F425274

General Info

Members Datasets Scaffolds Average Seq Length
370 206 740 177

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100191195|Ga0068869_1001911951
Length 199
Sequence MYLRTCATGPLSGSLTGSEVIRVAGALVLNATYEPLCVVTLRRAVVLVLAEKAFVVEAGNDVMHSARVAIPVPTVVRLAHYVRVPYRREVPLTRRAVLDRDGYACVYCGTRADTIDHVRPRSRGGQHVWTNVVAACARCNHRKGDQLLGELGWHLRVAPTQPPATVAVVMGWAKRDPAWERYLGLTPGADDAGEYAAPA

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 2.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 7.3
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100191195 3300005334 Bacteria 1609
2 Ga0070658_10002407 3300005327 Bacteria 15654
3 Ga0070683_100357723 3300005329 Bacteria 1390
4 Ga0070666_10002575 3300005335 Bacteria 10953
5 Ga0070666_10062456 3300005335 Bacteria 2524
6 Ga0070680_100017771 3300005336 Bacteria 5610
7 Ga0070682_100034213 3300005337 Bacteria 3093
8 Ga0068868_100020004 3300005338 Bacteria 5022
9 Ga0070660_100039557 3300005339 Bacteria 3585
10 Ga0070660_100293356 3300005339 Bacteria 1332
11 Ga0070691_10162330 3300005341 Bacteria 1153
12 Ga0070687_100099094 3300005343 Bacteria 1628
13 Ga0070661_100669250 3300005344 Unclassified 844
14 Ga0070692_10025547 3300005345 Bacteria 2911
15 Ga0070668_100006792 3300005347 Bacteria 8486
16 Ga0070668_100117563 3300005347 Unclassified 2121
17 Ga0070675_100092608 3300005354 Bacteria 2534
18 Ga0070675_100353626 3300005354 Bacteria 1303
19 Ga0070671_100008610 3300005355 Bacteria 8179
20 Ga0070667_100030869 3300005367 Bacteria 4469
21 Ga0070709_10109919 3300005434 Bacteria 1851
22 Ga0070714_100000008 3300005435 Bacteria 278734
23 Ga0070714_100071324 3300005435 Bacteria 3003
24 Ga0070713_100041812 3300005436 Bacteria 3737
25 Ga0070710_10008278 3300005437 Bacteria 5062
26 Ga0070711_100006315 3300005439 Bacteria 7134
27 Ga0070700_100268276 3300005441 Bacteria 1232
28 Ga0070694_100041983 3300005444 Bacteria 3053
29 Ga0070678_100136994 3300005456 Bacteria 1953
30 Ga0070681_10031237 3300005458 Bacteria 5345
31 Ga0070681_10337777 3300005458 Bacteria 1416
32 Ga0070685_10085989 3300005466 Unclassified 1895
33 Ga0070679_100073692 3300005530 Bacteria 3405
34 Ga0070679_100164270 3300005530 Bacteria 2194
35 Ga0070679_101096015 3300005530 Bacteria 741
36 Ga0070684_100591541 3300005535 Bacteria 1031
37 Ga0070686_100170266 3300005544 Bacteria 1540
38 Ga0070695_100048667 3300005545 Bacteria 2711
39 Ga0070696_100020524 3300005546 Bacteria 4476
40 Ga0070665_100002494 3300005548 Bacteria 20259
41 Ga0070665_100225873 3300005548 Bacteria 1872
42 Ga0070704_100010870 3300005549 Bacteria 5552
43 Ga0068855_100006398 3300005563 Bacteria 14344
44 Ga0068855_100030789 3300005563 Bacteria 6415
45 Ga0068855_100044787 3300005563 Bacteria 5236
46 Ga0068855_100058283 3300005563 Bacteria 4523
47 Ga0068856_100006692 3300005614 Bacteria 11298
48 Ga0068856_100024045 3300005614 Bacteria 5929
49 Ga0068856_100132088 3300005614 Bacteria 2502
50 Ga0068856_101514636 3300005614 Bacteria 684
51 Ga0070702_100001526 3300005615 Bacteria 9531
52 Ga0068852_100044546 3300005616 Bacteria 3769
53 Ga0068852_100073210 3300005616 Bacteria 3013
54 Ga0068859_100043350 3300005617 Bacteria 4521
55 Ga0068864_100176026 3300005618 Bacteria 1953
56 Ga0068861_100053463 3300005719 Bacteria 3073
57 Ga0068851_10010213 3300005834 Bacteria 4377
58 Ga0068863_100002894 3300005841 Bacteria 17005
