F425252

General Info

Members Datasets Scaffolds Average Seq Length
370 283 306 538

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10004938|JGI25151J46595_100049382
Length 614
Sequence MEDTSQTRGVRHRALAARIPGPPRFTTPAATPTLDFRGGPPPGDWTGTGHAGRQMETTFDYLVVGAGSAGCALAGRLADSGNDAIALLETGAHDHHVLVRTPAGCAAMLPRAGARNYGYLTAPQSELDGRRGYQPRGRGLGGSSSINAMIYMRGRPADYDGWAAAGCDGWSWDDVLPYFRRAECNERVAGHDDDPLHGGTGPLHVSDLRSPNPFGQHFIDAAQHAGIVRNDDFNGEEQEGVGWYQVTQHNGERWNAARAYLHGGNVRDRNCNGGRSHLHVMTGTQVLRILFEKRRAVGVLAWRDGREMVLRARREVIVSAGAFGSPQLLMASGVGPAAHLREHGIDVVHDLPGVGGNLQDHLDIILHKRVPASDLFGISLGGARRLVAEFLRYRRHRTGMMTSNFAEAGAFVRSRPDLSEPDLQLHFVVGMADNHMRRINLGHGYSCHVCVLRPRSRGEVRLASADMRQAPRIDPRYLTDPQDMATMLEGLRIVRRIFMQAPLAVFGGRELYSEALRLDGSDDEAACELIRRHADTIYHPVGTCRMGMDALAVVDPQLRVRGVEGLRVVDASIMPTLVGGNTNAPAIMIGERAHDLIRYAPHVTLRIREAAVAD

