F425160

General Info

Members Datasets Scaffolds Average Seq Length
369 271 312 227

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0102463|Ga0495645_0102463_500_1246
Length 248
Sequence LNPRRLALKPAGRLFKTEIIMHISFQIETEQGSRRLDTDIHTLIVAGWAGRDHAAIEHHIEELAALGISRPSAVPLYYRIASNQLTQASQVQVVGPDSSGEVETFVFAADGELYVSIASDHTDRKLEAHSVALSKQACVKPVAGSAWRLAEVAGYWDELVIRSYIEENGEQRLYQEGPLASLRTPQDLIAGYTDGAAMLPPGSGMTCGTVAAIGGIRPAQSFTMELFDPRRQRTLRHHYQVEVLPEVA

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
5 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
6 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
7 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
8 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
9 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
10 2643221569 Achromobacter sp. Root565 Isolate Unclassified
11 2643221594 Achromobacter sp. Root170 Isolate Unclassified
12 2643221621 Achromobacter sp. Root83 Isolate Unclassified
13 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
14 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
17 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
18 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
19 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
20 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
21 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
22 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
23 2818991436 Collimonas arenae 515 Isolate Unclassified
24 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
25 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
26 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
27 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
28 2842747753 Variovorax sp. R-72060 Isolate Unclassified
29 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
30 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
31 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
32 2858950400 Achromobacter sp. K91 Isolate Unclassified
33 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
34 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
35 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
36 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
37 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
38 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
39 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
40 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
41 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
42 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
43 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
44 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
45 2904504865 Serratia marcescens 1822 Isolate Unclassified
46 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
47 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
48 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
49 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
50 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
51 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
52 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
53 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
54 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
55 2941479691
56 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
