ga0065715_10089446 3300005293 Bacteria 10135
8 Ga0065715_10100026 3300005293 Bacteria 3344
9 Ga0065715_10110877 3300005293 Bacteria 2599
10 Ga0070676_10047652 3300005328 Bacteria 2503
11 Ga0070676_10069683 3300005328 Bacteria 2108
12 Ga0070690_100022602 3300005330 Bacteria 3848
13 Ga0070670_100002046 3300005331 Bacteria 16506
14 Ga0070670_100031242 3300005331 Bacteria 4586
15 Ga0070670_100069666 3300005331 Bacteria 3019
16 Ga0070670_100070297 3300005331 Bacteria 3005
17 Ga0070670_100107148 3300005331 Bacteria 2408
18 Ga0070670_100206216 3300005331 Bacteria 1709
19 Ga0068869_100036333 3300005334 Bacteria 3498
20 Ga0068869_100043748 3300005334 Bacteria 3218
21 Ga0068869_100254893 3300005334 Bacteria 1403
22 Ga0070680_100000553 3300005336 Bacteria 25626
23 Ga0070682_100008587 3300005337 Bacteria 5767
24 Ga0070682_100039029 3300005337 Bacteria 2916
25 Ga0068868_100015906 3300005338 Bacteria 5575
26 Ga0068868_100059164 3300005338 Bacteria 3030
27 Ga0070660_100143864 3300005339 Bacteria 1914
28 Ga0070689_100016548 3300005340 Bacteria 5398
29 Ga0070689_100150246 3300005340 Bacteria 1878
30 Ga0070687_100009863 3300005343 Bacteria 4102
31 Ga0070687_100167519 3300005343 Bacteria 1304
32 Ga0070692_10004047 3300005345 Bacteria 6057
33 Ga0070669_100007619 3300005353 Bacteria 7738
34 Ga0070669_100133767 3300005353 Bacteria 1905
35 Ga0070675_100040631 3300005354 Bacteria 3798
36 Ga0070671_100008237 3300005355 Bacteria 8342
37 Ga0070671_100202475 3300005355 Bacteria 1684
38 Ga0070673_100090292 3300005364 Bacteria 2502
39 Ga0070673_100156891 3300005364 Bacteria 1932
40 Ga0070673_100277742 3300005364 Bacteria 1468
41 Ga0070659_100017630 3300005366 Bacteria 5378
42 Ga0070659_100089353 3300005366 Bacteria 2468
43 Ga0070667_100067422 3300005367 Bacteria 3042
44 Ga0070667_100129989 3300005367 Bacteria 2197
45 Ga0070703_10011891 3300005406 Bacteria 2463
46 Ga0070705_100000790 3300005440 Bacteria 17847
47 Ga0070700_100000157 3300005441 Bacteria 39668
48 Ga0070700_100068990 3300005441 Bacteria 2250
49 Ga0070700_100218241 3300005441 Bacteria 1350
50 Ga0070694_100009404 3300005444 Bacteria 5998
51 Ga0070694_100009550 3300005444 Bacteria 5952
52 Ga0070694_100155467 3300005444 Bacteria 1674
53 Ga0070694_100166385 3300005444 Bacteria 1621
54 Ga0070708_100000692 3300005445 Bacteria 25660
55 Ga0070678_100141311 3300005456 Bacteria 1927
56 Ga0070662_100275473 3300005457 Unclassified 1360
57 Ga0070681_10001049 3300005458 Bacteria 23504
58 Ga0070681_10026110 3300005458 Bacteria 5873
59 Ga0068867_100023243 3300005459 Bacteria 4438
60 Ga0068867_100078675 3300005459 Bacteria 2480
61 Ga0068867_100213543 3300005459 Bacteria 1551
62 Ga0068867_100217261 3300005459 Bacteria 1538
63 Ga0070706_100000431 3300005467 Bacteria 50311
64 Ga0070706_100002699 3300005467 Bacteria 17761
65 Ga0070706_100006996 3300005467 Bacteria 10639
66 Ga0070706_100071540 3300005467 Bacteria 3208
67 Ga0070707_100005874 3300005468 Bacteria 11448
68 Ga0070707_100071431 3300005468 Bacteria 3344
69 Ga0070698_100101123 3300005471 Bacteria 2854
70 Ga0070698_100106639 3300005471 Bacteria 2770
71 Ga0070699_100006630 3300005518 Bacteria 10068
72 Ga0070699_100018140 3300005518 Bacteria 6046
73 Ga0070699_100117951 3300005518 Unclassified 2333
74 Ga0070679_100000139 3300005530 Bacteria 58974
75 Ga0070679_100024897 3300005530 Bacteria 5866
76 Ga0070697_100025516 3300005536 Bacteria 4715
77 Ga0070697_100027499 3300005536 Bacteria 4551
78 Ga0068853_100010603 3300005539 Bacteria 7454
79 Ga0070672_100022323 3300005543 Bacteria 4648
80 Ga0070695_100023949 3300005545 Bacteria 3758
81 Ga0070696_100100639 3300005546 Bacteria 2071
82 Ga0070696_100131306 3300005546 Bacteria 1822
83 Ga0070696_100213561 3300005546 Bacteria 1445
84 Ga0070696_100356079 3300005546 Unclassified 1135
85 Ga0070693_100003842 3300005547 Bacteria 7038
86 Ga0070693_100044067 3300005547 Bacteria 2522
87 Ga0070693_100044094 3300005547 Bacteria 2522
88 Ga0070693_100104440 3300005547 Bacteria 1732
89 Ga0070665_100281796 3300005548 Bacteria 1664
90 Ga0070704_100019926 3300005549 Bacteria 4317
91 Ga0070664_100011690 3300005564 Bacteria 7125
92 Ga0070664_100096514 3300005564 Bacteria 2565
93 Ga0068857_100001249 3300005577 Bacteria 19891
94 Ga0068856_100032949 3300005614 Bacteria 5074
95 Ga0070702_100008683 3300005615 Bacteria 4934
96 Ga0070702_100015520 3300005615 Bacteria 3890
97 Ga0068859_100029043 3300005617 Bacteria 5548
98 Ga0068859_100091953 3300005617 Bacteria 3085
99 Ga0068859_100137703 3300005617 Bacteria 2515
100 Ga0068859_100163048 3300005617 Bacteria 2308
101 Ga0068859_100265755 3300005617 Bacteria 1807
102 Ga0068859_100392361 3300005617 Bacteria 1484
103 Ga0068864_100000825 3300005618 Bacteria 26108
104 Ga0068864_100058825 3300005618 Bacteria 3323
105 Ga0068864_100086607 3300005618 Bacteria 2756
106 Ga0068864_100125139 3300005618 Bacteria 2303
107 Ga0068864_100178399 3300005618 Bacteria 1941
108 Ga0068866_10055610 3300005718 Bacteria 2033
109 Ga0068861_100279721 3300005719 Bacteria 1436
110 Ga0068851_10161277 3300005834 Bacteria 1232
111 Ga0068870_10084799 3300005840 Bacteria 1759
112 Ga0068863_100102058 3300005841 Bacteria 2727
113 Ga0068863_100123253 3300005841 Bacteria 2472