59 Ga0068858_100076413 3300005842 Unclassified 3110
60 Ga0068860_100000017 3300005843 Bacteria 307083
61 Ga0068862_100042093 3300005844 Bacteria 3890
62 Ga0081455_10013827 3300005937 Bacteria 7942
63 Ga0081455_10172420 3300005937 Bacteria 1646
64 Ga0081540_1002807 3300005983 Bacteria 14102
65 Ga0081540_1034313 3300005983 Bacteria 2739
66 Ga0070716_100011755 3300006173 Bacteria 4415
67 Ga0070712_100061725 3300006175 Bacteria 2648
68 Ga0075434_100040130 3300006871 Bacteria 4637
69 Ga0068865_100080966 3300006881 Bacteria 2331
70 Ga0075436_100033775 3300006914 Bacteria 3526
71 Ga0097620_100005186 3300006931 Bacteria 13234
72 Ga0097620_100043351 3300006931 Bacteria 4521
73 Ga0075435_100015218 3300007076 Bacteria 5778
74 Ga0105240_10016517 3300009093 Bacteria 9992
75 Ga0105240_10024489 3300009093 Bacteria 7953
76 Ga0105240_10143377 3300009093 Bacteria 2854
77 Ga0105240_10262538 3300009093 Unclassified 1991
78 Ga0111539_10144473 3300009094 Bacteria 2785
79 Ga0105245_10063619 3300009098 Bacteria 3332
80 Ga0105245_10644585 3300009098 Bacteria 1089
81 Ga0105245_10644586 3300009098 Unclassified 1089
82 Ga0105247_10014576 3300009101 Bacteria 4715
83 Ga0105247_10523976 3300009101 Unclassified 867
84 Ga0105243_10028972 3300009148 Bacteria 4255
85 Ga0105241_10029533 3300009174 Bacteria 4092
86 Ga0105241_10052759 3300009174 Bacteria 3106
87 Ga0105241_10090544 3300009174 Bacteria 2412
88 Ga0105242_10037228 3300009176 Bacteria 3907
89 Ga0105248_10334110 3300009177 Bacteria 1706
90 Ga0105237_10063122 3300009545 Bacteria 3702
91 Ga0105237_10132783 3300009545 Bacteria 2484
92 Ga0105237_10888031 3300009545 Bacteria 898
93 Ga0105238_10048416 3300009551 Bacteria 4284
94 Ga0105238_10233751 3300009551 Bacteria 1815
95 Ga0105238_10469014 3300009551 Bacteria 1257
96 Ga0105238_10545015 3300009551 Bacteria 1164
97 Ga0105238_11939043 3300009551 Bacteria 622
98 Ga0105249_10042865 3300009553 Bacteria 4116
99 Ga0105239_10009392 3300010375 Bacteria 11028
100 Ga0105239_10109615 3300010375 Bacteria 3060
101 Ga0105239_10303421 3300010375 Bacteria 1798
102 Ga0105239_10525527 3300010375 Bacteria 1346
103 Ga0105239_10772168 3300010375 Unclassified 1100
104 Ga0105246_10016388 3300011119 Bacteria 4693
105 Ga0157371_10053130 3300013102 Bacteria 2877
106 Ga0157370_10092579 3300013104 Bacteria 2837
107 Ga0157369_10023575 3300013105 Bacteria 6854
108 Ga0157369_10602585 3300013105 Bacteria 1134
109 Ga0157369_11306445 3300013105 Bacteria 739
110 Ga0157374_10018119 3300013296 Bacteria 6210
111 Ga0157378_10073408 3300013297 Bacteria 3076
112 Ga0157378_10264899 3300013297 Unclassified 1650
113 Ga0163162_10024943 3300013306 Bacteria 5906
114 Ga0157372_10085334 3300013307 Bacteria 3580
115 Ga0157372_10345903 3300013307 Bacteria 1732
116 Ga0157372_11106453 3300013307 Bacteria 916
117 Ga0163163_10121793 3300014325 Bacteria 2643
118 Ga0157380_10015033 3300014326 Bacteria 5679
119 Ga0182008_10097301 3300014497 Bacteria 1453
120 Ga0157379_10078663 3300014968 Bacteria 2954
121 Ga0157376_10035988 3300014969 Bacteria 4008
122 Ga0157376_11998200 3300014969 Unclassified 617
123 Ga0163161_10018545 3300017792 Bacteria 4875
124 Ga0197907_10957725 3300020069 Bacteria 2006
125 Ga0206356_10413458 3300020070 Bacteria 3338
126 Ga0206349_1749992 3300020075 Bacteria 1186
127 Ga0206354_11457338 3300020081 Bacteria 5969
128 Ga0206353_10632180 3300020082 Bacteria 653