57 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
58 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
61 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
62 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
63 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
67 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
68 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
69 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
70 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
71 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
76 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
77 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
79 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
86 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
87 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
88 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
267 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
268 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 640753048 Serratia proteamaculans 568 Isolate Endosphere
271 8004592986 Serratia sp. S119 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.55
Metatranscriptomes 0
Isolates 15.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.26
Nodule 2.44
Rhizoplane 0.54
Rhizosphere 58.54
Stem 0
Stem Tuber 0.54
Unclassified 21.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000129 3300002704 Bacteria 36066
2 JGI25155J39150_1000250 3300002704 Bacteria 20639
3 JGI25156J39149_1000110 3300002705 Bacteria 59456
4 JGI25156J39149_1000255 3300002705 Bacteria 36676
5 JGI25156J39149_1013818 3300002705 Bacteria 1694
6 JGI25162J39368_1000036 3300002737 Bacteria 180433
7 JGI25162J39368_1009106 3300002737 Bacteria 1356
8 JGI25154J39366_1000156 3300002738 Bacteria 52857
9 JGI25154J39366_1000230 3300002738 Bacteria 37506
10 JGI25157J39369_1000241 3300002741 Bacteria 41722
11 JGI25163J39215_1003490 3300002771 Bacteria 1261
12 JGI25164J39214_1002954 3300002772 Bacteria 2325
13 JGI25406J46586_10020927 3300003203 Bacteria 2634
14 JGI25165J46597_1000022 3300003214 Bacteria 357959
15 rootH1_10184868 3300003323 Bacteria 1431
16 Ga0055538_1000002 3300003751 Bacteria 999437
17 Ga0055538_1000011 3300003751 Bacteria 357959
18 Ga0055539_1000002 3300003752 Bacteria 999437
19 Ga0055539_1000016 3300003752 Bacteria 358248
20 Ga0055533_1000004 3300003756 Bacteria 999437
21 Ga0055533_1000019 3300003756 Bacteria 357959
22 Ga0055532_1000015 3300003758 Bacteria 340197
23 Ga0055532_1003039 3300003758 Bacteria 3102
24 Ga0055525_1000002 3300003759 Bacteria 999437
25 Ga0055525_1000042 3300003759 Bacteria 279804
26 Ga0055527_1000163 3300003760 Bacteria 46039
27 Ga0055535_1000347 3300003761 Bacteria 46008
28 Ga0055535_1005475 3300003761 Bacteria 2769
29 Ga0055542_1000319 3300003762 Bacteria 51627
30 Ga0055529_1000345 3300003763 Bacteria 51627
31 Ga0055541_1000017 3300003841 Bacteria 286811
32 Ga0055541_1000043 3300003841 Bacteria 161703
33 Ga0065703_1018966 3300005272 Bacteria 4692
34 Ga0065715_10040534 3300005293 Bacteria 1535
35 Ga0070683_100018001 3300005329 Bacteria 6248
36 Ga0070690_100279277 3300005330 Bacteria 1191
37 Ga0070670_100033229 3300005331 Bacteria 4444
38 Ga0070670_100584696 3300005331 Bacteria 998
39 Ga0070677_10020126 3300005333 Bacteria 2426