114 Ga0068863_100179111 3300005841 Bacteria 2035
115 Ga0068863_100205247 3300005841 Bacteria 1897
116 Ga0068863_100377355 3300005841 Bacteria 1384
117 Ga0068858_100044647 3300005842 Bacteria 4107
118 Ga0068858_100272289 3300005842 Unclassified 1611
119 Ga0068860_100004749 3300005843 Bacteria 13845
120 Ga0068860_100058693 3300005843 Bacteria 3658
121 Ga0081539_10000998 3300005985 Bacteria 52505
122 Ga0081539_10002508 3300005985 Bacteria 25695
123 Ga0097621_100006162 3300006237 Bacteria 8498
124 Ga0097621_100059785 3300006237 Bacteria 3121
125 Ga0097621_100276682 3300006237 Bacteria 1477
126 Ga0068871_100009568 3300006358 Bacteria 7035
127 Ga0075430_100123572 3300006846 Bacteria 2157
128 Ga0075433_10030418 3300006852 Bacteria 4607
129 Ga0075433_10063504 3300006852 Bacteria 3235
130 Ga0075433_10170150 3300006852 Bacteria 1939
131 Ga0075433_10209012 3300006852 Bacteria 1735
132 Ga0075434_100033150 3300006871 Bacteria 5095
133 Ga0075434_100075815 3300006871 Bacteria 3357
134 Ga0075434_100168776 3300006871 Bacteria 2208
135 Ga0068865_100016793 3300006881 Bacteria 4691
136 Ga0097620_100029042 3300006931 Bacteria 5548
137 Ga0097620_100091950 3300006931 Bacteria 3085
138 Ga0097620_100137705 3300006931 Bacteria 2515
139 Ga0097620_100163049 3300006931 Bacteria 2308
140 Ga0097620_100265767 3300006931 Bacteria 1807
141 Ga0097620_100392368 3300006931 Bacteria 1484
142 Ga0075435_100013898 3300007076 Bacteria 6004
143 Ga0111539_10007031 3300009094 Bacteria 14443
144 Ga0111539_10515064 3300009094 Bacteria 1393
145 Ga0105245_10044337 3300009098 Bacteria 3969
146 Ga0105245_10262198 3300009098 Bacteria 1682
147 Ga0105247_10018383 3300009101 Bacteria 4193
148 Ga0114129_10039253 3300009147 Bacteria 6675
149 Ga0114129_10816664 3300009147 Bacteria 1188
150 Ga0105243_10018669 3300009148 Bacteria 5255
151 Ga0105243_10062060 3300009148 Bacteria 2991
152 Ga0105243_10289301 3300009148 Bacteria 1480
153 Ga0105243_10309694 3300009148 Bacteria 1434
154 Ga0105243_10339421 3300009148 Bacteria 1375
155 Ga0105241_10143437 3300009174 Bacteria 1947
156 Ga0105241_10145655 3300009174 Bacteria 1932
157 Ga0105241_10237907 3300009174 Bacteria 1538
158 Ga0105241_10458387 3300009174 Unclassified 1129
159 Ga0105242_10123437 3300009176 Bacteria 2226
160 Ga0105248_10014780 3300009177 Bacteria 8596
161 Ga0105248_10050917 3300009177 Bacteria 4647
162 Ga0105248_10106059 3300009177 Bacteria 3168
163 Ga0105248_10244679 3300009177 Bacteria 2019
164 Ga0105248_10670699 3300009177 Bacteria 1170
165 Ga0105248_10715662 3300009177 Bacteria 1130
166 Ga0105248_10730651 3300009177 Bacteria 1117
167 Ga0105237_10000468 3300009545 Bacteria 57134
168 Ga0105238_10002654 3300009551 Bacteria 17795
169 Ga0105238_10240300 3300009551 Bacteria 1788
170 Ga0105249_10000375 3300009553 Bacteria 44344
171 Ga0105249_10612938 3300009553 Unclassified 1144
172 Ga0105239_10477645 3300010375 Bacteria 1416
173 Ga0105246_10405854 3300011119 Unclassified 1133
174 Ga0157373_10046336 3300013100 Bacteria 3102
175 Ga0157373_10120551 3300013100 Bacteria 1843
176 Ga0157374_10220309 3300013296 Bacteria 1862
177 Ga0157374_10366015 3300013296 Bacteria 1434
178 Ga0157378_10031573 3300013297 Bacteria 4678
179 Ga0157378_10051879 3300013297 Bacteria 3649
180 Ga0157378_10279858 3300013297 Unclassified 1608
181 Ga0163162_10000162 3300013306 Bacteria 61820
182 Ga0163162_10148977 3300013306 Bacteria 2457
183 Ga0163162_10275255 3300013306 Bacteria 1815
184 Ga0163162_10292633 3300013306 Bacteria 1760
185 Ga0157372_10096686 3300013307 Bacteria 3366
186 Ga0157372_10611146 3300013307 Unclassified 1271
187 Ga0157375_10030870 3300013308 Bacteria 5058
188 Ga0157375_10044583 3300013308 Bacteria 4310
189 Ga0157375_10172224 3300013308 Bacteria 2313
190 Ga0157375_10185929 3300013308 Bacteria 2231
191 Ga0157375_10207418 3300013308 Bacteria 2116
192 Ga0163163_10003484 3300014325 Bacteria 13363
193 Ga0163163_10007389 3300014325 Bacteria 9698
194 Ga0163163_10029180 3300014325 Bacteria 5306
195 Ga0163163_10054980 3300014325 Bacteria 3934
196 Ga0157380_10000349 3300014326 Bacteria 27635
197 Ga0157380_10013349 3300014326 Bacteria 5987
198 Ga0157380_10141097 3300014326 Bacteria 2070
199 Ga0157380_10294993 3300014326 Unclassified 1490
200 Ga0157377_10091659 3300014745 Unclassified 1796
201 Ga0157379_10068230 3300014968 Bacteria 3179
202 Ga0157379_10408017 3300014968 Bacteria 1250
203 Ga0157376_10053240 3300014969 Bacteria 3369
204 Ga0163161_10122850 3300017792 Bacteria 1952
205 Ga0213876_10004360 3300021384 Bacteria 7923
206 Ga0207697_10055822 3300025315 Bacteria 1638
207 Ga0207656_10006626 3300025321 Bacteria 4179
208 Ga0207653_10013847 3300025885 Bacteria 2527
209 Ga0207642_10126167 3300025899 Unclassified 1328
210 Ga0207647_10012587 3300025904 Bacteria 5884
211 Ga0207643_10077730 3300025908 Bacteria 1919
212 Ga0207684_10000316 3300025910 Bacteria 68606
213 Ga0207684_10020057 3300025910 Bacteria 5712
214 Ga0207684_10020813 3300025910 Bacteria 5604
215 Ga0207684_10113649 3300025910 Bacteria 2318
216 Ga0207654_10054256 3300025911 Bacteria 2316
217 Ga0207654_10140933 3300025911 Bacteria 1537
218 Ga0207654_10270467 3300025911 Bacteria 1146
219 Ga0207707_10000050 3300025912 Bacteria 117404