129 Ga0206353_10669774 3300020082 Bacteria 4533
130 Ga0206353_11301150 3300020082 Bacteria 21754
131 Ga0206353_11310703 3300020082 Bacteria 898
132 Ga0213876_10029666 3300021384 Bacteria 2883
133 Ga0207656_10080042 3300025321 Bacteria 1467
134 Ga0207653_10019677 3300025885 Bacteria 2130
135 Ga0207692_10048485 3300025898 Bacteria 2138
136 Ga0207710_10400744 3300025900 Unclassified 704
137 Ga0207688_10007437 3300025901 Bacteria 5957
138 Ga0207680_10007484 3300025903 Bacteria 5328
139 Ga0207680_10055616 3300025903 Bacteria 2386
140 Ga0207647_10019994 3300025904 Bacteria 4495
141 Ga0207647_10111423 3300025904 Bacteria 1618
142 Ga0207705_10036447 3300025909 Bacteria 3519
143 Ga0207705_10326988 3300025909 Bacteria 1179
144 Ga0207654_10072681 3300025911 Bacteria 2048
145 Ga0207654_10283714 3300025911 Bacteria 1121
146 Ga0207707_10012880 3300025912 Bacteria 7279
147 Ga0207707_10435024 3300025912 Bacteria 1123
148 Ga0207695_10058728 3300025913 Bacteria 3992
149 Ga0207695_10124141 3300025913 Bacteria 2546
150 Ga0207671_10016269 3300025914 Bacteria 5786
151 Ga0207693_10002350 3300025915 Bacteria 16433
152 Ga0207663_10748081 3300025916 Unclassified 776
153 Ga0207660_10000519 3300025917 Bacteria 25693
154 Ga0207662_10072089 3300025918 Bacteria 2093
155 Ga0207652_10003737 3300025921 Bacteria 12491
156 Ga0207652_10097210 3300025921 Bacteria 2595
157 Ga0207646_10148420 3300025922 Bacteria 2114
158 Ga0207681_10775716 3300025923 Unclassified 800
159 Ga0207694_10654618 3300025924 Bacteria 885
160 Ga0207659_10059040 3300025926 Bacteria 2756
161 Ga0207687_10034838 3300025927 Bacteria 3422
162 Ga0207700_10049861 3300025928 Bacteria 3116
163 Ga0207664_10000002 3300025929 Bacteria 657053
164 Ga0207664_10452839 3300025929 Bacteria 1146
165 Ga0207644_10054762 3300025931 Bacteria 2874
166 Ga0207690_10219323 3300025932 Bacteria 1454
167 Ga0207706_10069161 3300025933 Bacteria 3105
168 Ga0207686_10012737 3300025934 Bacteria 4631
169 Ga0207709_10176717 3300025935 Bacteria 1504
170 Ga0207670_10363643 3300025936 Unclassified 1149
171 Ga0207669_10365227 3300025937 Bacteria 1120
172 Ga0207665_10003116 3300025939 Bacteria 11120
173 Ga0207711_10565625 3300025941 Bacteria 1060
174 Ga0207689_10088929 3300025942 Bacteria 2537
175 Ga0207661_10042098 3300025944 Bacteria 3600
176 Ga0207667_10057319 3300025949 Bacteria 4089
177 Ga0207667_10067077 3300025949 Bacteria 3738
178 Ga0207712_10037003 3300025961 Bacteria 3327
179 Ga0207712_11141210 3300025961 Bacteria 694
180 Ga0207640_10098696 3300025981 Bacteria 2042
181 Ga0207658_10044559 3300025986 Bacteria 3230
182 Ga0207703_10170580 3300026035 Unclassified 1913
183 Ga0207703_10496996 3300026035 Bacteria 1144
184 Ga0207639_10086300 3300026041 Bacteria 2498
185 Ga0207678_10012775 3300026067 Bacteria 7373
186 Ga0207708_10125576 3300026075 Bacteria 2002
187 Ga0207702_10011342 3300026078 Bacteria 7430
188 Ga0207702_10292668 3300026078 Bacteria 1543
189 Ga0207641_10003448 3300026088 Bacteria 14004
190 Ga0207641_10086324 3300026088 Bacteria 2736
191 Ga0207648_10186128 3300026089 Bacteria 1839
192 Ga0207674_10147666 3300026116 Bacteria 2309
193 Ga0207674_10361184 3300026116 Bacteria 1404
194 Ga0207675_100002341 3300026118 Bacteria 18785
195 Ga0207698_10022380 3300026142 Bacteria 4391
196 Ga0207698_10257214 3300026142 Bacteria 1602
197 Ga0207698_10318931 3300026142 Bacteria 1454