40 Ga0070666_10370559 3300005335 Bacteria 1027
41 Ga0070689_100059665 3300005340 Bacteria 2965
42 Ga0070669_100094241 3300005353 Bacteria 2250
43 Ga0070675_100127264 3300005354 Bacteria 2168
44 Ga0070671_100066426 3300005355 Bacteria 3006
45 Ga0070674_100028324 3300005356 Bacteria 3679
46 Ga0070674_100171830 3300005356 Bacteria 1653
47 Ga0070673_100520942 3300005364 Bacteria 1077
48 Ga0070659_100764238 3300005366 Bacteria 839
49 Ga0070700_100186599 3300005441 Bacteria 1447
50 Ga0070662_100385121 3300005457 Bacteria 1155
51 Ga0070681_10218624 3300005458 Bacteria 1821
52 Ga0068867_100047381 3300005459 Bacteria 3159
53 Ga0070685_10042505 3300005466 Bacteria 2594
54 Ga0070698_100268372 3300005471 Bacteria 1638
55 Ga0070684_100020344 3300005535 Bacteria 5506
56 Ga0070672_100095487 3300005543 Bacteria 2404
57 Ga0068855_100000065 3300005563 Bacteria 129307
58 Ga0068855_100003861 3300005563 Bacteria 18318
59 Ga0068855_100041964 3300005563 Bacteria 5421
60 Ga0068854_100425248 3300005578 Bacteria 1104
61 Ga0068856_100021164 3300005614 Bacteria 6319
62 Ga0068852_100005403 3300005616 Bacteria 9140
63 Ga0068859_100125876 3300005617 Bacteria 2631
64 Ga0068861_100118489 3300005719 Bacteria 2132
65 Ga0068863_100397395 3300005841 Bacteria 1348
66 Ga0075364_10035439 3300006051 Bacteria 3224
67 Ga0097621_100142574 3300006237 Bacteria 2048
68 Ga0097620_100125887 3300006931 Bacteria 2631
69 Ga0079104_1000037 3300006946 Bacteria 189207
70 Ga0079104_1000542 3300006946 Bacteria 39551
71 Ga0079104_1010340 3300006946 Bacteria 3082
72 Ga0105251_10000036 3300009011 Bacteria 117656
73 Ga0105251_10000576 3300009011 Bacteria 34073
74 Ga0105251_10001087 3300009011 Bacteria 23687
75 Ga0105251_10063135 3300009011 Bacteria 1738
76 Ga0105244_10000019 3300009036 Bacteria 242333
77 Ga0105244_10001040 3300009036 Bacteria 23211
78 Ga0105250_10000021 3300009092 Bacteria 239960
79 Ga0105250_10001621 3300009092 Bacteria 12033
80 Ga0105250_10007581 3300009092 Bacteria 4652
81 Ga0105240_10003969 3300009093 Bacteria 22846
82 Ga0105240_10005768 3300009093 Bacteria 18361
83 Ga0105240_10567238 3300009093 Bacteria 1254
84 Ga0105247_10000059 3300009101 Bacteria 129821
85 Ga0105243_10007340 3300009148 Bacteria 8474
86 Ga0105241_10000012 3300009174 Bacteria 221790
87 Ga0105241_10166302 3300009174 Bacteria 1818
88 Ga0105237_10135707 3300009545 Bacteria 2455
89 Ga0105238_10034748 3300009551 Bacteria 5127
90 Ga0105238_10081884 3300009551 Bacteria 3218
91 Ga0105246_10028292 3300011119 Bacteria 3681
92 Ga0157373_10000753 3300013100 Bacteria 25142
93 Ga0157370_10177342 3300013104 Bacteria 1981
94 Ga0157370_10181761 3300013104 Bacteria 1954
95 Ga0157374_10721271 3300013296 Bacteria 1011
96 Ga0157380_10042317 3300014326 Bacteria 3561
97 Ga0182008_10030156 3300014497 Bacteria 2735
98 Ga0182008_10138104 3300014497 Bacteria 1218
99 Ga0182008_10355180 3300014497 Bacteria 778
100 Ga0157379_10532569 3300014968 Bacteria 1091
101 Ga0182006_1006664 3300015261 Bacteria 5348
102 Ga0182007_10005445 3300015262 Bacteria 5591
103 Ga0182007_10010247 3300015262 Bacteria 3717
104 Ga0182005_1001639 3300015265 Bacteria 8713
105 Ga0163161_10000126 3300017792 Bacteria 71921
106 Ga0213872_10003001 3300021361 Bacteria 9536
107 Ga0209435_100021 3300025206 Bacteria 223961
108 Ga0209435_100502 3300025206 Bacteria 7658