220 Ga0207707_10166681 3300025912 Bacteria 1925
221 Ga0207695_10209270 3300025913 Bacteria 1862
222 Ga0207671_10001108 3300025914 Bacteria 32488
223 Ga0207671_10153514 3300025914 Bacteria 1780
224 Ga0207662_10049147 3300025918 Bacteria 2501
225 Ga0207662_10153293 3300025918 Bacteria 1467
226 Ga0207657_10023404 3300025919 Bacteria 5752
227 Ga0207652_10000170 3300025921 Bacteria 70017
228 Ga0207646_10028445 3300025922 Bacteria 5089
229 Ga0207681_10006771 3300025923 Bacteria 7029
230 Ga0207681_10098845 3300025923 Bacteria 2100
231 Ga0207694_10014984 3300025924 Bacteria 5845
232 Ga0207650_10000001 3300025925 Bacteria 1545726
233 Ga0207650_10000555 3300025925 Bacteria 30291
234 Ga0207650_10094314 3300025925 Bacteria 2292
235 Ga0207659_10134520 3300025926 Unclassified 1912
236 Ga0207687_10150521 3300025927 Unclassified 1775
237 Ga0207644_10048186 3300025931 Bacteria 3045
238 Ga0207690_10039967 3300025932 Bacteria 3063
239 Ga0207690_10063515 3300025932 Bacteria 2518
240 Ga0207706_10027797 3300025933 Bacteria 5056
241 Ga0207686_10102606 3300025934 Bacteria 1913
242 Ga0207709_10003714 3300025935 Bacteria 8995
243 Ga0207709_10175806 3300025935 Bacteria 1507
244 Ga0207670_10004511 3300025936 Bacteria 7503
245 Ga0207670_10037065 3300025936 Bacteria 3176
246 Ga0207670_10050574 3300025936 Bacteria 2786
247 Ga0207665_10013679 3300025939 Bacteria 5337
248 Ga0207665_10039040 3300025939 Bacteria 3164
249 Ga0207691_10012812 3300025940 Bacteria 8026
250 Ga0207691_10167265 3300025940 Bacteria 1927
251 Ga0207711_10058531 3300025941 Bacteria 3316
252 Ga0207711_10082296 3300025941 Bacteria 2814
253 Ga0207711_10097365 3300025941 Bacteria 2598
254 Ga0207711_10129470 3300025941 Bacteria 2261
255 Ga0207689_10017022 3300025942 Bacteria 6151
256 Ga0207689_10044179 3300025942 Bacteria 3683
257 Ga0207689_10046642 3300025942 Bacteria 3581
258 Ga0207679_10050543 3300025945 Bacteria 3039
259 Ga0207651_10001864 3300025960 Bacteria 9854
260 Ga0207712_10000313 3300025961 Bacteria 44454
261 Ga0207712_10010449 3300025961 Bacteria 5893
262 Ga0207712_10148349 3300025961 Bacteria 1809
263 Ga0207640_10012740 3300025981 Bacteria 4799
264 Ga0207640_10242242 3300025981 Bacteria 1394
265 Ga0207677_10234646 3300026023 Bacteria 1480
266 Ga0207703_10028638 3300026035 Bacteria 4393
267 Ga0207703_10166273 3300026035 Bacteria 1936
268 Ga0207703_10341511 3300026035 Bacteria 1376
269 Ga0207639_10050021 3300026041 Bacteria 3172
270 Ga0207708_10000331 3300026075 Bacteria 37200
271 Ga0207708_10036223 3300026075 Bacteria 3756
272 Ga0207708_10152470 3300026075 Bacteria 1820
273 Ga0207708_10203403 3300026075 Unclassified 1581
274 Ga0207641_10220357 3300026088 Bacteria 1759
275 Ga0207648_10047545 3300026089 Bacteria 3760
276 Ga0207648_10048402 3300026089 Bacteria 3721
277 Ga0207648_10058846 3300026089 Bacteria 3351
278 Ga0207648_10072347 3300026089 Bacteria 3005
279 Ga0207648_10079262 3300026089 Bacteria 2865
280 Ga0207648_10186188 3300026089 Bacteria 1839
281 Ga0207676_10004620 3300026095 Bacteria 9749
282 Ga0207676_10004704 3300026095 Bacteria 9671
283 Ga0207676_10068124 3300026095 Bacteria 2845
284 Ga0207676_10192572 3300026095 Bacteria 1795
285 Ga0207674_10000023 3300026116 Bacteria 157752
286 Ga0207674_10154561 3300026116 Bacteria 2249
287 Ga0207674_10184120 3300026116 Bacteria 2039
288 Ga0207674_10210929 3300026116 Bacteria 1891
289 Ga0207674_10295578 3300026116 Bacteria 1568
290 Ga0207675_100005941 3300026118 Bacteria 11642
291 Ga0207675_100076065 3300026118 Bacteria 3143
292 Ga0207683_10207419 3300026121 Bacteria 1783
293 Ga0207683_10365002 3300026121 Bacteria 1326
294 Ga0207428_10006610 3300027907 Bacteria 10670
295 Ga0268266_10072954 3300028379 Bacteria 2978
296 Ga0268264_10244152 3300028381 Bacteria 1665
297 Ga0268264_10294909 3300028381 Unclassified 1524
298 Ga0268264_10394251 3300028381 Bacteria 1329
299 Ga0307408_100009542 3300031548 Bacteria 6402
300 Ga0307405_10000863 3300031731 Bacteria 11973
301 Ga0307405_10050394 3300031731 Bacteria 2578
302 Ga0307410_10109102 3300031852 Bacteria 2000
303 Ga0307406_10004810 3300031901 Bacteria 7355
304 Ga0307407_10051157 3300031903 Bacteria 2367
305 Ga0307412_10033793 3300031911 Bacteria 3253
306 Ga0307416_100005893 3300032002 Bacteria 7605
307 Ga0307416_100301534 3300032002 Bacteria 1593
308 Ga0307414_10002802 3300032004 Bacteria 9184
309 Ga0307411_10002568 3300032005 Bacteria 8097
310 Ga0307411_10121993 3300032005 Unclassified 1888
311 Ga0307411_10143833 3300032005 Bacteria 1762
312 Ga0307415_100004025 3300032126 Bacteria 7576
313 Ga0373951_0001068 3300035091 Bacteria 7340
314 Ga0373937_0050847 3300036401 Bacteria 3798
315 Ga0395900_0166661 3300037418 Bacteria 2245
316 Ga0395900_0369332 3300037418 Bacteria 1405
317 Ga0395901_0153365 3300038443 Bacteria 2420
318 Ga0242420_000515 3300038996 Bacteria 4434
319 Ga0242420_007626 3300038996 Unclassified 1740
320 Ga0436365_0490709 3300039437 Bacteria 7922
321 Ga0451576_0430116 3300045051 Bacteria 1385
322 Ga0496102_0048579 3300048905 Bacteria 3859
323 Ga0496103_0039916 3300048906 Bacteria 2885
324 Ga0496104_0154207 3300048907 Bacteria 2205
325 Ga0496107_0136864 3300048910 Unclassified 1810
326 Ga0496108_0179762 3300048911 Bacteria 1832