198 Ga0268266_10286261 3300028379 Bacteria 1533
199 Ga0268265_10449076 3300028380 Bacteria 1204
200 Ga0268265_10912707 3300028380 Unclassified 863
201 Ga0268264_10000033 3300028381 Bacteria 404123
202 Ga0268264_10052294 3300028381 Bacteria 3406
203 Ga0373928_0012080 3300035084 Bacteria 1718
204 Ga0373929_0003245 3300035085 Bacteria 2944
205 Ga0373940_0045308 3300035088 Bacteria 1220
206 Ga0373932_0003115 3300035112 Bacteria 4037
207 Ga0373960_0004222 3300035121 Bacteria 3284
208 Ga0373961_0005108 3300035241 Bacteria 3157
209 Ga0373962_0005773 3300035242 Bacteria 2987
210 Ga0373927_0173910 3300035695 Unclassified 1412
211 Ga0395905_0886393 3300037471 Bacteria 795
212 Ga0395901_0062079 3300038443 Bacteria 3889
213 Ga0436365_0703326 3300039437 Bacteria 3041
214 Ga0436365_1255517 3300039437 Unclassified 1480
215 Ga0466969_0024994 3300044656 Bacteria 3072
216 Ga0466969_0145114 3300044656 Bacteria 1095
217 Ga0466972_0003515 3300044658 Bacteria 7779
218 Ga0466972_0028837 3300044658 Bacteria 2735
219 Ga0466972_0268924 3300044658 Bacteria 797
220 Ga0466965_0004779 3300044683 Bacteria 6040
221 Ga0466966_0005150 3300044684 Bacteria 8591
222 Ga0466966_0048052 3300044684 Bacteria 2719
223 Ga0466966_0053544 3300044684 Bacteria 2560
224 Ga0466966_0084138 3300044684 Bacteria 1979
225 Ga0466966_0203885 3300044684 Bacteria 1196
226 Ga0466966_0296082 3300044684 Unclassified 973
227 Ga0466966_0628701 3300044684 Bacteria 646
228 Ga0466961_0007779 3300044693 Bacteria 6821
229 Ga0466961_0022890 3300044693 Bacteria 4019
230 Ga0466961_0042285 3300044693 Bacteria 2921
231 Ga0466961_0043405 3300044693 Bacteria 2880
232 Ga0466961_0047513 3300044693 Bacteria 2744
233 Ga0466961_0073012 3300044693 Bacteria 2176
234 Ga0466961_0084904 3300044693 Bacteria 2002
235 Ga0466961_0147700 3300044693 Archaea 1469
236 Ga0466961_0208680 3300044693 Bacteria 1206
237 Ga0466961_0273679 3300044693 Unclassified 1034
238 Ga0466963_0001894 3300044694 Bacteria 11425
239 Ga0466963_0009224 3300044694 Bacteria 5939
240 Ga0466963_0011342 3300044694 Bacteria 5424
241 Ga0466963_0057373 3300044694 Bacteria 2593
242 Ga0466963_0104058 3300044694 Bacteria 1945
243 Ga0466963_0106272 3300044694 Bacteria 1925
244 Ga0466963_0194946 3300044694 Archaea 1416
245 Ga0466963_0234894 3300044694 Unclassified 1285
246 Ga0466963_0314663 3300044694 Bacteria 1101
247 Ga0466963_0351088 3300044694 Bacteria 1039
248 Ga0466963_0651378 3300044694 Unclassified 743
249 Ga0466963_0834603 3300044694 Bacteria 650
250 Ga0466964_0016633 3300044706 Bacteria 2810
251 Ga0466964_0131994 3300044706 Bacteria 1139
252 Ga0466971_0007094 3300044719 Bacteria 4877
253 Ga0466971_0027301 3300044719 Bacteria 2557
254 Ga0466971_0052575 3300044719 Bacteria 1835
255 Ga0466971_0080399 3300044719 Bacteria 1486
256 Ga0466971_0149988 3300044719 Bacteria 1088
257 Ga0466971_0156016 3300044719 Bacteria 1067
258 Ga0466971_0379002 3300044719 Bacteria 687
259 Ga0466970_0072942 3300044765 Bacteria 1847
260 Ga0466970_0325797 3300044765 Bacteria 869
261 Ga0466970_0426016 3300044765 Bacteria 759
262 Ga0466957_0001512 3300044842 Bacteria 12213
263 Ga0466957_0014535 3300044842 Bacteria 4585
264 Ga0466957_0022526 3300044842 Bacteria 3718
265 Ga0466957_0039207 3300044842 Bacteria 2858
266 Ga0466957_0246537 3300044842 Bacteria 1186
267 Ga0466957_0465906 3300044842 Bacteria 872
268 Ga0466957_1063139 3300044842 Archaea 583