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
4 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
5 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
6 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
7 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
8 2519103095 Burkholderia sp. KJ006 Isolate Nodule
9 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
10 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
11 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
12 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
13 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
14 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
15 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
16 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
17 2643221561 Nocardioides sp. Root151 Isolate Unclassified
18 2643221696 Nocardioides sp. Root140 Isolate Unclassified
19 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
20 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
21 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
22 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
23 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
24 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
25 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
26 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
27 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
28 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
29 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
30 2818991452 Burkholderia cepacia 561 Isolate Unclassified
31 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
32 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
33 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
34 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
35 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
36 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
37 2904564687 Burkholderia sp. 571 Isolate Unclassified
38 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
39 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
40 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
41 2928163908 Burkholderia sp. 567 Isolate Unclassified
42 2928170801 Burkholderia sp. 572 Isolate Unclassified
43 2928536128 Burkholderia sola 565 Isolate Unclassified
44 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
45 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
46 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
47 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
51 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
56 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
247 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
248 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
249 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
250 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
257 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
258 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
259 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
260 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
263 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
272 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
273 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
274 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
275 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
276 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
277 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
278 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
279 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
280 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
281 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
282 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
283 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.7
Metatranscriptomes 0
Isolates 17.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 24.86
Nodule 2.43
Rhizoplane 5.41
Rhizosphere 56.22
Stem 0
Stem Tuber 0
Unclassified 10.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005048 3300001989 Bacteria 5026
2 JGI24735J21928_10013862 3300002067 Bacteria 2528
3 JGI25162J39368_1000005 3300002737 Bacteria 435925
4 JGI25162J39368_1000652 3300002737 Bacteria 24538
5 JGI25164J39214_1000447 3300002772 Bacteria 21548
6 JGI25151J46595_10004938 3300003187 Bacteria 6962
7 JGI25151J46595_10009105 3300003187 Bacteria 4729
8 JGI25165J46597_1000623 3300003214 Bacteria 29740
9 JGI25160J50197_1000037 3300003354 Bacteria 162757
10 Ga0055532_1000986 3300003758 Bacteria 8952
11 Ga0055532_1001094 3300003758 Bacteria 8367
12 Ga0055532_1001206 3300003758 Bacteria 7672
13 Ga0055527_1000501 3300003760 Bacteria 13936
14 Ga0055527_1003025 3300003760 Bacteria 2616
15 Ga0055535_1001312 3300003761 Bacteria 13288
16 Ga0055535_1001339 3300003761 Bacteria 13009
17 Ga0055542_1001301 3300003762 Bacteria 13288
18 Ga0055529_1000854 3300003763 Bacteria 17673
19 Ga0055524_1000451 3300003775 Bacteria 34032
20 Ga0055524_1006625 3300003775 Bacteria 5008
21 Ga0055524_1011746 3300003775 Bacteria 3402
22 Ga0055524_1024975 3300003775 Bacteria 1881
23 Ga0055536_1000031 3300003781 Bacteria 151112
24 Ga0055534_1005738 3300003784 Bacteria 3259
25 Ga0055530_10013195 3300003791 Bacteria 2830
26 Ga0055531_10011116 3300003794 Bacteria 4386
27 Ga0058692_1001820 3300003856 Bacteria 7515
28 Ga0065165_1002480 3300005262 Bacteria 15515
29 Ga0065715_10001389 3300005293 Bacteria 9531
30 Ga0070658_10038324 3300005327 Bacteria 3865
31 Ga0068869_100131642 3300005334 Bacteria 1923
32 Ga0070660_100000015 3300005339 Bacteria 105703
33 Ga0070673_100112918 3300005364 Bacteria 2256
34 Ga0070659_100000109 3300005366 Bacteria 60487
35 Ga0070714_100005297 3300005435 Bacteria 9832
36 Ga0070711_100030376 3300005439 Bacteria 3576
37 Ga0070663_100000813 3300005455 Bacteria 16927
38 Ga0070663_100071020 3300005455 Bacteria 2533
39 Ga0068855_100117538 3300005563 Bacteria 3046
40 Ga0068856_100137366 3300005614 Bacteria 2450
41 Ga0068852_100024420 3300005616 Bacteria 4884
42 Ga0068862_100014597 3300005844 Bacteria 6522
43 Ga0081455_10002112 3300005937 Bacteria 23670
44 Ga0081455_10005275 3300005937 Bacteria 14201
45 Ga0081539_10000123 3300005985 Bacteria 181245
46 Ga0070716_100017115 3300006173 Bacteria 3753
47 Ga0105240_10007058 3300009093 Bacteria 16380
48 Ga0105240_10012389 3300009093 Bacteria 11776
49 Ga0105240_10113668 3300009093 Bacteria 3271
50 Ga0111539_10008405 3300009094 Bacteria 13136
51 Ga0105245_10005422 3300009098 Bacteria 11202
52 Ga0105243_10000101 3300009148 Bacteria 98298
53 Ga0105242_10000557 3300009176 Bacteria 29513
54 Ga0105248_10011860 3300009177 Bacteria 9616