327 Ga0496109_0184227 3300048912 Bacteria 1962
328 Ga0496110_0090144 3300048913 Bacteria 2742
329 Ga0496112_0060805 3300048915 Bacteria 3723
330 Ga0496112_0246514 3300048915 Bacteria 1738
331 Ga0496112_0390124 3300048915 Bacteria 1333
332 Ga0496113_0041396 3300048916 Bacteria 3400
333 Ga0496113_0350292 3300048916 Bacteria 1185
334 Ga0501296_001544 3300049519 Bacteria 2339
335 Ga0501298_001833 3300049521 Bacteria 3143
336 Ga0501298_016644 3300049521 Unclassified 1334
337 Ga0501299_006789 3300049522 Bacteria 1806
338 Ga0501299_006811 3300049522 Bacteria 1803
339 Ga0501038_0009016 3300049574 Bacteria 9155
340 Ga0501075_0198143 3300049591 Unclassified 1532
341 Ga0501216_006097 3300049660 Bacteria 1838
342 Ga0501217_000551 3300049661 Bacteria 6270
343 Ga0501217_011381 3300049661 Bacteria 1968
344 Ga0501223_009373 3300049663 Bacteria 1984
345 Ga0501223_009747 3300049663 Bacteria 1940
346 Ga0501227_003648 3300049665 Bacteria 3336
347 Ga0501233_003685 3300049668 Bacteria 2766
348 Ga0501233_014833 3300049668 Bacteria 1597
349 Ga0501233_046131 3300049668 Unclassified 1041
350 Ga0501236_006070 3300049670 Bacteria 1477
351 Ga0501243_013251 3300049675 Bacteria 1307
352 Ga0501225_0003197 3300049705 Bacteria 4999
353 Ga0501225_0040488 3300049705 Bacteria 1284
354 Ga0501229_001611 3300049706 Bacteria 2641
355 Ga0501234_003643 3300049707 Bacteria 2421
356 Ga0501234_019284 3300049707 Bacteria 1081
357 Ga0501273_001498 3300049770 Bacteria 2240
358 Ga0501283_002077 3300049779 Bacteria 2599
359 Ga0501226_001870 3300049853 Bacteria 2636
360 nmdc:mga05p37_71201_c1 3300050507 Bacteria 4277
361 nmdc:mga09592_332923_c1 3300050508 Unclassified 1314
362 nmdc:mga06r32_557689_c1 3300050510 Bacteria 1119
363 nmdc:mga08y16_32821_c1 3300050511 Bacteria 5458
364 nmdc:mga0n895_379400_c1 3300050512 Unclassified 1431
365 nmdc:mga0n895_9739_c1 3300050512 Bacteria 8428
366 nmdc:mga0a205_102938_c1 3300050515 Bacteria 2754
367 nmdc:mga0a205_284277_c1 3300050515 Bacteria 1529
368 nmdc:mga0a205_50284_c1 3300050515 Bacteria 4024
369 nmdc:mga0a205_67709_c1 3300050515 Bacteria 3449
370 nmdc:mga0a205_85234_c1 3300050515 Bacteria 3051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10715662 Ga0105248_107156621 301
2 3300005334 Ga0068869_100254893 Ga0068869_1002548931 309
3 3300005340 Ga0070689_100150246 Ga0070689_1001502463 309
4 3300005353 Ga0070669_100007619 Ga0070669_1000076199 309
5 3300025923 Ga0207681_10006771 Ga0207681_100067716 309
6 3300025925 Ga0207650_10000555 Ga0207650_1000055518 309
7 3300025936 Ga0207670_10037065 Ga0207670_100370653 309
8 3300013308 Ga0157375_10172224 Ga0157375_101722242 311
9 3300014326 Ga0157380_10000349 Ga0157380_100003494 311
10 3300049668 Ga0501233_046131 Ga0501233_046131_54_998 312
11 3300005293 Ga0065715_10110877 Ga0065715_101108772 314
12 3300005618 Ga0068864_100178399 Ga0068864_1001783992 314
13 3300025941 Ga0207711_10097365 Ga0207711_100973653 314
14 3300005337 Ga0070682_100008587 Ga0070682_1000085877 315
15 3300005345 Ga0070692_10004047 Ga0070692_100040472 315
16 3300005406 Ga0070703_10011891 Ga0070703_100118912 315
17 3300005440 Ga0070705_100000790 Ga0070705_10000079010 315
18 3300005444 Ga0070694_100009404 Ga0070694_1000094048 315
19 3300005547 Ga0070693_100003842 Ga0070693_1000038426 315
20 3300005549 Ga0070704_100019926 Ga0070704_1000199263 315
21 3300005615 Ga0070702_100015520 Ga0070702_1000155203 315
22 3300009177 Ga0105248_10014780 Ga0105248_1001478011 315
23 3300009545 Ga0105237_10000468 Ga0105237_1000046841 315
24 3300013306 Ga0163162_10148977 Ga0163162_101489772 315
25 3300014968 Ga0157379_10068230 Ga0157379_100682302 315
26 3300014968 Ga0157379_10408017 Ga0157379_104080172 315
27 3300025321 Ga0207656_10006626 Ga0207656_100066263 315
28 3300025885 Ga0207653_10013847 Ga0207653_100138473 315
29 3300025914 Ga0207671_10001108 Ga0207671_100011084 315
30 3300026035 Ga0207703_10166273 Ga0207703_101662732 315
31 3300026075 Ga0207708_10036223 Ga0207708_100362233 315
32 3300048916 Ga0496113_0041396 Ga0496113_0041396_208_1236 315
33 3300005467 Ga0070706_100071540 Ga0070706_1000715404 317
34 3300045051 Ga0451576_0430116 Ga0451576_0430116_362_1342 318
35 3300005355 Ga0070671_100008237 Ga0070671_1000082378 319
36 3300005328 Ga0070676_10047652 Ga0070676_100476522 320
37 3300005330 Ga0070690_100022602 Ga0070690_1000226023 320
38 3300005338 Ga0068868_100059164 Ga0068868_1000591641 320
39 3300005354 Ga0070675_100040631 Ga0070675_1000406312 320
40 3300005355 Ga0070671_100202475 Ga0070671_1002024751 320
41 3300005367 Ga0070667_100067422 Ga0070667_1000674222 320
42 3300005441 Ga0070700_100218241 Ga0070700_1002182412 320
43 3300005456 Ga0070678_100141311 Ga0070678_1001413112 320
44 3300005457 Ga0070662_100275473 Ga0070662_1002754731 320
45 3300005459 Ga0068867_100078675 Ga0068867_1000786753 320
46 3300005546 Ga0070696_100100639 Ga0070696_1001006392 320
47 3300005618 Ga0068864_100086607 Ga0068864_1000866071 320
48 3300005618 Ga0068864_100125139 Ga0068864_1001251392 320
49 3300005718 Ga0068866_10055610 Ga0068866_100556101 320
50 3300005841 Ga0068863_100102058 Ga0068863_1001020581 320
51 3300005842 Ga0068858_100272289 Ga0068858_1002722891 320
52 3300005843 Ga0068860_100058693 Ga0068860_1000586933 320