269 Ga0466960_0025369 3300044901 Bacteria 2682
270 Ga0466960_0259126 3300044901 Bacteria 968
271 Ga0466959_0008094 3300045049 Bacteria 7414
272 Ga0466959_0189831 3300045049 Bacteria 1434
273 Ga0466959_0224614 3300045049 Bacteria 1301
274 Ga0466959_0225283 3300045049 Bacteria 1299
275 Ga0466959_0241719 3300045049 Bacteria 1247
276 Ga0466959_0287537 3300045049 Bacteria 1127
277 Ga0466959_0336071 3300045049 Bacteria 1031
278 Ga0466958_0001971 3300045836 Bacteria 10093
279 Ga0466958_0021469 3300045836 Bacteria 3774
280 Ga0466958_0042519 3300045836 Bacteria 2736
281 Ga0466958_0075849 3300045836 Bacteria 2063
282 Ga0466958_0323914 3300045836 Bacteria 990
283 Ga0466958_0356310 3300045836 Bacteria 942
284 Ga0466958_0446891 3300045836 Bacteria 837
285 Ga0466967_0002125 3300045976 Bacteria 12152
286 Ga0466967_0004121 3300045976 Bacteria 9711
287 Ga0466967_0006273 3300045976 Bacteria 8387
288 Ga0466967_0030714 3300045976 Bacteria 4511
289 Ga0466967_0037774 3300045976 Bacteria 4136
290 Ga0466967_0062968 3300045976 Bacteria 3294
291 Ga0466967_0147652 3300045976 Bacteria 2194
292 Ga0466967_0188987 3300045976 Bacteria 1946
293 Ga0466967_0193055 3300045976 Bacteria 1925
294 Ga0466967_0279605 3300045976 Bacteria 1601
295 Ga0466967_0299111 3300045976 Bacteria 1548
296 Ga0466967_0313892 3300045976 Bacteria 1510
297 Ga0466967_0315819 3300045976 Bacteria 1506
298 Ga0466967_0352731 3300045976 Bacteria 1424
299 Ga0466967_0386442 3300045976 Bacteria 1360
300 Ga0466967_0729854 3300045976 Bacteria 982
301 Ga0466967_1300517 3300045976 Bacteria 724
302 Ga0495641_0221822 3300046461 Bacteria 848
303 Ga0495653_0524698 3300046463 Bacteria 736
304 Ga0495667_0289030 3300046559 Unclassified 1040
305 Ga0495623_0442928 3300046679 Bacteria 693
306 Ga0495624_0077077 3300046690 Bacteria 2068
307 Ga0495670_0331370 3300046691 Bacteria 818
308 Ga0495674_0680753 3300047319 Unclassified 809
309 Ga0495672_0130939 3300047320 Bacteria 1320
310 Ga0495676_0154696 3300047321 Bacteria 1628
311 Ga0496101_0023559 3300048904 Bacteria 4255
312 Ga0496101_0905460 3300048904 Unclassified 694
313 Ga0496102_0000142 3300048905 Bacteria 97037
314 Ga0496102_0001260 3300048905 Bacteria 22839
315 Ga0496102_0406067 3300048905 Bacteria 1280
316 Ga0496103_0000085 3300048906 Bacteria 105412
317 Ga0496103_0105926 3300048906 Bacteria 1783
318 Ga0496103_0178359 3300048906 Unclassified 1365
319 Ga0496103_0340200 3300048906 Unclassified 965
320 Ga0496103_0639499 3300048906 Bacteria 676
321 Ga0496104_0137695 3300048907 Bacteria 2345
322 Ga0496104_0211631 3300048907 Bacteria 1850
323 Ga0496105_0006452 3300048908 Bacteria 9018
324 Ga0496105_0388673 3300048908 Bacteria 1109
325 Ga0496106_0010106 3300048909 Bacteria 6970
326 Ga0496107_0980288 3300048910 Bacteria 614
327 Ga0496108_0021533 3300048911 Bacteria 5297
328 Ga0496110_0047855 3300048913 Bacteria 3746
329 Ga0496110_0731162 3300048913 Bacteria 892
330 Ga0496110_0868711 3300048913 Bacteria 807
331 Ga0496112_0082589 3300048915 Bacteria 3177
332 Ga0496112_0151058 3300048915 Bacteria 2290
333 Ga0496113_0013970 3300048916 Bacteria 5462
334 Ga0496114_0022693 3300048917 Bacteria 5115
335 Ga0496114_0481239 3300048917 Bacteria 1098
336 Ga0496115_0098469 3300048918 Bacteria 2395
337 Ga0496115_0260685 3300048918 Unclassified 1425
338 Ga0496117_0099919 3300048920 Bacteria 1839