55 Ga0105237_10029598 3300009545 Bacteria 5565
56 Ga0105249_10055837 3300009553 Bacteria 3614
57 Ga0105249_10095693 3300009553 Bacteria 2785
58 Ga0105246_10123535 3300011119 Bacteria 1922
59 Ga0157378_10031658 3300013297 Bacteria 4673
60 Ga0157375_10020274 3300013308 Bacteria 6069
61 Ga0157375_10091492 3300013308 Bacteria 3104
62 Ga0209566_101663 3300025225 Bacteria 5621
63 Ga0209674_103023 3300025226 Bacteria 3246
64 Ga0209672_100041 3300025228 Bacteria 278535
65 Ga0209672_100071 3300025228 Bacteria 169941
66 Ga0209147_100135 3300025229 Bacteria 118099
67 Ga0209147_100364 3300025229 Bacteria 32130
68 Ga0209147_100758 3300025229 Bacteria 15835
69 Ga0207427_100191 3300025231 Bacteria 60860
70 Ga0209437_100043 3300025233 Bacteria 440454
71 Ga0209437_100167 3300025233 Bacteria 144661
72 Ga0209258_100120 3300025242 Bacteria 183488
73 Ga0209258_100207 3300025242 Bacteria 119062
74 Ga0209148_1000134 3300025254 Bacteria 169941
75 Ga0209148_1001121 3300025254 Bacteria 15855
76 Ga0209233_1000046 3300025261 Bacteria 470971
77 Ga0209565_1001202 3300025263 Bacteria 12339
78 Ga0209565_1012705 3300025263 Bacteria 1999
79 Ga0209455_1000241 3300025272 Bacteria 68235
80 Ga0209455_1001072 3300025272 Bacteria 13497
81 Ga0209673_1000102 3300025273 Bacteria 189583
82 Ga0209673_1004235 3300025273 Bacteria 7809
83 Ga0209130_1003627 3300025284 Bacteria 6402
84 Ga0209675_1000372 3300025291 Bacteria 38132
85 Ga0209675_1008876 3300025291 Bacteria 3624
86 Ga0209675_1009937 3300025291 Bacteria 3303
87 Ga0209676_1000036 3300025292 Bacteria 457623
88 Ga0209676_1000853 3300025292 Bacteria 39341
89 Ga0209676_1001638 3300025292 Bacteria 19672
90 Ga0209676_1008281 3300025292 Bacteria 4663
91 Ga0209025_1003788 3300025294 Bacteria 13842
92 Ga0209025_1004258 3300025294 Bacteria 12583
93 Ga0209025_1005109 3300025294 Bacteria 10910
94 Ga0209025_1009235 3300025294 Bacteria 6913
95 Ga0209025_1023037 3300025294 Bacteria 3276
96 Ga0209564_1001212 3300025295 Bacteria 29387
97 Ga0209564_1001412 3300025295 Bacteria 24763
98 Ga0209564_1002371 3300025295 Bacteria 15143
99 Ga0209050_1000652 3300025298 Bacteria 53645
100 Ga0209050_1009718 3300025298 Bacteria 4872
101 Ga0209256_1000713 3300025299 Bacteria 44089
102 Ga0209256_1003864 3300025299 Bacteria 9953
103 Ga0209256_1004182 3300025299 Bacteria 9301
104 Ga0209256_1006707 3300025299 Bacteria 5971
105 Ga0207426_1000004 3300025302 Bacteria 1047900
106 Ga0209051_1023183 3300025303 Bacteria 2589
107 Ga0209257_1000378 3300025304 Bacteria 88945
108 Ga0209257_1002057 3300025304 Bacteria 21312
109 Ga0209257_1007841 3300025304 Bacteria 6304
110 Ga0209257_1009318 3300025304 Bacteria 5298
111 Ga0207647_10017556 3300025904 Bacteria 4863
112 Ga0207695_10001334 3300025913 Bacteria 41893
113 Ga0207695_10031401 3300025913 Bacteria 5825
114 Ga0207695_10087912 3300025913 Bacteria 3130
115 Ga0207671_10006457 3300025914 Bacteria 10440
116 Ga0207657_10000039 3300025919 Bacteria 121088
117 Ga0207687_10006048 3300025927 Bacteria 8006
118 Ga0207664_10001238 3300025929 Bacteria 16904
119 Ga0207664_10001760 3300025929 Bacteria 14275
120 Ga0207690_10000010 3300025932 Bacteria 330298
121 Ga0207686_10019156 3300025934 Bacteria 3887
122 Ga0207709_10000103 3300025935 Bacteria 131589
123 Ga0207665_10000529 3300025939 Bacteria 25748
124 Ga0207711_10060476 3300025941 Bacteria 3265
125 Ga0207712_10043778 3300025961 Bacteria 3090
126 Ga0207712_10117961 3300025961 Bacteria 2002
127 Ga0207677_10041445 3300026023 Bacteria 3045
128 Ga0207703_10015833 3300026035 Bacteria 5882
129 Ga0207703_10085566 3300026035 Bacteria 2639
130 Ga0207678_10000032 3300026067 Bacteria 109814
131 Ga0207702_10028410 3300026078 Bacteria 4650
132 Ga0207698_10138571 3300026142 Bacteria 2092
133 Ga0209371_1000345 3300027312 Bacteria 50863
134 Ga0209967_1002885 3300027364 Bacteria 2248
135 Ga0209999_1009304 3300027543 Bacteria 1775
136 Ga0209970_1001175 3300027614 Bacteria 4602
137 Ga0209983_1000211 3300027665 Bacteria 11573
138 Ga0209282_1000799 3300027666 Bacteria 16038
139 Ga0209971_1000229 3300027682 Bacteria 16278
140 Ga0209974_10004351 3300027876 Bacteria 5037
141 Ga0209974_10013716 3300027876 Bacteria 2700
142 Ga0207428_10044592 3300027907 Bacteria 3578
143 Ga0307515_10000103 3300028794 Bacteria 198308
144 Ga0307515_10023919 3300028794 Bacteria 10674
145 Ga0307515_10108344 3300028794 Bacteria 3274
146 Ga0265338_10049534 3300028800 Bacteria 3807
147 Ga0268256_1001944 3300030500 Bacteria 11301
148 Ga0307511_10000103 3300030521 Bacteria 75234
149 Ga0265327_10026060 3300031251 Bacteria 3394
150 Ga0307513_10000202 3300031456 Bacteria 85897
151 Ga0307408_100105128 3300031548 Bacteria 2158
152 Ga0307508_10032680 3300031616 Bacteria 4699
153 Ga0316579_10039332 3300031691 Bacteria 2190
154 Ga0307410_10041243 3300031852 Bacteria 3043
155 Ga0307407_10068086 3300031903 Bacteria 2107
156 Ga0307409_100016421 3300031995 Bacteria 4898
157 Ga0307409_100053632 3300031995 Bacteria 3099
158 Ga0307414_10015964 3300032004 Bacteria 4550
159 Ga0307414_10049619 3300032004 Bacteria 2903
160 Ga0307415_100030496 3300032126 Bacteria 3463
161 Ga0307510_10002795 3300033180 Bacteria 20030
162 Ga0373954_0003175 3300035118 Bacteria 6944
163 Ga0373956_0000427 3300035119 Bacteria 17143
164 Ga0373955_0020132 3300035172 Bacteria 3350
165 Ga0373927_0000316 3300035695 Bacteria 37783
166 Ga0373925_0049296 3300037068 Bacteria 3139
167 Ga0395900_0001112 3300037418 Bacteria 34108
168 Ga0395898_0065101 3300037466 Bacteria 3534
169 Ga0395901_0119649 3300038443 Bacteria 2767
170 Ga0436360_0724457 3300039438 Bacteria 10432
171 Ga0439448_0001059 3300042005 Bacteria 6900
172 Ga0439448_0046534 3300042005 Bacteria 1414
173 Ga0439452_009850 3300042010 Bacteria 2804
174 Ga0451577_0007179 3300042876 Bacteria 10981
175 Ga0451577_0009589 3300042876 Bacteria 9298
176 Ga0451577_0035401 3300042876 Bacteria 4497
177 Ga0453684_0124462 3300044712 Bacteria 3106
178 Ga0453684_0452307 3300044712 Bacteria 1429
179 Ga0466960_0013208 3300044901 Bacteria 3503
180 Ga0451576_0000609 3300045051 Bacteria 75538
181 Ga0466958_0013383 3300045836 Bacteria 4670
182 Ga0495617_001354 3300046452 Bacteria 10860
183 Ga0495592_0013948 3300046454 Bacteria 6104
184 Ga0495603_0001042 3300046455 Bacteria 16056
185 Ga0495638_0000183 3300046460 Bacteria 95741
186 Ga0495651_0109982 3300046462 Bacteria 2039
187 Ga0495653_0003201 3300046463 Bacteria 13108
188 Ga0495580_0000009 3300046472 Bacteria 101827
189 Ga0495605_0006429 3300046474 Bacteria 6757
190 Ga0495605_0047039 3300046474 Bacteria 2117
191 Ga0495585_0018715 3300046492 Plasmid 3995
192 Ga0495596_0000580 3300046500 Bacteria 22853
193 Ga0495583_0009199 3300046506 Bacteria 5931
194 Ga0495608_0003208 3300046511 Bacteria 11703
195 Ga0495610_0001842 3300046512 Bacteria 18385