53 3300006237 Ga0097621_100276682 Ga0097621_1002766821 320
54 3300006881 Ga0068865_100016793 Ga0068865_1000167933 320
55 3300009174 Ga0105241_10145655 Ga0105241_101456552 320
56 3300009177 Ga0105248_10106059 Ga0105248_101060592 320
57 3300013296 Ga0157374_10366015 Ga0157374_103660152 320
58 3300013297 Ga0157378_10051879 Ga0157378_100518792 320
59 3300013308 Ga0157375_10185929 Ga0157375_101859292 320
60 3300014325 Ga0163163_10007389 Ga0163163_100073891 320
61 3300014326 Ga0157380_10294993 Ga0157380_102949932 320
62 3300014745 Ga0157377_10091659 Ga0157377_100916592 320
63 3300014969 Ga0157376_10053240 Ga0157376_100532402 320
64 3300017792 Ga0163161_10122850 Ga0163161_101228502 320
65 3300025926 Ga0207659_10134520 Ga0207659_101345202 320
66 3300025940 Ga0207691_10012812 Ga0207691_100128123 320
67 3300026075 Ga0207708_10203403 Ga0207708_102034032 320
68 3300026089 Ga0207648_10047545 Ga0207648_100475451 320
69 3300028381 Ga0268264_10294909 Ga0268264_102949091 320
70 3300036401 Ga0373937_0050847 Ga0373937_0050847_2128_3165 320
71 3300050510 nmdc:mga06r32_557689_c1 nmdc:mga06r32_557689_c1_61_1101 320
72 3300005331 Ga0070670_100070297 Ga0070670_1000702973 321
73 3300005444 Ga0070694_100155467 Ga0070694_1001554671 321
74 3300005467 Ga0070706_100002699 Ga0070706_10000269911 321
75 3300005617 Ga0068859_100091953 Ga0068859_1000919532 321
76 3300005719 Ga0068861_100279721 Ga0068861_1002797211 321
77 3300006237 Ga0097621_100059785 Ga0097621_1000597852 321
78 3300006931 Ga0097620_100091950 Ga0097620_1000919502 321
79 3300009553 Ga0105249_10612938 Ga0105249_106129381 321
80 3300014326 Ga0157380_10013349 Ga0157380_100133497 321
81 3300025315 Ga0207697_10055822 Ga0207697_100558221 321
82 3300025910 Ga0207684_10020057 Ga0207684_100200572 321
83 3300025923 Ga0207681_10098845 Ga0207681_100988452 321
84 3300025936 Ga0207670_10050574 Ga0207670_100505742 321
85 3300025961 Ga0207712_10148349 Ga0207712_101483492 321
86 3300026121 Ga0207683_10365002 Ga0207683_103650021 321
87 3300005334 Ga0068869_100036333 Ga0068869_1000363333 322
88 3300005338 Ga0068868_100015906 Ga0068868_1000159065 322
89 3300005339 Ga0070660_100143864 Ga0070660_1001438642 322
90 3300005364 Ga0070673_100277742 Ga0070673_1002777421 322
91 3300005366 Ga0070659_100017630 Ga0070659_1000176304 322
92 3300005367 Ga0070667_100129989 Ga0070667_1001299892 322
93 3300005458 Ga0070681_10026110 Ga0070681_100261104 322
94 3300005459 Ga0068867_100213543 Ga0068867_1002135432 322
95 3300005530 Ga0070679_100024897 Ga0070679_1000248972 322
96 3300005536 Ga0070697_100027499 Ga0070697_1000274993 322
97 3300005539 Ga0068853_100010603 Ga0068853_1000106037 322
98 3300005548 Ga0070665_100281796 Ga0070665_1002817962 322
99 3300005564 Ga0070664_100011690 Ga0070664_1000116908 322
100 3300005577 Ga0068857_100001249 Ga0068857_10000124911 322
101 3300005618 Ga0068864_100058825 Ga0068864_1000588252 322
102 3300005834 Ga0068851_10161277 Ga0068851_101612771 322
103 3300005842 Ga0068858_100044647 Ga0068858_1000446473 322
104 3300006237 Ga0097621_100006162 Ga0097621_1000061621 322
105 3300009148 Ga0105243_10062060 Ga0105243_100620602 322
106 3300014325 Ga0163163_10029180 Ga0163163_100291804 322
107 3300025899 Ga0207642_10126167 Ga0207642_101261672 322
108 3300025910 Ga0207684_10113649 Ga0207684_101136492 322
109 3300025912 Ga0207707_10166681 Ga0207707_101666811 322
110 3300025919 Ga0207657_10023404 Ga0207657_100234048 322
111 3300025931 Ga0207644_10048186 Ga0207644_100481862 322
112 3300025932 Ga0207690_10039967 Ga0207690_100399672 322
113 3300025941 Ga0207711_10082296 Ga0207711_100822962 322
114 3300025942 Ga0207689_10017022 Ga0207689_100170222 322
115 3300025942 Ga0207689_10046642 Ga0207689_100466422 322
116 3300026035 Ga0207703_10028638 Ga0207703_100286383 322
117 3300026041 Ga0207639_10050021 Ga0207639_100500212 322
118 3300026089 Ga0207648_10048402 Ga0207648_100484022 322
119 3300026095 Ga0207676_10004704 Ga0207676_100047044 322
120 3300026095 Ga0207676_10192572 Ga0207676_101925722 322
121 3300026116 Ga0207674_10000023 Ga0207674_10000023117 322
122 3300026118 Ga0207675_100076065 Ga0207675_1000760653 322
123 3300026121 Ga0207683_10207419 Ga0207683_102074193 322
124 3300028379 Ga0268266_10072954 Ga0268266_100729541 322
125 3300031548 Ga0307408_100009542 Ga0307408_1000095427 322
126 3300031731 Ga0307405_10000863 Ga0307405_100008636 322
127 3300031901 Ga0307406_10004810 Ga0307406_100048102 322
128 3300031903 Ga0307407_10051157 Ga0307407_100511572 322
129 3300031911 Ga0307412_10033793 Ga0307412_100337932 322
130 3300032002 Ga0307416_100005893 Ga0307416_10000589310 322
131 3300032004 Ga0307414_10002802 Ga0307414_1000280211 322
132 3300032005 Ga0307411_10002568 Ga0307411_1000256810 322
133 3300032126 Ga0307415_100004025 Ga0307415_1000040252 322
134 3300049661 Ga0501217_000551 Ga0501217_000551_1687_2727 322
135 3300049663 Ga0501223_009373 Ga0501223_009373_24_1064 322
136 3300049665 Ga0501227_003648 Ga0501227_003648_1104_2144 322
137 3300049668 Ga0501233_003685 Ga0501233_003685_317_1357 322
138 3300049670 Ga0501236_006070 Ga0501236_006070_381_1421 322
139 3300049705 Ga0501225_0003197 Ga0501225_0003197_2667_3707 322
140 3300049706 Ga0501229_001611 Ga0501229_001611_52_1092 322