339 Ga0496118_0042838 3300048921 Bacteria 3566
340 Ga0496119_0000153 3300048922 Bacteria 95945
341 Ga0496120_0004213 3300048923 Bacteria 12277
342 Ga0496120_0054751 3300048923 Bacteria 2259
343 Ga0501031_0024192 3300049568 Bacteria 3959
344 Ga0501032_0005488 3300049569 Bacteria 9411
345 Ga0501036_0497405 3300049572 Bacteria 1014
346 Ga0501036_0928568 3300049572 Bacteria 714
347 Ga0501037_0040754 3300049573 Bacteria 3417
348 Ga0501038_0011955 3300049574 Bacteria 7926
349 Ga0501043_0023806 3300049579 Bacteria 4804
350 Ga0501046_0935457 3300049580 Bacteria 603
351 Ga0501047_0005811 3300049581 Bacteria 11612
352 Ga0501047_0230198 3300049581 Bacteria 1707
353 Ga0501048_0000234 3300049582 Bacteria 36730
354 Ga0501069_0086569 3300049585 Bacteria 1769
355 Ga0501070_0116821 3300049586 Bacteria 2203
356 Ga0501070_0395679 3300049586 Bacteria 1118
357 Ga0501073_0403183 3300049589 Bacteria 945
358 Ga0501081_0131736 3300049743 Bacteria 1787
359 Ga0501035_0029957 3300049822 Bacteria 4964
360 Ga0501035_0519705 3300049822 Bacteria 978
361 nmdc:mga0n895_41375_c1 3300050512 Bacteria 4480
362 Ga0500568_0048734 3300053139 Bacteria 1674
363 Ga0466962_0005733 3300061719 Bacteria 5966
364 Ga0466962_0019975 3300061719 Bacteria 3220
365 Ga0466962_0027870 3300061719 Bacteria 2708
366 Ga0466962_0043611 3300061719 Bacteria 2146
367 Ga0466962_0131921 3300061719 Bacteria 1208
368 Ga0466962_0252016 3300061719 Bacteria 868
369 Ga0466962_0285604 3300061719 Bacteria 815
370 Ga0466962_0630942 3300061719 Bacteria 547
371 Ga0068869_100191195
372 Ga0070658_10002407
373 Ga0070683_100357723
374 Ga0070666_10002575
375 Ga0070666_10062456
376 Ga0070680_100017771
377 Ga0070682_100034213
378 Ga0068868_100020004
379 Ga0070660_100039557
380 Ga0070660_100293356
381 Ga0070691_10162330
382 Ga0070687_100099094
383 Ga0070661_100669250
384 Ga0070692_10025547
385 Ga0070668_100006792
386 Ga0070668_100117563
387 Ga0070675_100092608
388 Ga0070675_100353626
389 Ga0070671_100008610
390 Ga0070667_100030869
391 Ga0070709_10109919
392 Ga0070714_100000008
393 Ga0070714_100071324
394 Ga0070713_100041812
395 Ga0070710_10008278
396 Ga0070711_100006315
397 Ga0070700_100268276
398 Ga0070694_100041983
399 Ga0070678_100136994
400 Ga0070681_10031237
401 Ga0070681_10337777
402 Ga0070685_10085989
403 Ga0070679_100073692
404 Ga0070679_100164270
405 Ga0070679_101096015
406 Ga0070684_100591541
407 Ga0070686_100170266
408 Ga0070695_100048667
409 Ga0070696_100020524
410 Ga0070665_100002494
411 Ga0070665_100225873
412 Ga0070704_100010870
413 Ga0068855_100006398
414 Ga0068855_100030789
415 Ga0068855_100044787
416 Ga0068855_100058283
417 Ga0068856_100006692
418 Ga0068856_100024045
419 Ga0068856_100132088
420 Ga0068856_101514636
421 Ga0070702_100001526
422 Ga0068852_100044546
423 Ga0068852_100073210
424 Ga0068859_100043350
425 Ga0068864_100176026
426 Ga0068861_100053463
427 Ga0068851_10010213
428 Ga0068863_100002894
429 Ga0068858_100076413
430 Ga0068860_100000017
431 Ga0068862_100042093
432 Ga0081455_10013827
433 Ga0081455_10172420
434 Ga0081540_1002807
435 Ga0081540_1034313
436 Ga0070716_100011755
437 Ga0070712_100061725
438 Ga0075434_100040130
439 Ga0068865_100080966
440 Ga0075436_100033775
441 Ga0097620_100005186
442 Ga0097620_100043351
443 Ga0075435_100015218
444 Ga0105240_10016517
445 Ga0105240_10024489
446 Ga0105240_10143377
447 Ga0105240_10262538
448 Ga0111539_10144473