196 Ga0495610_0017417 3300046512 Plasmid 4096
197 Ga0495620_0000045 3300046515 Bacteria 109595
198 Ga0495643_0001834 3300046522 Bacteria 18074
199 Ga0495648_0002568 3300046524 Bacteria 16642
200 Ga0495648_0022169 3300046524 Bacteria 4380
201 Ga0495663_0000263 3300046525 Bacteria 20187
202 Ga0495652_0003956 3300046529 Bacteria 14359
203 Ga0495640_0065498 3300046533 Bacteria 2453
204 Ga0495645_0015938 3300046543 Bacteria 5355
205 Ga0495667_0001649 3300046559 Bacteria 14790
206 Ga0495611_0000134 3300046648 Bacteria 51892
207 Ga0495625_0014759 3300046660 Bacteria 6217
208 Ga0495661_0003837 3300046665 Bacteria 10995
209 Ga0495661_0016127 3300046665 Bacteria 4963
210 Ga0495588_0000938 3300046674 Bacteria 12716
211 Ga0495599_0036340 3300046678 Bacteria 3093
212 Ga0495613_0000439 3300046689 Bacteria 35567
213 Ga0495670_0000026 3300046691 Bacteria 90929
214 Ga0495671_0000079 3300046692 Bacteria 93288
215 Ga0495671_0002836 3300046692 Bacteria 10851
216 Ga0495649_0000480 3300046694 Bacteria 34342
217 Ga0495604_0003524 3300047317 Bacteria 12471
218 Ga0495604_0006221 3300047317 Bacteria 9474
219 Ga0495604_0104822 3300047317 Bacteria 2071
220 Ga0495674_0007999 3300047319 Bacteria 10093
221 Ga0495674_0016453 3300047319 Bacteria 6899
222 Ga0495672_0006070 3300047320 Bacteria 9438
223 Ga0495687_000093 3300047443 Bacteria 138076
224 Ga0495687_010061 3300047443 Bacteria 5219
225 Ga0495687_037995 3300047443 Bacteria 2140
226 Ga0495675_0036165 3300047444 Bacteria 3151
227 Ga0495681_0000758 3300047470 Bacteria 24874
228 Ga0495684_0011106 3300047471 Bacteria 6962
229 Ga0495686_0000770 3300047472 Bacteria 42285
230 Ga0495602_0004257 3300048088 Bacteria 14895
231 Ga0495615_0000053 3300048090 Bacteria 36349
232 Ga0496100_0000070 3300048903 Bacteria 56600
233 Ga0496100_0014864 3300048903 Bacteria 4531
234 Ga0496100_0026183 3300048903 Bacteria 3574
235 Ga0496101_0000044 3300048904 Bacteria 161295
236 Ga0496101_0002643 3300048904 Bacteria 11006
237 Ga0496102_0001008 3300048905 Bacteria 26419
238 Ga0496104_0006975 3300048907 Bacteria 9963
239 Ga0496104_0252449 3300048907 Bacteria 1676
240 Ga0496105_0000055 3300048908 Bacteria 88389
241 Ga0496108_0018474 3300048911 Bacteria 5708
242 Ga0496110_0010259 3300048913 Bacteria 7611
243 Ga0496110_0051681 3300048913 Bacteria 3612
244 Ga0496110_0056681 3300048913 Bacteria 3448
245 Ga0496111_0000092 3300048914 Bacteria 38172
246 Ga0496111_0032453 3300048914 Bacteria 3723
247 Ga0496114_0000274 3300048917 Bacteria 37581
248 Ga0496117_0000098 3300048920 Bacteria 196331
249 Ga0496118_0008754 3300048921 Bacteria 10381
250 Ga0496118_0010280 3300048921 Bacteria 9283
251 Ga0496121_0002190 3300048924 Bacteria 30584
252 Ga0496121_0003312 3300048924 Bacteria 23134
253 Ga0496121_0004010 3300048924 Bacteria 20282
254 Ga0496121_0009087 3300048924 Bacteria 11504
255 Ga0496122_0009871 3300048925 Bacteria 9951
256 Ga0496123_0006270 3300048926 Bacteria 11582
257 Ga0495678_000171 3300049459 Bacteria 75725
258 Ga0495682_0000817 3300049460 Bacteria 19575
259 Ga0501292_000021 3300049515 Bacteria 51994
260 Ga0501034_0003833 3300049571 Bacteria 16946
261 Ga0501034_0014371 3300049571 Bacteria 8156
262 Ga0501043_0088857 3300049579 Bacteria 2428
263 Ga0501046_0006256 3300049580 Bacteria 10561
264 Ga0501047_0004517 3300049581 Bacteria 13084
265 Ga0501070_0003318 3300049586 Bacteria 13980
266 Ga0501071_0010199 3300049587 Bacteria 6286
267 Ga0501073_0062604 3300049589 Bacteria 2595
268 Ga0501075_0066951 3300049591 Bacteria 2711
269 Ga0501076_0069873 3300049592 Bacteria 2807
270 Ga0501235_001920 3300049669 Bacteria 4446
271 Ga0501249_000361 3300049679 Bacteria 12053
272 Ga0501257_000018 3300049686 Bacteria 48053
273 Ga0501257_002399 3300049686 Bacteria 3948
274 Ga0501225_0000099 3300049705 Bacteria 28025
275 Ga0501245_000079 3300049708 Bacteria 9538
276 Ga0501079_0121009 3300049741 Bacteria 2036
277 Ga0501080_0001046 3300049742 Bacteria 22756
278 Ga0501080_0127992 3300049742 Bacteria 2351
279 Ga0501266_001254 3300049763 Bacteria 3237
280 Ga0501279_000014 3300049775 Bacteria 70029
281 Ga0501280_000404 3300049776 Bacteria 10374
282 Ga0501281_00017 3300049777 Bacteria 23209
283 Ga0501283_001804 3300049779 Unclassified 2776
284 Ga0501044_0030899 3300049823 Bacteria 5641
285 nmdc:mga08y16_27098_c1 3300050511 Bacteria 6040
286 nmdc:mga08x19_17357_c1 3300050514 Bacteria 4403
287 Ga0495601_0110444 3300053077 Bacteria 1780
288 Ga0495619_0060879 3300053085 Bacteria 2510
289 Ga0500578_0001583 3300053086 Bacteria 22110
290 Ga0500583_0011495 3300053092 Bacteria 3339
291 Ga0500555_002580 3300053103 Bacteria 5219
292 Ga0500592_000084 3300053116 Bacteria 21490
293 Ga0500597_010544 3300053120 Plasmid 3306
294 Ga0500608_000051 3300053122 Bacteria 52600
295 Ga0500618_001286 3300053125 Bacteria 11546
296 Ga0500655_000946 3300053133 Bacteria 5605
297 Ga0500559_0009336 3300053136 Bacteria 4251
298 Ga0500564_000404 3300053138 Bacteria 12410
299 Ga0500568_0029434 3300053139 Bacteria 2280
300 Ga0500574_000006 3300053141 Bacteria 52655
301 Ga0500616_0000060 3300053153 Bacteria 252252
302 Ga0500616_0003435 3300053153 Bacteria 12099
303 Ga0500616_0044178 3300053153 Bacteria 2378
304 Ga0500616_0090522 3300053153 Bacteria 1516
305 Ga0500624_000648 3300053157 Bacteria 9180
306 Ga0500636_0003805 3300053177 Bacteria 8524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0121009 Ga0501079_0121009_24_1307 400
2 3300042005 Ga0439448_0046534 Ga0439448_0046534_87_1400 429
3 3300044712 Ga0453684_0452307 Ga0453684_0452307_100_1413 429
4 3300053153 Ga0500616_0090522 Ga0500616_0090522_169_1482 434
5 3300048907 Ga0496104_0252449 Ga0496104_0252449_19_1410 446
6 3300026035 Ga0207703_10085566 Ga0207703_100855661 449
7 3300049763 Ga0501266_001254 Ga0501266_001254_26_1414 459
8 3300003791 Ga0055530_10013195 Ga0055530_100131951 475
9 3300031903 Ga0307407_10068086 Ga0307407_100680862 476
10 3300005937 Ga0081455_10002112 Ga0081455_100021124 480
11 3300005614 Ga0068856_100137366 Ga0068856_1001373662 486
12 3300026078 Ga0207702_10028410 Ga0207702_100284102 486
13 3300048903 Ga0496100_0026183 Ga0496100_0026183_1843_3360 486
14 3300048904 Ga0496101_0002643 Ga0496101_0002643_5651_7168 486
15 3300048907 Ga0496104_0006975 Ga0496104_0006975_2405_3922 486
16 3300048908 Ga0496105_0000055 Ga0496105_0000055_29880_31397 486
17 3300048911 Ga0496108_0018474 Ga0496108_0018474_136_1653 486
18 3300048913 Ga0496110_0010259 Ga0496110_0010259_2325_3842 486
19 3300048914 Ga0496111_0000092 Ga0496111_0000092_30646_32163 486
20 3300048917 Ga0496114_0000274 Ga0496114_0000274_14232_15749 486
21 3300005334 Ga0068869_100131642 Ga0068869_1001316421 490
22 3300005439 Ga0070711_100030376 Ga0070711_1000303765 491
23 3300006173 Ga0070716_100017115 Ga0070716_1000171152 491
24 3300025929 Ga0207664_10001238 Ga0207664_1000123814 491