141 3300049853 Ga0501226_001870 Ga0501226_001870_1522_2562 322
142 3300005353 Ga0070669_100133767 Ga0070669_1001337671 323
143 3300009098 Ga0105245_10044337 Ga0105245_100443372 323
144 3300009553 Ga0105249_10000375 Ga0105249_100003752 323
145 3300013296 Ga0157374_10220309 Ga0157374_102203091 323
146 3300013306 Ga0163162_10000162 Ga0163162_1000016242 323
147 3300025908 Ga0207643_10077730 Ga0207643_100777301 323
148 3300025918 Ga0207662_10049147 Ga0207662_100491471 323
149 3300025945 Ga0207679_10050543 Ga0207679_100505433 323
150 3300025961 Ga0207712_10000313 Ga0207712_1000031343 323
151 3300005331 Ga0070670_100107148 Ga0070670_1001071483 324
152 3300028381 Ga0268264_10244152 Ga0268264_102441522 325
153 3300049705 Ga0501225_0040488 Ga0501225_0040488_282_1262 326
154 3300049707 Ga0501234_019284 Ga0501234_019284_23_1003 326
155 3300005985 Ga0081539_10002508 Ga0081539_1000250820 329
156 3300005543 Ga0070672_100022323 Ga0070672_1000223237 331
157 3300005843 Ga0068860_100004749 Ga0068860_1000047498 331
158 3300009174 Ga0105241_10458387 Ga0105241_104583871 331
159 3300025911 Ga0207654_10270467 Ga0207654_102704671 331
160 3300025940 Ga0207691_10167265 Ga0207691_101672651 331
161 3300032005 Ga0307411_10121993 Ga0307411_101219932 331
162 3300048915 Ga0496112_0060805 Ga0496112_0060805_2097_3143 331
163 3300049522 Ga0501299_006789 Ga0501299_006789_20_1054 331
164 3300049663 Ga0501223_009747 Ga0501223_009747_828_1862 331
165 3300049770 Ga0501273_001498 Ga0501273_001498_1076_2110 331
166 3300025960 Ga0207651_10001864 Ga0207651_100018649 333
167 3300005331 Ga0070670_100031242 Ga0070670_1000312422 334
168 3300025925 Ga0207650_10094314 Ga0207650_100943142 334
169 3300005328 Ga0070676_10069683 Ga0070676_100696831 335
170 3300005364 Ga0070673_100156891 Ga0070673_1001568911 335
171 3300005546 Ga0070696_100213561 Ga0070696_1002135612 335
172 3300005617 Ga0068859_100029043 Ga0068859_1000290433 335
173 3300005617 Ga0068859_100163048 Ga0068859_1001630482 335
174 3300006931 Ga0097620_100029042 Ga0097620_1000290423 335
175 3300006931 Ga0097620_100163049 Ga0097620_1001630492 335
176 3300009147 Ga0114129_10816664 Ga0114129_108166641 335
177 3300013306 Ga0163162_10292633 Ga0163162_102926332 335
178 3300013308 Ga0157375_10030870 Ga0157375_100308703 335
179 3300025933 Ga0207706_10027797 Ga0207706_100277971 335
180 3300026075 Ga0207708_10152470 Ga0207708_101524701 335
181 3300049574 Ga0501038_0009016 Ga0501038_0009016_3981_5024 335
182 3300049591 Ga0501075_0198143 Ga0501075_0198143_104_1114 335
183 3300050511 nmdc:mga08y16_32821_c1 nmdc:mga08y16_32821_c1_1753_2766 335
184 3300005336 Ga0070680_100000553 Ga0070680_10000055313 336
185 3300005458 Ga0070681_10001049 Ga0070681_100010491 336
186 3300005530 Ga0070679_100000139 Ga0070679_10000013924 336
187 3300025912 Ga0207707_10000050 Ga0207707_1000005070 336
188 3300025921 Ga0207652_10000170 Ga0207652_1000017030 336
189 3300005288 Ga0065714_10064594 Ga0065714_1006459418 338
190 3300005290 Ga0065712_10000121 Ga0065712_1000012119 338
191 3300005293 Ga0065715_10089446 Ga0065715_1008944612 338
192 3300013308 Ga0157375_10044583 Ga0157375_100445833 338
193 3300048910 Ga0496107_0136864 Ga0496107_0136864_591_1607 338
194 3300005841 Ga0068863_100377355 Ga0068863_1003773552 339
195 3300025939 Ga0207665_10039040 Ga0207665_100390403 339
196 3300031852 Ga0307410_10109102 Ga0307410_101091022 339
197 3300032005 Ga0307411_10143833 Ga0307411_101438332 339
198 3300049519 Ga0501296_001544 Ga0501296_001544_263_1300 339
199 3300049521 Ga0501298_001833 Ga0501298_001833_709_1746 339
200 3300049522 Ga0501299_006811 Ga0501299_006811_142_1179 339
201 3300049660 Ga0501216_006097 Ga0501216_006097_233_1270 339
202 3300049668 Ga0501233_014833 Ga0501233_014833_461_1498 339
203 3300049707 Ga0501234_003643 Ga0501234_003643_1038_2075 339
204 3300005445 Ga0070708_100000692 Ga0070708_1000006928 340
205 3300005467 Ga0070706_100000431 Ga0070706_10000043144 340
206 3300005467 Ga0070706_100006996 Ga0070706_1000069964 340
207 3300005518 Ga0070699_100018140 Ga0070699_1000181401 340
208 3300007076 Ga0075435_100013898 Ga0075435_1000138984 340
209 3300025910 Ga0207684_10000316 Ga0207684_1000031616 340
210 3300025910 Ga0207684_10020813 Ga0207684_100208135 340
211 3300032002 Ga0307416_100301534 Ga0307416_1003015341 340
212 3300005331 Ga0070670_100069666 Ga0070670_1000696662 341
213 3300005340 Ga0070689_100016548 Ga0070689_1000165485 341
214 3300005618 Ga0068864_100000825 Ga0068864_1000008253 341
215 3300005840 Ga0068870_10084799 Ga0068870_100847992 341
216 3300005841 Ga0068863_100205247 Ga0068863_1002052472 341
217 3300006852 Ga0075433_10063504 Ga0075433_100635043 341
218 3300006871 Ga0075434_100075815 Ga0075434_1000758153 341
219 3300009094 Ga0111539_10515064 Ga0111539_105150642 341
220 3300025936 Ga0207670_10004511 Ga0207670_100045114 341
221 3300026095 Ga0207676_10004620 Ga0207676_100046206 341
222 3300026095 Ga0207676_10068124 Ga0207676_100681243 341
223 3300026116 Ga0207674_10154561 Ga0207674_101545612 341
224 3300031731 Ga0307405_10050394 Ga0307405_100503942 341
225 3300050512 nmdc:mga0n895_9739_c1 nmdc:mga0n895_9739_c1_6453_7478 341
226 3300050515 nmdc:mga0a205_102938_c1 nmdc:mga0a205_102938_c1_216_1241 341