449 Ga0105245_10063619
450 Ga0105245_10644585
451 Ga0105245_10644586
452 Ga0105247_10014576
453 Ga0105247_10523976
454 Ga0105243_10028972
455 Ga0105241_10029533
456 Ga0105241_10052759
457 Ga0105241_10090544
458 Ga0105242_10037228
459 Ga0105248_10334110
460 Ga0105237_10063122
461 Ga0105237_10132783
462 Ga0105237_10888031
463 Ga0105238_10048416
464 Ga0105238_10233751
465 Ga0105238_10469014
466 Ga0105238_10545015
467 Ga0105238_11939043
468 Ga0105249_10042865
469 Ga0105239_10009392
470 Ga0105239_10109615
471 Ga0105239_10303421
472 Ga0105239_10525527
473 Ga0105239_10772168
474 Ga0105246_10016388
475 Ga0157371_10053130
476 Ga0157370_10092579
477 Ga0157369_10023575
478 Ga0157369_10602585
479 Ga0157369_11306445
480 Ga0157374_10018119
481 Ga0157378_10073408
482 Ga0157378_10264899
483 Ga0163162_10024943
484 Ga0157372_10085334
485 Ga0157372_10345903
486 Ga0157372_11106453
487 Ga0163163_10121793
488 Ga0157380_10015033
489 Ga0182008_10097301
490 Ga0157379_10078663
491 Ga0157376_10035988
492 Ga0157376_11998200
493 Ga0163161_10018545
494 Ga0197907_10957725
495 Ga0206356_10413458
496 Ga0206349_1749992
497 Ga0206354_11457338
498 Ga0206353_10632180
499 Ga0206353_10669774
500 Ga0206353_11301150
501 Ga0206353_11310703
502 Ga0213876_10029666
503 Ga0207656_10080042
504 Ga0207653_10019677
505 Ga0207692_10048485
506 Ga0207710_10400744
507 Ga0207688_10007437
508 Ga0207680_10007484
509 Ga0207680_10055616
510 Ga0207647_10019994
511 Ga0207647_10111423
512 Ga0207705_10036447
513 Ga0207705_10326988
514 Ga0207654_10072681
515 Ga0207654_10283714
516 Ga0207707_10012880
517 Ga0207707_10435024
518 Ga0207695_10058728
519 Ga0207695_10124141
520 Ga0207671_10016269
521 Ga0207693_10002350
522 Ga0207663_10748081
523 Ga0207660_10000519
524 Ga0207662_10072089
525 Ga0207652_10003737
526 Ga0207652_10097210
527 Ga0207646_10148420
528 Ga0207681_10775716
529 Ga0207694_10654618
530 Ga0207659_10059040
531 Ga0207687_10034838
532 Ga0207700_10049861
533 Ga0207664_10000002
534 Ga0207664_10452839
535 Ga0207644_10054762
536 Ga0207690_10219323
537 Ga0207706_10069161
538 Ga0207686_10012737
539 Ga0207709_10176717
540 Ga0207670_10363643
541 Ga0207669_10365227
542 Ga0207665_10003116
543 Ga0207711_10565625
544 Ga0207689_10088929
545 Ga0207661_10042098
546 Ga0207667_10057319
547 Ga0207667_10067077
548 Ga0207712_10037003
549 Ga0207712_11141210
550 Ga0207640_10098696
551 Ga0207658_10044559
552 Ga0207703_10170580
553 Ga0207703_10496996
554 Ga0207639_10086300
555 Ga0207678_10012775
556 Ga0207708_10125576
557 Ga0207702_10011342
558 Ga0207702_10292668
559 Ga0207641_10003448
560 Ga0207641_10086324
561 Ga0207648_10186128
562 Ga0207674_10147666
563 Ga0207674_10361184
564 Ga0207675_100002341
565 Ga0207698_10022380
566 Ga0207698_10257214
567 Ga0207698_10318931
568 Ga0268266_10286261
569 Ga0268265_10449076
570 Ga0268265_10912707
571 Ga0268264_10000033
572 Ga0268264_10052294
573 Ga0373928_0012080
574 Ga0373929_0003245
575 Ga0373940_0045308
576 Ga0373932_0003115
577 Ga0373960_0004222
578 Ga0373961_0005108
579 Ga0373962_0005773
580 Ga0373927_0173910
581 Ga0395905_0886393
582 Ga0395901_0062079
583 Ga0436365_0703326
584 Ga0436365_1255517
585 Ga0466969_0024994
586 Ga0466969_0145114
587 Ga0466972_0003515
588 Ga0466972_0028837
589 Ga0466972_0268924
590 Ga0466965_0004779
591 Ga0466966_0005150
592 Ga0466966_0048052
593 Ga0466966_0053544
594 Ga0466966_0084138