25 3300025939 Ga0207665_10000529 Ga0207665_1000052925 491
26 3300049587 Ga0501071_0010199 Ga0501071_0010199_3347_4906 491
27 3300049589 Ga0501073_0062604 Ga0501073_0062604_263_1822 491
28 3300049591 Ga0501075_0066951 Ga0501075_0066951_860_2419 491
29 3300049592 Ga0501076_0069873 Ga0501076_0069873_1031_2590 491
30 3300049742 Ga0501080_0001046 Ga0501080_0001046_3791_5350 491
31 3300053085 Ga0495619_0060879 Ga0495619_0060879_942_2495 492
32 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005142 494
33 3300025233 Ga0209437_100043 Ga0209437_100043256 494
34 3300031548 Ga0307408_100105128 Ga0307408_1001051281 494
35 3300049686 Ga0501257_002399 Ga0501257_002399_2359_3915 499
36 3300028794 Ga0307515_10108344 Ga0307515_101083443 500
37 3300027614 Ga0209970_1001175 Ga0209970_10011753 501
38 3300005844 Ga0068862_100014597 Ga0068862_1000145975 502
39 3300048090 Ga0495615_0000053 Ga0495615_0000053_3911_5521 502
40 3300009553 Ga0105249_10055837 Ga0105249_100558373 503
41 3300025961 Ga0207712_10043778 Ga0207712_100437782 503
42 3300037068 Ga0373925_0049296 Ga0373925_0049296_862_2511 503
43 3300053116 Ga0500592_000084 Ga0500592_000084_1948_3564 503
44 3300053139 Ga0500568_0029434 Ga0500568_0029434_557_2173 503
45 3300025298 Ga0209050_1009718 Ga0209050_10097182 504
46 3300049515 Ga0501292_000021 Ga0501292_000021_39633_41174 506
47 3300049669 Ga0501235_001920 Ga0501235_001920_862_2403 506
48 3300049686 Ga0501257_000018 Ga0501257_000018_26271_27812 506
49 3300049705 Ga0501225_0000099 Ga0501225_0000099_3337_4878 506
50 3300049708 Ga0501245_000079 Ga0501245_000079_1025_2566 506
51 3300049775 Ga0501279_000014 Ga0501279_000014_28863_30404 506
52 3300049777 Ga0501281_00017 Ga0501281_00017_15898_17439 506
53 3300049779 Ga0501283_001804 Ga0501283_001804_1128_2669 506
54 3300005985 Ga0081539_10000123 Ga0081539_10000123154 507
55 3300047317 Ga0495604_0104822 Ga0495604_0104822_318_1910 507
56 3300047444 Ga0495675_0036165 Ga0495675_0036165_477_2069 507
57 3300039438 Ga0436360_0724457 Ga0436360_0724457_8307_9851 510
58 3300053153 Ga0500616_0000060 Ga0500616_0000060_144722_146299 510
59 iso_pu_bacteria 2585427608 2585900795 511
60 3300047472 Ga0495686_0000770 Ga0495686_0000770_17657_19240 512
61 3300042005 Ga0439448_0001059 Ga0439448_0001059_269_1867 513
62 3300047443 Ga0495687_010061 Ga0495687_010061_731_2320 514
63 iso_pu_bacteria 8003014200 8003016823 514
64 3300009148 Ga0105243_10000101 Ga0105243_1000010129 515
65 3300025935 Ga0207709_10000103 Ga0207709_1000010372 515
66 3300031456 Ga0307513_10000202 Ga0307513_100002023 515
67 3300033180 Ga0307510_10002795 Ga0307510_100027956 515
68 3300046452 Ga0495617_001354 Ga0495617_001354_6884_8482 515
69 3300046460 Ga0495638_0000183 Ga0495638_0000183_32596_34194 515
70 3300046492 Ga0495585_0018715 Ga0495585_0018715_709_2307 515
71 3300046512 Ga0495610_0017417 Ga0495610_0017417_1012_2610 515
72 3300046515 Ga0495620_0000045 Ga0495620_0000045_75399_76997 515
73 3300046522 Ga0495643_0001834 Ga0495643_0001834_8545_10143 515
74 3300046524 Ga0495648_0002568 Ga0495648_0002568_4110_5708 515
75 3300046525 Ga0495663_0000263 Ga0495663_0000263_1584_3182 515
76 3300046648 Ga0495611_0000134 Ga0495611_0000134_21547_23145 515
77 3300046660 Ga0495625_0014759 Ga0495625_0014759_2641_4239 515
78 3300046665 Ga0495661_0016127 Ga0495661_0016127_935_2533 515
79 3300046674 Ga0495588_0000938 Ga0495588_0000938_9177_10775 515
80 3300046689 Ga0495613_0000439 Ga0495613_0000439_6421_8019 515
81 3300046691 Ga0495670_0000026 Ga0495670_0000026_32553_34151 515
82 3300046692 Ga0495671_0000079 Ga0495671_0000079_76701_78299 515
83 3300046694 Ga0495649_0000480 Ga0495649_0000480_6783_8381 515
84 3300047443 Ga0495687_000093 Ga0495687_000093_33031_34629 515
85 3300047470 Ga0495681_0000758 Ga0495681_0000758_7621_9219 515
86 3300049459 Ga0495678_000171 Ga0495678_000171_21617_23215 515
87 3300049460 Ga0495682_0000817 Ga0495682_0000817_7289_8887 515
88 3300053086 Ga0500578_0001583 Ga0500578_0001583_13267_14865 515
89 3300053103 Ga0500555_002580 Ga0500555_002580_2395_3993 515
90 3300053120 Ga0500597_010544 Ga0500597_010544_272_1870 515
91 3300053122 Ga0500608_000051 Ga0500608_000051_32567_34165 515
92 3300053125 Ga0500618_001286 Ga0500618_001286_2018_3616 515
93 3300053136 Ga0500559_0009336 Ga0500559_0009336_2055_3653 515
94 3300053138 Ga0500564_000404 Ga0500564_000404_5414_7012 515
95 3300053141 Ga0500574_000006 Ga0500574_000006_18507_20105 515
96 3300053157 Ga0500624_000648 Ga0500624_000648_6421_8019 515
97 3300053177 Ga0500636_0003805 Ga0500636_0003805_6096_7694 515
98 iso_pu_bacteria 2855386786 2855390571 515
99 3300053153 Ga0500616_0003435 Ga0500616_0003435_3912_5513 516
100 iso_pu_bacteria 2643221561 2643826925 516
101 iso_pu_bacteria 2643221696 2644534273 516
102 3300005293 Ga0065715_10001389 Ga0065715_100013895 517
103 3300045836 Ga0466958_0013383 Ga0466958_0013383_306_1985 517
104 3300048921 Ga0496118_0010280 Ga0496118_0010280_4424_6019 517
105 3300048924 Ga0496121_0003312 Ga0496121_0003312_19603_21198 517
106 3300049679 Ga0501249_000361 Ga0501249_000361_8725_10329 517
107 3300003775 Ga0055524_1006625 Ga0055524_10066255 518
108 3300003775 Ga0055524_1024975 Ga0055524_10249751 518
109 3300003794 Ga0055531_10011116 Ga0055531_100111163 518
110 3300009094 Ga0111539_10008405 Ga0111539_100084055 518
111 3300025273 Ga0209673_1004235 Ga0209673_10042352 518
112 3300025284 Ga0209130_1003627 Ga0209130_10036275 518
113 3300025292 Ga0209676_1000853 Ga0209676_10008535 518
114 3300025292 Ga0209676_1001638 Ga0209676_10016382 518
115 3300025292 Ga0209676_1008281 Ga0209676_10082812 518
116 3300025294 Ga0209025_1004258 Ga0209025_10042586 518
117 3300025294 Ga0209025_1023037 Ga0209025_10230372 518
118 3300025298 Ga0209050_1000652 Ga0209050_10006523 518
119 3300025299 Ga0209256_1004182 Ga0209256_10041821 518
120 3300025299 Ga0209256_1006707 Ga0209256_10067072 518
121 3300025304 Ga0209257_1000378 Ga0209257_100037818 518
122 3300025304 Ga0209257_1002057 Ga0209257_100205716 518
123 3300025304 Ga0209257_1007841 Ga0209257_10078415 518
124 3300042010 Ga0439452_009850 Ga0439452_009850_343_1923 518
125 3300050511 nmdc:mga08y16_27098_c1 nmdc:mga08y16_27098_c1_1062_2648 518
126 3300009093 Ga0105240_10012389 Ga0105240_100123895 519
127 3300025304 Ga0209257_1009318 Ga0209257_10093185 519
128 3300027907 Ga0207428_10044592 Ga0207428_100445922 519
129 3300031852 Ga0307410_10041243 Ga0307410_100412432 519
130 3300031995 Ga0307409_100053632 Ga0307409_1000536322 519
131 3300032004 Ga0307414_10015964 Ga0307414_100159641 519
132 3300032004 Ga0307414_10049619 Ga0307414_100496192 519
133 3300044901 Ga0466960_0013208 Ga0466960_0013208_1154_2773 519
134 3300048913 Ga0496110_0051681 Ga0496110_0051681_1574_3160 519