227 3300050515 nmdc:mga0a205_284277_c1 nmdc:mga0a205_284277_c1_250_1284 341
228 3300002459 JGI24751J29686_10000098 JGI24751J29686_1000009832 342
229 3300003203 JGI25406J46586_10000959 JGI25406J46586_100009595 342
230 3300005289 Ga0065704_10078582 Ga0065704_100785823 342
231 3300005290 Ga0065712_10079872 Ga0065712_100798722 342
232 3300005293 Ga0065715_10100026 Ga0065715_101000263 342
233 3300005331 Ga0070670_100002046 Ga0070670_10000204613 342
234 3300005331 Ga0070670_100206216 Ga0070670_1002062162 342
235 3300005334 Ga0068869_100043748 Ga0068869_1000437483 342
236 3300005337 Ga0070682_100039029 Ga0070682_1000390292 342
237 3300005343 Ga0070687_100009863 Ga0070687_1000098631 342
238 3300005343 Ga0070687_100167519 Ga0070687_1001675192 342
239 3300005364 Ga0070673_100090292 Ga0070673_1000902922 342
240 3300005366 Ga0070659_100089353 Ga0070659_1000893532 342
241 3300005441 Ga0070700_100000157 Ga0070700_10000015727 342
242 3300005441 Ga0070700_100068990 Ga0070700_1000689902 342
243 3300005444 Ga0070694_100009550 Ga0070694_1000095508 342
244 3300005444 Ga0070694_100166385 Ga0070694_1001663852 342
245 3300005459 Ga0068867_100023243 Ga0068867_1000232431 342
246 3300005459 Ga0068867_100217261 Ga0068867_1002172612 342
247 3300005468 Ga0070707_100005874 Ga0070707_1000058748 342
248 3300005468 Ga0070707_100071431 Ga0070707_1000714312 342
249 3300005471 Ga0070698_100101123 Ga0070698_1001011232 342
250 3300005471 Ga0070698_100106639 Ga0070698_1001066393 342
251 3300005518 Ga0070699_100006630 Ga0070699_1000066307 342
252 3300005518 Ga0070699_100117951 Ga0070699_1001179511 342
253 3300005536 Ga0070697_100025516 Ga0070697_1000255163 342
254 3300005545 Ga0070695_100023949 Ga0070695_1000239493 342
255 3300005546 Ga0070696_100131306 Ga0070696_1001313061 342
256 3300005546 Ga0070696_100356079 Ga0070696_1003560791 342
257 3300005547 Ga0070693_100044067 Ga0070693_1000440673 342
258 3300005547 Ga0070693_100044094 Ga0070693_1000440942 342
259 3300005547 Ga0070693_100104440 Ga0070693_1001044401 342
260 3300005564 Ga0070664_100096514 Ga0070664_1000965141 342
261 3300005614 Ga0068856_100032949 Ga0068856_1000329494 342
262 3300005615 Ga0070702_100008683 Ga0070702_1000086834 342
263 3300005617 Ga0068859_100137703 Ga0068859_1001377032 342
264 3300005617 Ga0068859_100265755 Ga0068859_1002657552 342
265 3300005617 Ga0068859_100392361 Ga0068859_1003923612 342
266 3300005841 Ga0068863_100123253 Ga0068863_1001232533 342
267 3300005841 Ga0068863_100179111 Ga0068863_1001791113 342
268 3300005985 Ga0081539_10000998 Ga0081539_1000099815 342
269 3300006358 Ga0068871_100009568 Ga0068871_1000095683 342
270 3300006846 Ga0075430_100123572 Ga0075430_1001235722 342
271 3300006852 Ga0075433_10030418 Ga0075433_100304184 342
272 3300006852 Ga0075433_10170150 Ga0075433_101701502 342
273 3300006852 Ga0075433_10209012 Ga0075433_102090123 342
274 3300006871 Ga0075434_100033150 Ga0075434_1000331503 342
275 3300006871 Ga0075434_100168776 Ga0075434_1001687762 342
276 3300006931 Ga0097620_100137705 Ga0097620_1001377052 342
277 3300006931 Ga0097620_100265767 Ga0097620_1002657672 342
278 3300006931 Ga0097620_100392368 Ga0097620_1003923682 342
279 3300009094 Ga0111539_10007031 Ga0111539_1000703112 342
280 3300009098 Ga0105245_10262198 Ga0105245_102621983 342
281 3300009101 Ga0105247_10018383 Ga0105247_100183833 342
282 3300009147 Ga0114129_10039253 Ga0114129_100392536 342
283 3300009148 Ga0105243_10018669 Ga0105243_100186694 342
284 3300009148 Ga0105243_10289301 Ga0105243_102893011 342
285 3300009148 Ga0105243_10309694 Ga0105243_103096942 342
286 3300009148 Ga0105243_10339421 Ga0105243_103394211 342
287 3300009174 Ga0105241_10143437 Ga0105241_101434371 342
288 3300009174 Ga0105241_10237907 Ga0105241_102379072 342
289 3300009176 Ga0105242_10123437 Ga0105242_101234372 342
290 3300009177 Ga0105248_10050917 Ga0105248_100509175 342
291 3300009177 Ga0105248_10244679 Ga0105248_102446791 342
292 3300009177 Ga0105248_10670699 Ga0105248_106706991 342
293 3300009177 Ga0105248_10730651 Ga0105248_107306511 342
294 3300009551 Ga0105238_10002654 Ga0105238_100026543 342
295 3300009551 Ga0105238_10240300 Ga0105238_102403001 342
296 3300010375 Ga0105239_10477645 Ga0105239_104776451 342
297 3300011119 Ga0105246_10405854 Ga0105246_104058541 342
298 3300013100 Ga0157373_10046336 Ga0157373_100463363 342
299 3300013100 Ga0157373_10120551 Ga0157373_101205513 342
300 3300013297 Ga0157378_10031573 Ga0157378_100315733 342
301 3300013297 Ga0157378_10279858 Ga0157378_102798582 342
302 3300013306 Ga0163162_10275255 Ga0163162_102752552 342
303 3300013307 Ga0157372_10096686 Ga0157372_100966864 342
304 3300013307 Ga0157372_10611146 Ga0157372_106111462 342
305 3300013308 Ga0157375_10207418 Ga0157375_102074183 342
306 3300014325 Ga0163163_10003484 Ga0163163_1000348413 342
307 3300014325 Ga0163163_10054980 Ga0163163_100549803 342
308 3300014326 Ga0157380_10141097 Ga0157380_101410971 342
309 3300021384 Ga0213876_10004360 Ga0213876_100043604 342
310 3300025904 Ga0207647_10012587 Ga0207647_100125873 342
311 3300025911 Ga0207654_10054256 Ga0207654_100542562 342
312 3300025911 Ga0207654_10140933 Ga0207654_101409332 342