109 Ga0209784_100002 3300025224 Bacteria 1753105
110 Ga0209784_100019 3300025224 Bacteria 453558
111 Ga0209566_100003 3300025225 Bacteria 1753105
112 Ga0209566_100017 3300025225 Bacteria 453558
113 Ga0209674_100004 3300025226 Bacteria 1753105
114 Ga0209674_100031 3300025226 Bacteria 453558
115 Ga0209672_100093 3300025228 Bacteria 115446
116 Ga0209672_106251 3300025228 Bacteria 1956
117 Ga0209147_100004 3300025229 Bacteria 1371850
118 Ga0209147_100134 3300025229 Bacteria 118581
119 Ga0209563_100006 3300025230 Bacteria 1753105
120 Ga0209563_100035 3300025230 Bacteria 453558
121 Ga0207427_100819 3300025231 Bacteria 14035
122 Ga0209437_100038 3300025233 Bacteria 453558
123 Ga0209437_100045 3300025233 Bacteria 429809
124 Ga0209258_100083 3300025242 Bacteria 246008
125 Ga0209258_100209 3300025242 Bacteria 118581
126 Ga0209646_1000020 3300025246 Bacteria 462204
127 Ga0209646_1000074 3300025246 Bacteria 223961
128 Ga0209026_1000058 3300025250 Bacteria 228656
129 Ga0209677_100003 3300025253 Bacteria 1753105
130 Ga0209677_100020 3300025253 Bacteria 453558
131 Ga0209148_1000184 3300025254 Bacteria 118581
132 Ga0209759_1000046 3300025256 Bacteria 230149
133 Ga0209759_1000073 3300025256 Bacteria 178048
134 Ga0209233_1000049 3300025261 Bacteria 453558
135 Ga0209455_1000160 3300025272 Bacteria 118581
136 Ga0209455_1003374 3300025272 Bacteria 5678
137 Ga0209676_1049409 3300025292 Bacteria 1116
138 Ga0209050_1001566 3300025298 Bacteria 23811
139 Ga0207696_1000061 3300025711 Bacteria 241730
140 Ga0207696_1000079 3300025711 Bacteria 199842
141 Ga0207655_1000025 3300025728 Bacteria 449261
142 Ga0207655_1000079 3300025728 Bacteria 219036
143 Ga0207713_1000051 3300025735 Bacteria 225973
144 Ga0207713_1000054 3300025735 Bacteria 222042
145 Ga0207713_1001067 3300025735 Bacteria 23652
146 Ga0207682_10004167 3300025893 Bacteria 6113
147 Ga0207710_10000042 3300025900 Bacteria 223734
148 Ga0207710_10015746 3300025900 Bacteria 3197
149 Ga0207688_10050198 3300025901 Bacteria 2335
150 Ga0207680_10456356 3300025903 Bacteria 907
151 Ga0207654_10000015 3300025911 Bacteria 221799
152 Ga0207695_10001256 3300025913 Bacteria 43272
153 Ga0207695_10003202 3300025913 Bacteria 23318
154 Ga0207695_10016352 3300025913 Bacteria 8682
155 Ga0207695_10575966 3300025913 Bacteria 1007
156 Ga0207671_10036947 3300025914 Bacteria 3622
157 Ga0207662_10083790 3300025918 Bacteria 1949
158 Ga0207681_10096654 3300025923 Bacteria 2121
159 Ga0207694_10003828 3300025924 Bacteria 11904
160 Ga0207694_10057960 3300025924 Bacteria 3012
161 Ga0207650_10280280 3300025925 Bacteria 1357
162 Ga0207644_10106297 3300025931 Bacteria 2116
163 Ga0207709_10000167 3300025935 Bacteria 88877
164 Ga0207669_10043356 3300025937 Bacteria 2634
165 Ga0207691_10033828 3300025940 Bacteria 4758
166 Ga0207667_10000025 3300025949 Bacteria 350159
167 Ga0207667_10455392 3300025949 Bacteria 1300
168 Ga0207640_10438669 3300025981 Bacteria 1073
169 Ga0207677_10232477 3300026023 Bacteria 1486
170 Ga0207639_10501037 3300026041 Bacteria 1109
171 Ga0207708_10193290 3300026075 Bacteria 1621
172 Ga0207702_10018384 3300026078 Bacteria 5783
173 Ga0207648_10013708 3300026089 Bacteria 7525
174 Ga0207674_10026522 3300026116 Bacteria 6150
175 Ga0207674_10177515 3300026116 Bacteria 2082
176 Ga0207675_100679650 3300026118 Bacteria 1037
177 Ga0207683_10001401 3300026121 Bacteria 21763