135 iso_pu_bacteria 2524614729 2525556364 519
136 iso_pu_bacteria 2627854209 2630649594 519
137 iso_pu_bacteria 2738541264 2738669383 519
138 iso_pu_bacteria 2738541356 2739148507 519
139 iso_pu_bacteria 2775507049 2776912119 519
140 iso_pu_bacteria 2902810491 2902811637 519
141 iso_pu_bacteria 2939582691 2939582824 519
142 3300013308 Ga0157375_10091492 Ga0157375_100914922 520
143 3300025913 Ga0207695_10031401 Ga0207695_100314013 520
144 3300049776 Ga0501280_000404 Ga0501280_000404_4358_5944 520
145 3300050514 nmdc:mga08x19_17357_c1 nmdc:mga08x19_17357_c1_384_2033 520
146 iso_pu_bacteria 2984576629 2984580464 520
147 iso_pu_bacteria 2990256926 2990258156 520
148 3300009177 Ga0105248_10011860 Ga0105248_100118602 521
149 3300027364 Ga0209967_1002885 Ga0209967_10028852 521
150 3300027543 Ga0209999_1009304 Ga0209999_10093041 521
151 3300027665 Ga0209983_1000211 Ga0209983_10002118 521
152 3300027682 Ga0209971_1000229 Ga0209971_10002292 521
153 3300027876 Ga0209974_10004351 Ga0209974_100043512 521
154 3300027876 Ga0209974_10013716 Ga0209974_100137161 521
155 3300031995 Ga0307409_100016421 Ga0307409_1000164214 521
156 3300032126 Ga0307415_100030496 Ga0307415_1000304961 521
157 3300047319 Ga0495674_0016453 Ga0495674_0016453_4429_6078 521
158 3300049571 Ga0501034_0014371 Ga0501034_0014371_1710_3386 521
159 3300049579 Ga0501043_0088857 Ga0501043_0088857_263_1939 521
160 3300049580 Ga0501046_0006256 Ga0501046_0006256_5344_7020 521
161 3300049581 Ga0501047_0004517 Ga0501047_0004517_6000_7676 521
162 3300049586 Ga0501070_0003318 Ga0501070_0003318_3877_5553 521
163 3300049742 Ga0501080_0127992 Ga0501080_0127992_613_2289 521
164 3300049823 Ga0501044_0030899 Ga0501044_0030899_114_1790 521
165 3300005455 Ga0070663_100071020 Ga0070663_1000710203 522
166 3300009553 Ga0105249_10095693 Ga0105249_100956934 522
167 3300013308 Ga0157375_10020274 Ga0157375_100202746 522
168 3300025961 Ga0207712_10117961 Ga0207712_101179611 522
169 3300011119 Ga0105246_10123535 Ga0105246_101235351 523
170 3300005364 Ga0070673_100112918 Ga0070673_1001129181 524
171 3300005937 Ga0081455_10005275 Ga0081455_100052759 524
172 3300009098 Ga0105245_10005422 Ga0105245_100054223 524
173 3300013297 Ga0157378_10031658 Ga0157378_100316584 524
174 3300025927 Ga0207687_10006048 Ga0207687_100060485 524
175 3300025941 Ga0207711_10060476 Ga0207711_100604762 524
176 3300026023 Ga0207677_10041445 Ga0207677_100414453 524
177 3300026035 Ga0207703_10015833 Ga0207703_100158335 524
178 3300048913 Ga0496110_0056681 Ga0496110_0056681_1523_3112 524
179 3300048914 Ga0496111_0032453 Ga0496111_0032453_1212_2801 524
180 3300049571 Ga0501034_0003833 Ga0501034_0003833_12517_14196 525
181 3300005327 Ga0070658_10038324 Ga0070658_100383242 526
182 3300005435 Ga0070714_100005297 Ga0070714_1000052973 526
183 3300025929 Ga0207664_10001760 Ga0207664_1000176013 526
184 3300026142 Ga0207698_10138571 Ga0207698_101385712 526
185 3300028794 Ga0307515_10023919 Ga0307515_100239194 526
186 3300031691 Ga0316579_10039332 Ga0316579_100393322 526
187 iso_pu_bacteria 2808606401 2809065384 526
188 iso_pu_bacteria 2808606404 2809081411 526
189 iso_pu_bacteria 2808606405 2809085722 526
190 iso_pu_bacteria 2880518877 2880522721 526
191 3300009176 Ga0105242_10000557 Ga0105242_1000055725 527
192 3300025934 Ga0207686_10019156 Ga0207686_100191563 527
193 3300028794 Ga0307515_10000103 Ga0307515_10000103168 527
194 3300030521 Ga0307511_10000103 Ga0307511_1000010335 527
195 3300031616 Ga0307508_10032680 Ga0307508_100326802 527
196 3300053092 Ga0500583_0011495 Ga0500583_0011495_553_2160 527
197 3300053133 Ga0500655_000946 Ga0500655_000946_3228_4835 527
198 3300053153 Ga0500616_0044178 Ga0500616_0044178_700_2307 527
199 3300003354 JGI25160J50197_1000037 JGI25160J50197_100003772 528
200 3300005262 Ga0065165_1002480 Ga0065165_10024807 528
201 3300025302 Ga0207426_1000004 Ga0207426_1000004579 528
202 3300042876 Ga0451577_0035401 Ga0451577_0035401_1703_3313 528
203 3300046455 Ga0495603_0001042 Ga0495603_0001042_9260_10927 528
204 3300046472 Ga0495580_0000009 Ga0495580_0000009_72838_74505 528
205 3300046474 Ga0495605_0047039 Ga0495605_0047039_254_1921 528
206 3300046506 Ga0495583_0009199 Ga0495583_0009199_292_1959 528
207 3300047319 Ga0495674_0007999 Ga0495674_0007999_4771_6438 528
208 3300047443 Ga0495687_037995 Ga0495687_037995_24_1691 528
209 3300048903 Ga0496100_0000070 Ga0496100_0000070_8165_9832 528
210 3300048903 Ga0496100_0014864 Ga0496100_0014864_448_2115 528
211 3300048904 Ga0496101_0000044 Ga0496101_0000044_88887_90554 528
212 3300048905 Ga0496102_0001008 Ga0496102_0001008_16621_18288 528
213 3300048920 Ga0496117_0000098 Ga0496117_0000098_123923_125590 528
214 3300048921 Ga0496118_0008754 Ga0496118_0008754_570_2237 528
215 3300048924 Ga0496121_0002190 Ga0496121_0002190_13894_15561 528
216 3300048924 Ga0496121_0004010 Ga0496121_0004010_1726_3393 528
217 iso_pu_bacteria 2562617112 2563059764 528
218 iso_pu_bacteria 2711768613 2713480528 528
219 iso_pu_bacteria 2921643360 2921652822 528
220 3300035118 Ga0373954_0003175 Ga0373954_0003175_877_2484 529
221 3300035119 Ga0373956_0000427 Ga0373956_0000427_8889_10496 529
222 3300035172 Ga0373955_0020132 Ga0373955_0020132_1661_3310 529
223 3300035695 Ga0373927_0000316 Ga0373927_0000316_35912_37519 529
224 3300046454 Ga0495592_0013948 Ga0495592_0013948_52_1701 529
225 3300046463 Ga0495653_0003201 Ga0495653_0003201_11381_13030 529
226 3300046511 Ga0495608_0003208 Ga0495608_0003208_5009_6658 529
227 3300046529 Ga0495652_0003956 Ga0495652_0003956_92_1741 529
228 3300046533 Ga0495640_0065498 Ga0495640_0065498_748_2397 529
229 3300046543 Ga0495645_0015938 Ga0495645_0015938_1937_3586 529
230 3300046559 Ga0495667_0001649 Ga0495667_0001649_67_1716 529
231 3300047317 Ga0495604_0006221 Ga0495604_0006221_78_1727 529
232 3300047471 Ga0495684_0011106 Ga0495684_0011106_23_1672 529
233 3300053077 Ga0495601_0110444 Ga0495601_0110444_108_1757 529
234 iso_pu_bacteria 2808606401 2809063980 529
235 iso_pu_bacteria 2808606404 2809079948 529
236 iso_pu_bacteria 2808606405 2809084313 529
237 iso_pu_bacteria 2880518877 2880522879 529
238 3300002737 JGI25162J39368_1000652 JGI25162J39368_100065212 530
239 3300002772 JGI25164J39214_1000447 JGI25164J39214_100044714 530
240 3300003214 JGI25165J46597_1000623 JGI25165J46597_100062320 530
241 3300025231 Ga0207427_100191 Ga0207427_10019134 530
242 3300025233 Ga0209437_100167 Ga0209437_10016783 530
243 3300025261 Ga0209233_1000046 Ga0209233_100004683 530
244 3300046678 Ga0495599_0036340 Ga0495599_0036340_14_1729 530
245 3300037418 Ga0395900_0001112 Ga0395900_0001112_10975_12636 531
246 3300037466 Ga0395898_0065101 Ga0395898_0065101_1728_3389 531
247 3300038443 Ga0395901_0119649 Ga0395901_0119649_793_2454 531
248 3300028800 Ga0265338_10049534 Ga0265338_100495342 534