313 3300025913 Ga0207695_10209270 Ga0207695_102092703 342
314 3300025914 Ga0207671_10153514 Ga0207671_101535142 342
315 3300025918 Ga0207662_10153293 Ga0207662_101532931 342
316 3300025922 Ga0207646_10028445 Ga0207646_100284453 342
317 3300025924 Ga0207694_10014984 Ga0207694_100149845 342
318 3300025925 Ga0207650_10000001 Ga0207650_100000011078 342
319 3300025927 Ga0207687_10150521 Ga0207687_101505211 342
320 3300025932 Ga0207690_10063515 Ga0207690_100635153 342
321 3300025934 Ga0207686_10102606 Ga0207686_101026063 342
322 3300025935 Ga0207709_10003714 Ga0207709_100037142 342
323 3300025935 Ga0207709_10175806 Ga0207709_101758061 342
324 3300025939 Ga0207665_10013679 Ga0207665_100136794 342
325 3300025941 Ga0207711_10058531 Ga0207711_100585312 342
326 3300025941 Ga0207711_10129470 Ga0207711_101294702 342
327 3300025942 Ga0207689_10044179 Ga0207689_100441793 342
328 3300025961 Ga0207712_10010449 Ga0207712_100104492 342
329 3300025981 Ga0207640_10012740 Ga0207640_100127401 342
330 3300025981 Ga0207640_10242242 Ga0207640_102422422 342
331 3300026023 Ga0207677_10234646 Ga0207677_102346461 342
332 3300026035 Ga0207703_10341511 Ga0207703_103415112 342
333 3300026075 Ga0207708_10000331 Ga0207708_1000033125 342
334 3300026088 Ga0207641_10220357 Ga0207641_102203572 342
335 3300026089 Ga0207648_10058846 Ga0207648_100588462 342
336 3300026089 Ga0207648_10072347 Ga0207648_100723473 342
337 3300026089 Ga0207648_10079262 Ga0207648_100792623 342
338 3300026089 Ga0207648_10186188 Ga0207648_101861882 342
339 3300026116 Ga0207674_10184120 Ga0207674_101841202 342
340 3300026116 Ga0207674_10210929 Ga0207674_102109292 342
341 3300026116 Ga0207674_10295578 Ga0207674_102955782 342
342 3300026118 Ga0207675_100005941 Ga0207675_1000059419 342
343 3300027907 Ga0207428_10006610 Ga0207428_100066103 342
344 3300028381 Ga0268264_10394251 Ga0268264_103942511 342
345 3300035091 Ga0373951_0001068 Ga0373951_0001068_4605_5633 342
346 3300037418 Ga0395900_0166661 Ga0395900_0166661_25_1068 342
347 3300037418 Ga0395900_0369332 Ga0395900_0369332_196_1239 342
348 3300038443 Ga0395901_0153365 Ga0395901_0153365_601_1644 342
349 3300038996 Ga0242420_000515 Ga0242420_000515_2841_3869 342
350 3300038996 Ga0242420_007626 Ga0242420_007626_405_1442 342
351 3300039437 Ga0436365_0490709 Ga0436365_0490709_3690_4739 342
352 3300048905 Ga0496102_0048579 Ga0496102_0048579_2238_3275 342
353 3300048906 Ga0496103_0039916 Ga0496103_0039916_587_1624 342
354 3300048907 Ga0496104_0154207 Ga0496104_0154207_745_1782 342
355 3300048911 Ga0496108_0179762 Ga0496108_0179762_521_1567 342
356 3300048912 Ga0496109_0184227 Ga0496109_0184227_342_1379 342
357 3300048913 Ga0496110_0090144 Ga0496110_0090144_572_1621 342
358 3300048915 Ga0496112_0246514 Ga0496112_0246514_220_1263 342
359 3300048915 Ga0496112_0390124 Ga0496112_0390124_166_1215 342
360 3300048916 Ga0496113_0350292 Ga0496113_0350292_26_1054 342
361 3300049521 Ga0501298_016644 Ga0501298_016644_14_1048 342
362 3300049661 Ga0501217_011381 Ga0501217_011381_661_1704 342
363 3300049675 Ga0501243_013251 Ga0501243_013251_222_1265 342
364 3300049779 Ga0501283_002077 Ga0501283_002077_159_1193 342
365 3300050507 nmdc:mga05p37_71201_c1 nmdc:mga05p37_71201_c1_2944_3987 342
366 3300050508 nmdc:mga09592_332923_c1 nmdc:mga09592_332923_c1_230_1273 342
367 3300050512 nmdc:mga0n895_379400_c1 nmdc:mga0n895_379400_c1_332_1372 342
368 3300050515 nmdc:mga0a205_50284_c1 nmdc:mga0a205_50284_c1_697_1737 342
369 3300050515 nmdc:mga0a205_67709_c1 nmdc:mga0a205_67709_c1_1888_2922 342
370 3300050515 nmdc:mga0a205_85234_c1 nmdc:mga0a205_85234_c1_1522_2550 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

76

345

0.86

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

111

359

0.85

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

63

326

0.83

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

67

318

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.8811 30 342
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8665 29 339
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.8629 30 342
6lkj-assembly1.cif.gz_A two-component system protein mediate signal transduction 0.8588 30 332
1y4t-assembly2.cif.gz_D ferric binding protein from campylobacter jejuni 0.8576 31 336
ID Description Score Start End Superfamily
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.89 30 102 3.40.190.10
4elqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8873 30 313 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8871 31 302 3.40.190.10
af_Q2G1D9_30_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8798 31 321 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8794 31 99 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W1C0F8-F1-model_v4 Extracellular solute-binding protein 0.9889 86 342
AF-A0A7W1C0F8-F1-model_v4 Extracellular solute-binding protein 0.9776 86 342
AF-A0A3D4IFA6-F1-model_v4 Iron ABC transporter substrate-binding protein 0.973 30 340
AF-A0A7V5RJ97-F1-model_v4 Extracellular solute-binding protein 0.9668 21 342
AF-A0A7V9HVV2-F1-model_v4 Extracellular solute-binding protein 0.9638 19 342

Feature Viewer

pLDDT pTM Quality
90.83 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map