178 Ga0207698_10031659 3300026142 Bacteria 3822
179 Ga0209281_1000002 3300027111 Bacteria 1924012
180 Ga0209281_1000092 3300027111 Bacteria 241437
181 Ga0265325_10030670 3300031241 Bacteria 2882
182 Ga0265340_10115373 3300031247 Bacteria 1238
183 Ga0265327_10018399 3300031251 Bacteria 4333
184 Ga0307513_10018181 3300031456 Bacteria 8411
185 Ga0307509_10223333 3300031507 Bacteria 1694
186 Ga0307509_10494264 3300031507 Bacteria 909
187 Ga0307514_10005246 3300031649 Bacteria 11663
188 Ga0265342_10042951 3300031712 Bacteria 2729
189 Ga0307405_10351971 3300031731 Bacteria 1136
190 Ga0307413_10357305 3300031824 Bacteria 1130
191 Ga0307406_10243185 3300031901 Bacteria 1351
192 Ga0307412_10000263 3300031911 Bacteria 33733
193 Ga0307414_10244593 3300032004 Bacteria 1487
194 Ga0307414_10254960 3300032004 Bacteria 1460
195 Ga0373931_0196859 3300035691 Bacteria 1202
196 Ga0373937_0449490 3300036401 Bacteria 1224
197 Ga0436361_0097666 3300039447 Bacteria 18811
198 Ga0436361_0505039 3300039447 Bacteria 1234
199 Ga0439466_0020545 3300041411 Bacteria 2352
200 Ga0451793_0642226 3300041452 Bacteria 1092
201 Ga0439431_0037868 3300041997 Bacteria 1219
202 Ga0439432_012128 3300042006 Bacteria 2957
203 Ga0495627_000048 3300046453 Bacteria 169824
204 Ga0495592_0105778 3300046454 Bacteria 1998
205 Ga0495591_012727 3300046458 Bacteria 3115
206 Ga0495638_0042487 3300046460 Bacteria 2871
207 Ga0495651_0111527 3300046462 Bacteria 2021
208 Ga0495653_0006090 3300046463 Bacteria 9882
209 Ga0495650_0000033 3300046471 Bacteria 412188
210 Ga0495605_0100728 3300046474 Bacteria 1328
211 Ga0495584_0015450 3300046491 Bacteria 3891
212 Ga0495607_0000007 3300046501 Bacteria 272517
213 Ga0495607_0015889 3300046501 Bacteria 4869
214 Ga0495607_0058311 3300046501 Bacteria 2208
215 Ga0495606_0000408 3300046507 Bacteria 72620
216 Ga0495608_0038654 3300046511 Bacteria 3203
217 Ga0495616_0029479 3300046513 Bacteria 2897
218 Ga0495618_0076252 3300046514 Bacteria 2136
219 Ga0495628_0002144 3300046516 Bacteria 17876
220 Ga0495628_0026095 3300046516 Bacteria 4769
221 Ga0495628_0307920 3300046516 Bacteria 1171
222 Ga0495637_0072199 3300046520 Bacteria 1390
223 Ga0495643_0154251 3300046522 Bacteria 1135
224 Ga0495648_0016390 3300046524 Bacteria 5346
225 Ga0495652_0008199 3300046529 Bacteria 9550
226 Ga0495652_0073685 3300046529 Bacteria 2842
227 Ga0495654_0000020 3300046530 Bacteria 284814
228 Ga0495654_0000580 3300046530 Bacteria 29424
229 Ga0495654_0138663 3300046530 Bacteria 1086
230 Ga0495598_0078316 3300046537 Bacteria 1055
231 Ga0495645_0102463 3300046543 Bacteria 2034
232 Ga0495611_0039807 3300046648 Bacteria 2094
233 Ga0495625_0005408 3300046660 Bacteria 11659
234 Ga0495588_0002145 3300046674 Bacteria 8446
235 Ga0495599_0052676 3300046678 Bacteria 2549
236 Ga0495623_0053409 3300046679 Bacteria 2551
237 Ga0495623_0069567 3300046679 Bacteria 2193
238 Ga0495646_0000310 3300046680 Bacteria 25005
239 Ga0495646_0020792 3300046680 Bacteria 4150
240 Ga0495624_0068032 3300046690 Bacteria 2221
241 Ga0495671_0021315 3300046692 Bacteria 3406
242 Ga0495589_0000025 3300046794 Bacteria 185024
243 Ga0495589_0002801 3300046794 Bacteria 9642
244 Ga0495600_0011464 3300046809 Bacteria 5524
245 Ga0495660_0000011 3300046810 Bacteria 361397
246 Ga0495604_0073230 3300047317 Bacteria 2586