249 3300031251 Ga0265327_10026060 Ga0265327_100260602 534
250 3300003775 Ga0055524_1011746 Ga0055524_10117462 535
251 3300025263 Ga0209565_1012705 Ga0209565_10127051 535
252 3300025291 Ga0209675_1008876 Ga0209675_10088761 535
253 3300025294 Ga0209025_1009235 Ga0209025_10092353 535
254 3300025299 Ga0209256_1003864 Ga0209256_10038644 535
255 3300025303 Ga0209051_1023183 Ga0209051_10231832 535
256 iso_pu_bacteria 2501025504 2501410235 536
257 iso_pu_bacteria 2510917014 2511095553 536
258 iso_pu_bacteria 2513237082 2513554610 536
259 iso_pu_bacteria 2513237083 2513563560 536
260 iso_pu_bacteria 2513237150 2513957343 536
261 iso_pu_bacteria 2513237165 2514044759 536
262 iso_pu_bacteria 2515154189 2516018588 536
263 iso_pu_bacteria 2883087390 2883096215 536
264 iso_pu_bacteria 8003955200 8003960306 536
265 3300046462 Ga0495651_0109982 Ga0495651_0109982_241_1941 538
266 3300047317 Ga0495604_0003524 Ga0495604_0003524_8466_10166 538
267 3300048088 Ga0495602_0004257 Ga0495602_0004257_13180_14880 538
268 iso_pu_bacteria 644736347 644746510 538
269 3300003187 JGI25151J46595_10004938 JGI25151J46595_100049382 539
270 3300003187 JGI25151J46595_10009105 JGI25151J46595_100091053 539
271 3300003775 Ga0055524_1000451 Ga0055524_10004511 539
272 3300003781 Ga0055536_1000031 Ga0055536_100003152 539
273 3300003784 Ga0055534_1005738 Ga0055534_10057381 539
274 3300025263 Ga0209565_1001202 Ga0209565_10012021 539
275 3300025291 Ga0209675_1000372 Ga0209675_10003723 539
276 3300025291 Ga0209675_1009937 Ga0209675_10099372 539
277 3300025292 Ga0209676_1000036 Ga0209676_1000036279 539
278 3300025294 Ga0209025_1003788 Ga0209025_10037882 539
279 3300025294 Ga0209025_1005109 Ga0209025_10051095 539
280 3300025295 Ga0209564_1001212 Ga0209564_100121229 539
281 3300025295 Ga0209564_1001412 Ga0209564_100141212 539
282 3300025295 Ga0209564_1002371 Ga0209564_100237110 539
283 3300025299 Ga0209256_1000713 Ga0209256_100071344 539
284 3300042876 Ga0451577_0007179 Ga0451577_0007179_4765_6459 539
285 3300042876 Ga0451577_0009589 Ga0451577_0009589_2263_3927 539
286 3300044712 Ga0453684_0124462 Ga0453684_0124462_431_2095 539
287 3300045051 Ga0451576_0000609 Ga0451576_0000609_68541_70205 539
288 3300027666 Ga0209282_1000799 Ga0209282_10007994 542
289 3300046474 Ga0495605_0006429 Ga0495605_0006429_887_2578 542
290 3300046500 Ga0495596_0000580 Ga0495596_0000580_4514_6205 542
291 3300046512 Ga0495610_0001842 Ga0495610_0001842_4604_6295 542
292 3300046524 Ga0495648_0022169 Ga0495648_0022169_2426_4117 542
293 3300046665 Ga0495661_0003837 Ga0495661_0003837_4517_6208 542
294 3300046692 Ga0495671_0002836 Ga0495671_0002836_4962_6653 542
295 3300047320 Ga0495672_0006070 Ga0495672_0006070_2385_4076 542
296 3300048924 Ga0496121_0009087 Ga0496121_0009087_4279_5970 542
297 3300048925 Ga0496122_0009871 Ga0496122_0009871_1079_2770 542
298 3300048926 Ga0496123_0006270 Ga0496123_0006270_5571_7262 542
299 iso_pu_bacteria 2519103095 2519460110 542
300 iso_pu_bacteria 2582581311 2585290388 542
301 iso_pu_bacteria 2599185239 2599740068 542
302 iso_pu_bacteria 2599185240 2599744390 542
303 iso_pu_bacteria 2599185355 2600206427 542
304 iso_pu_bacteria 2675903129 2676744733 542
305 iso_pu_bacteria 2816332253 2817262382 542
306 iso_pu_bacteria 2816332256 2817280100 542
307 iso_pu_bacteria 2816332286 2817455312 542
308 iso_pu_bacteria 2818991452 2819635965 542
309 iso_pu_bacteria 2863421361 2863426250 542
310 iso_pu_bacteria 2870068957 2870069843 542
311 iso_pu_bacteria 2904564687 2904567937 542
312 iso_pu_bacteria 2904571731 2904574661 542
313 iso_pu_bacteria 2928157003 2928161778 542
314 iso_pu_bacteria 2928163908 2928169893 542
315 iso_pu_bacteria 2928170801 2928176786 542
316 iso_pu_bacteria 2928536128 2928539247 542
317 iso_pu_bacteria 2981990288 2981993056 542
318 iso_pu_bacteria 641736154 642417764 542
319 iso_pu_bacteria 8018845410 8018847179 542
320 iso_pu_bacteria 8020807995 8020809871 542
321 iso_pu_bacteria 8020938398 8020940855 542
322 iso_pu_bacteria 8020945358 8020948959 542
323 iso_pu_bacteria 8020953355 8020956281 542
324 iso_pu_bacteria 8021120328 8021127424 542
325 iso_pu_bacteria 8039098773 8039098854 542
326 iso_pu_bacteria 8040167225 8040171049 542
327 iso_pu_bacteria 8040173305 8040175597 542
328 3300001989 JGI24739J22299_10005048 JGI24739J22299_100050484 546
329 3300002067 JGI24735J21928_10013862 JGI24735J21928_100138622 546
330 3300003758 Ga0055532_1000986 Ga0055532_10009865 546
331 3300003758 Ga0055532_1001094 Ga0055532_10010944 546
332 3300003758 Ga0055532_1001206 Ga0055532_10012064 546
333 3300003760 Ga0055527_1000501 Ga0055527_100050112 546
334 3300003760 Ga0055527_1003025 Ga0055527_10030252 546
335 3300003761 Ga0055535_1001312 Ga0055535_10013124 546
336 3300003761 Ga0055535_1001339 Ga0055535_10013394 546
337 3300003762 Ga0055542_1001301 Ga0055542_10013014 546
338 3300003763 Ga0055529_1000854 Ga0055529_10008544 546
339 3300003856 Ga0058692_1001820 Ga0058692_10018202 546
340 3300005339 Ga0070660_100000015 Ga0070660_10000001540 546
341 3300005366 Ga0070659_100000109 Ga0070659_10000010958 546
342 3300005455 Ga0070663_100000813 Ga0070663_1000008132 546
343 3300005563 Ga0068855_100117538 Ga0068855_1001175383 546
344 3300005616 Ga0068852_100024420 Ga0068852_1000244204 546
345 3300009093 Ga0105240_10007058 Ga0105240_100070586 546
346 3300009093 Ga0105240_10113668 Ga0105240_101136682 546
347 3300009545 Ga0105237_10029598 Ga0105237_100295982 546
348 3300025225 Ga0209566_101663 Ga0209566_1016634 546
349 3300025226 Ga0209674_103023 Ga0209674_1030233 546
350 3300025228 Ga0209672_100041 Ga0209672_100041180 546
351 3300025228 Ga0209672_100071 Ga0209672_10007199 546
352 3300025229 Ga0209147_100135 Ga0209147_10013518 546
353 3300025229 Ga0209147_100364 Ga0209147_10036418 546
354 3300025229 Ga0209147_100758 Ga0209147_1007586 546
355 3300025242 Ga0209258_100120 Ga0209258_10012018 546
356 3300025242 Ga0209258_100207 Ga0209258_10020799 546
357 3300025254 Ga0209148_1000134 Ga0209148_100013471 546
358 3300025254 Ga0209148_1001121 Ga0209148_100112112 546
359 3300025272 Ga0209455_1000241 Ga0209455_100024146 546
360 3300025272 Ga0209455_1001072 Ga0209455_10010724 546
361 3300025273 Ga0209673_1000102 Ga0209673_1000102123 546
362 3300025904 Ga0207647_10017556 Ga0207647_100175564 546
363 3300025913 Ga0207695_10001334 Ga0207695_1000133414 546
364 3300025913 Ga0207695_10087912 Ga0207695_100879121 546
365 3300025914 Ga0207671_10006457 Ga0207671_100064576 546
366 3300025919 Ga0207657_10000039 Ga0207657_1000003978 546
367 3300025932 Ga0207690_10000010 Ga0207690_1000001039 546
368 3300026067 Ga0207678_10000032 Ga0207678_1000003277 546
369 3300027312 Ga0209371_1000345 Ga0209371_10003459 546
370 3300030500 Ga0268256_1001944 Ga0268256_10019449 546