595 Ga0466966_0203885
596 Ga0466966_0296082
597 Ga0466966_0628701
598 Ga0466961_0007779
599 Ga0466961_0022890
600 Ga0466961_0042285
601 Ga0466961_0043405
602 Ga0466961_0047513
603 Ga0466961_0073012
604 Ga0466961_0084904
605 Ga0466961_0147700
606 Ga0466961_0208680
607 Ga0466961_0273679
608 Ga0466963_0001894
609 Ga0466963_0009224
610 Ga0466963_0011342
611 Ga0466963_0057373
612 Ga0466963_0104058
613 Ga0466963_0106272
614 Ga0466963_0194946
615 Ga0466963_0234894
616 Ga0466963_0314663
617 Ga0466963_0351088
618 Ga0466963_0651378
619 Ga0466963_0834603
620 Ga0466964_0016633
621 Ga0466964_0131994
622 Ga0466971_0007094
623 Ga0466971_0027301
624 Ga0466971_0052575
625 Ga0466971_0080399
626 Ga0466971_0149988
627 Ga0466971_0156016
628 Ga0466971_0379002
629 Ga0466970_0072942
630 Ga0466970_0325797
631 Ga0466970_0426016
632 Ga0466957_0001512
633 Ga0466957_0014535
634 Ga0466957_0022526
635 Ga0466957_0039207
636 Ga0466957_0246537
637 Ga0466957_0465906
638 Ga0466957_1063139
639 Ga0466960_0025369
640 Ga0466960_0259126
641 Ga0466959_0008094
642 Ga0466959_0189831
643 Ga0466959_0224614
644 Ga0466959_0225283
645 Ga0466959_0241719
646 Ga0466959_0287537
647 Ga0466959_0336071
648 Ga0466958_0001971
649 Ga0466958_0021469
650 Ga0466958_0042519
651 Ga0466958_0075849
652 Ga0466958_0323914
653 Ga0466958_0356310
654 Ga0466958_0446891
655 Ga0466967_0002125
656 Ga0466967_0004121
657 Ga0466967_0006273
658 Ga0466967_0030714
659 Ga0466967_0037774
660 Ga0466967_0062968
661 Ga0466967_0147652
662 Ga0466967_0188987
663 Ga0466967_0193055
664 Ga0466967_0279605
665 Ga0466967_0299111
666 Ga0466967_0313892
667 Ga0466967_0315819
668 Ga0466967_0352731
669 Ga0466967_0386442
670 Ga0466967_0729854
671 Ga0466967_1300517
672 Ga0495641_0221822
673 Ga0495653_0524698
674 Ga0495667_0289030
675 Ga0495623_0442928
676 Ga0495624_0077077
677 Ga0495670_0331370
678 Ga0495674_0680753
679 Ga0495672_0130939
680 Ga0495676_0154696
681 Ga0496101_0023559
682 Ga0496101_0905460
683 Ga0496102_0000142
684 Ga0496102_0001260
685 Ga0496102_0406067
686 Ga0496103_0000085
687 Ga0496103_0105926
688 Ga0496103_0178359
689 Ga0496103_0340200
690 Ga0496103_0639499
691 Ga0496104_0137695
692 Ga0496104_0211631
693 Ga0496105_0006452
694 Ga0496105_0388673
695 Ga0496106_0010106
696 Ga0496107_0980288
697 Ga0496108_0021533
698 Ga0496110_0047855
699 Ga0496110_0731162
700 Ga0496110_0868711
701 Ga0496112_0082589
702 Ga0496112_0151058
703 Ga0496113_0013970
704 Ga0496114_0022693
705 Ga0496114_0481239
706 Ga0496115_0098469
707 Ga0496115_0260685
708 Ga0496117_0099919
709 Ga0496118_0042838
710 Ga0496119_0000153
711 Ga0496120_0004213
712 Ga0496120_0054751
713 Ga0501031_0024192
714 Ga0501032_0005488
715 Ga0501036_0497405
716 Ga0501036_0928568
717 Ga0501037_0040754
718 Ga0501038_0011955
719 Ga0501043_0023806
720 Ga0501046_0935457
721 Ga0501047_0005811
722 Ga0501047_0230198
723 Ga0501048_0000234
724 Ga0501069_0086569
725 Ga0501070_0116821
726 Ga0501070_0395679
727 Ga0501073_0403183
728 Ga0501081_0131736
729 Ga0501035_0029957
730 Ga0501035_0519705
731 nmdc:mga0n895_41375_c1
732 Ga0500568_0048734
733 Ga0466962_0005733
734 Ga0466962_0019975
735 Ga0466962_0027870
736 Ga0466962_0043611
737 Ga0466962_0131921
738 Ga0466962_0252016
739 Ga0466962_0285604
740 Ga0466962_0630942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

105

146

0.95

PF14279

HNH_5

HNH endonuclease

105

156

0.92

Map