247 Ga0495672_0000004 3300047320 Bacteria 631810
248 Ga0495683_0022561 3300047323 Bacteria 3236
249 Ga0495683_0022582 3300047323 Bacteria 3235
250 Ga0495673_0000023 3300047469 Bacteria 539904
251 Ga0495681_0002066 3300047470 Bacteria 14585
252 Ga0495681_0008973 3300047470 Bacteria 6207
253 Ga0495602_0179727 3300048088 Bacteria 1633
254 Ga0495602_0357361 3300048088 Bacteria 1052
255 Ga0495615_0010671 3300048090 Bacteria 1844
256 Ga0496116_0000009 3300048919 Bacteria 716119
257 Ga0496116_0003384 3300048919 Bacteria 15815
258 Ga0496116_0004430 3300048919 Bacteria 13401
259 Ga0496116_0038435 3300048919 Bacteria 3323
260 Ga0496117_0014437 3300048920 Bacteria 6805
261 Ga0496117_0022467 3300048920 Bacteria 5058
262 Ga0496117_0051731 3300048920 Bacteria 2900
263 Ga0496118_0005259 3300048921 Bacteria 14781
264 Ga0496118_0013341 3300048921 Bacteria 7781
265 Ga0496118_0016848 3300048921 Bacteria 6678
266 Ga0496118_0030108 3300048921 Bacteria 4539
267 Ga0496119_0016716 3300048922 Bacteria 5563
268 Ga0496119_0027059 3300048922 Bacteria 3956
269 Ga0496120_0010017 3300048923 Bacteria 6656
270 Ga0496120_0078312 3300048923 Bacteria 1797
271 Ga0496121_0002277 3300048924 Bacteria 29873
272 Ga0496121_0102690 3300048924 Bacteria 2202
273 Ga0496121_0168458 3300048924 Bacteria 1594
274 Ga0496122_0000021 3300048925 Bacteria 391363
275 Ga0496122_0000887 3300048925 Bacteria 55765
276 Ga0496122_0056659 3300048925 Bacteria 2919
277 Ga0496123_0000180 3300048926 Bacteria 127726
278 Ga0496123_0000426 3300048926 Bacteria 76093
279 Ga0496124_0162899 3300048927 Bacteria 1736
280 Ga0496124_0339871 3300048927 Bacteria 1066
281 Ga0496125_0000005 3300048928 Bacteria 827598
282 Ga0496125_0003534 3300048928 Bacteria 18842
283 Ga0496125_0080345 3300048928 Bacteria 2496
284 Ga0496125_0096427 3300048928 Bacteria 2195
285 Ga0496125_0307179 3300048928 Bacteria 968
286 Ga0496126_0048672 3300048929 Bacteria 3872
287 Ga0495678_007398 3300049459 Bacteria 5697
288 Ga0495682_0000004 3300049460 Bacteria 378337
289 Ga0501033_0187251 3300049570 Bacteria 1482
290 Ga0501037_0103866 3300049573 Bacteria 2049
291 Ga0501038_0098094 3300049574 Bacteria 2444
292 Ga0501047_0029543 3300049581 Bacteria 5285
293 Ga0501072_0008121 3300049588 Bacteria 7965
294 Ga0501083_0022783 3300049744 Bacteria 4346
295 Ga0501083_0026864 3300049744 Bacteria 3977
296 Ga0501035_0037436 3300049822 Bacteria 4393
297 Ga0501044_0046585 3300049823 Bacteria 4488
298 nmdc:mga00v17_36909_c1 3300050491 Bacteria 2915
299 Ga0495601_0090240 3300053077 Bacteria 1971
300 Ga0500651_0006783 3300053093 Bacteria 6631
301 Ga0500595_008202 3300053119 Bacteria 4284
302 Ga0500618_002684 3300053125 Bacteria 6505
303 Ga0500618_004092 3300053125 Bacteria 4776
304 Ga0500621_000001 3300053126 Bacteria 1049698
305 Ga0500577_0178367 3300053142 Bacteria 911
306 Ga0500590_059401 3300053148 Bacteria 1924
307 Ga0500619_000196 3300053154 Bacteria 13928
308 Ga0500619_001472 3300053154 Bacteria 4183
309 Ga0500627_0167780 3300053158 Bacteria 990
310 Ga0501082_0007311 3300060353 Bacteria 9529
311 Ga0501082_0246988 3300060353 Bacteria 1553
312 Ga0501082_0384296 3300060353 Bacteria 1225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100171830 Ga0070674_1001718302 212
2 3300047470 Ga0495681_0008973 Ga0495681_0008973_2530_3210 213
3 iso_pu_bacteria 2842747753 2842748525 218