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00732

GMC_oxred_N

GMC oxidoreductase

59

363

0.95

PF05199

GMC_oxred_C

GMC oxidoreductase

454

590

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oc1-assembly1.cif.gz_A crystal structure of aryl-alcohol oxidase from pleurotus eryngii in complex with p-anisic acid 0.9459 3 526
3fim-assembly1.cif.gz_B crystal structure of aryl-alcohol-oxidase from pleurotus eryingii 0.9445 3 526
8bxl-assembly3.cif.gz_E patulin synthase from penicillium expansum 0.9337 1 524
5zu3-assembly2.cif.gz_B effect of mutation (r554k) on fad modification in aspergillus oryzae rib40formate oxidase 0.9187 2 531
3t37-assembly1.cif.gz_A crystal structure of pyridoxine 4-oxidase from mesorbium loti 0.9178 3 521
ID Description Score Start End Superfamily
af_Q6UPE0_47_576_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9644 5 522 3.50.50.60
af_P9WNF7_1_267_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9641 1 36 3.50.50.60
af_P17444_4_531_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9551 4 522 3.50.50.60
3vrdB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.954 3 36 3.50.50.60
af_Q2FV11_9_533_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9499 4 519 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2E9Y7G6-F1-model_v4 Glucose-methanol-choline oxidoreductase 0.9847 1 523 GO:0008812
GO:0016020
GO:0019285
GO:0050660
AF-A0A1M5K2B3-F1-model_v4 Choline dehydrogenase 0.9842 2 525 GO:0008812
GO:0016020
GO:0019285
GO:0050660
AF-A0A061PX10-F1-model_v4 deleted 0.9818 34 410
AF-A0A529FQE2-F1-model_v4 Glucose-methanol-choline oxidoreductase 0.9797 178 436 GO:0016614
GO:0050660
AF-A0A352S0T1-F1-model_v4 GMC family oxidoreductase 0.9794 2 284 GO:0008812
GO:0016020
GO:0019285
GO:0050660

Feature Viewer

pLDDT pTM Quality
93.39 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map