4 iso_pu_bacteria 2881927736 2881930660 218
5 iso_pu_bacteria 2887375801 2887378541 218
6 iso_pu_bacteria 2506520007 2506580209 219
7 iso_pu_bacteria 2506520008 2506585348 219
8 iso_pu_bacteria 2508501071 2508853982 219
9 iso_pu_bacteria 2654587920 2656277778 219
10 iso_pu_bacteria 2687453601 2689446737 219
11 iso_pu_bacteria 2806310673 2807178052 219
12 iso_pu_bacteria 2869551831 2869556116 219
13 iso_pu_bacteria 2888366609 2888370736 219
14 iso_pu_bacteria 2888373701 2888376799 219
15 iso_pu_bacteria 2904504865 2904506126 219
16 iso_pu_bacteria 640753048 640939465 219
17 iso_pu_bacteria 8004592986 8004593040 219
18 3300003203 JGI25406J46586_10020927 JGI25406J46586_100209272 220
19 3300005293 Ga0065715_10040534 Ga0065715_100405341 220
20 3300005329 Ga0070683_100018001 Ga0070683_1000180013 220
21 3300005330 Ga0070690_100279277 Ga0070690_1002792771 220
22 3300005331 Ga0070670_100584696 Ga0070670_1005846962 220
23 3300005333 Ga0070677_10020126 Ga0070677_100201262 220
24 3300005340 Ga0070689_100059665 Ga0070689_1000596652 220
25 3300005353 Ga0070669_100094241 Ga0070669_1000942414 220
26 3300005354 Ga0070675_100127264 Ga0070675_1001272642 220
27 3300005355 Ga0070671_100066426 Ga0070671_1000664263 220
28 3300005356 Ga0070674_100028324 Ga0070674_1000283245 220
29 3300005364 Ga0070673_100520942 Ga0070673_1005209421 220
30 3300005441 Ga0070700_100186599 Ga0070700_1001865992 220
31 3300005457 Ga0070662_100385121 Ga0070662_1003851211 220
32 3300005458 Ga0070681_10218624 Ga0070681_102186242 220
33 3300005459 Ga0068867_100047381 Ga0068867_1000473812 220
34 3300005466 Ga0070685_10042505 Ga0070685_100425053 220
35 3300005535 Ga0070684_100020344 Ga0070684_1000203443 220
36 3300005543 Ga0070672_100095487 Ga0070672_1000954872 220
37 3300005617 Ga0068859_100125876 Ga0068859_1001258763 220
38 3300005719 Ga0068861_100118489 Ga0068861_1001184893 220
39 3300005841 Ga0068863_100397395 Ga0068863_1003973952 220
40 3300006237 Ga0097621_100142574 Ga0097621_1001425743 220
41 3300006931 Ga0097620_100125887 Ga0097620_1001258873 220
42 3300009093 Ga0105240_10567238 Ga0105240_105672382 220
43 3300009174 Ga0105241_10166302 Ga0105241_101663022 220
44 3300009551 Ga0105238_10081884 Ga0105238_100818845 220
45 3300011119 Ga0105246_10028292 Ga0105246_100282923 220
46 3300013296 Ga0157374_10721271 Ga0157374_107212712 220
47 3300014326 Ga0157380_10042317 Ga0157380_100423171 220
48 3300014968 Ga0157379_10532569 Ga0157379_105325692 220
49 3300025893 Ga0207682_10004167 Ga0207682_100041674 220
50 3300025900 Ga0207710_10015746 Ga0207710_100157465 220
51 3300025901 Ga0207688_10050198 Ga0207688_100501982 220
52 3300025913 Ga0207695_10575966 Ga0207695_105759661 220
53 3300025918 Ga0207662_10083790 Ga0207662_100837902 220
54 3300025923 Ga0207681_10096654 Ga0207681_100966543 220
55 3300025925 Ga0207650_10280280 Ga0207650_102802802 220
56 3300025931 Ga0207644_10106297 Ga0207644_101062972 220
57 3300025937 Ga0207669_10043356 Ga0207669_100433562 220
58 3300025940 Ga0207691_10033828 Ga0207691_100338283 220
59 3300026023 Ga0207677_10232477 Ga0207677_102324772 220
60 3300026041 Ga0207639_10501037 Ga0207639_105010372 220
61 3300026075 Ga0207708_10193290 Ga0207708_101932902 220
62 3300026089 Ga0207648_10013708 Ga0207648_100137086 220
63 3300026116 Ga0207674_10026522 Ga0207674_100265226 220
64 3300026118 Ga0207675_100679650 Ga0207675_1006796502 220
65 3300026121 Ga0207683_10001401 Ga0207683_100014014 220
66 3300031241 Ga0265325_10030670 Ga0265325_100306703 220
67 3300031247 Ga0265340_10115373 Ga0265340_101153732 220
68 3300031507 Ga0307509_10494264 Ga0307509_104942641 220
69 3300031712 Ga0265342_10042951 Ga0265342_100429512 220
70 3300035691 Ga0373931_0196859 Ga0373931_0196859_411_1085 220
71 3300046460 Ga0495638_0042487 Ga0495638_0042487_2030_2704 220
72 3300046501 Ga0495607_0015889 Ga0495607_0015889_2946_3629 220
73 3300046537 Ga0495598_0078316 Ga0495598_0078316_271_945 220
74 3300048090 Ga0495615_0010671 Ga0495615_0010671_950_1624 220
75 3300049581 Ga0501047_0029543 Ga0501047_0029543_1499_2176 220
76 3300049588 Ga0501072_0008121 Ga0501072_0008121_6802_7476 220
77 3300049744 Ga0501083_0022783 Ga0501083_0022783_2631_3305 220
78 3300049744 Ga0501083_0026864 Ga0501083_0026864_2361_3035 220
79 3300053142 Ga0500577_0178367 Ga0500577_0178367_13_687 220
80 3300053148 Ga0500590_059401 Ga0500590_059401_351_1070 220
81 3300053154 Ga0500619_000196 Ga0500619_000196_1611_2330 220
82 3300053158 Ga0500627_0167780 Ga0500627_0167780_86_760 220
83 3300060353 Ga0501082_0007311 Ga0501082_0007311_3671_4345 220
84 3300060353 Ga0501082_0246988 Ga0501082_0246988_407_1081 220
85 3300060353 Ga0501082_0384296 Ga0501082_0384296_518_1195 220
86 iso_pu_bacteria 2511231003 2511249792 220
87 iso_pu_bacteria 2511231026 2511384241 220
88 iso_pu_bacteria 2521172590 2521557785 220
89 iso_pu_bacteria 2548876994 2550696127 220
90 iso_pu_bacteria 2551306416 2553002908 220
91 iso_pu_bacteria 2599185292 2599902227 220
92 iso_pu_bacteria 2643221569 2643859619 220
93 iso_pu_bacteria 2643221594 2643978918 220
94 iso_pu_bacteria 2643221621 2644120359 220
95 iso_pu_bacteria 2721755523 2722885715 220
96 iso_pu_bacteria 2738541317 2738948414 220
97 iso_pu_bacteria 2765235838 2765568891 220
98 iso_pu_bacteria 2808606386 2808984570 220
99 iso_pu_bacteria 2808606395 2809036325 220
100 iso_pu_bacteria 2808606415 2809130616 220
101 iso_pu_bacteria 2808606419 2809149907 220
102 iso_pu_bacteria 2818991436 2819542467 220
103 iso_pu_bacteria 2818991445 2819592214 220
104 iso_pu_bacteria 2818991449 2819615070 220
105 iso_pu_bacteria 2839094727 2839096227 220
106 iso_pu_bacteria 2839138175 2839143939 220
107 iso_pu_bacteria 2852618963 2852619948 220
108 iso_pu_bacteria 2854601825 2854605169 220
109 iso_pu_bacteria 2857537821 2857541403 220
110 iso_pu_bacteria 2858950400 2858952921 220
111 iso_pu_bacteria 2884811622 2884812868 220
112 iso_pu_bacteria 2884836552 2884840362 220
113 iso_pu_bacteria 2884852848 2884855618 220
114 iso_pu_bacteria 2894023352 2894026692 220
115 iso_pu_bacteria 2896154374 2896157456 220
116 iso_pu_bacteria 2900051742 2900054685 220
117 iso_pu_bacteria 2904439833 2904441451 220
118 iso_pu_bacteria 2904530477 2904531611 220
119 iso_pu_bacteria 2904584206 2904586749 220
120 iso_pu_bacteria 2904589729 2904593218 220
121 iso_pu_bacteria 2904601388 2904602939 220
122 iso_pu_bacteria 2913308742 2913313203 220
123 iso_pu_bacteria 2919046199 2919046251 220
124 iso_pu_bacteria 2919079590 2919084041 220
125 iso_pu_bacteria 2923510766 2923511005 220
126 iso_pu_bacteria 2928130867 2928130967 220
127 iso_pu_bacteria 2941479691 2941483213 220
128 3300005335 Ga0070666_10370559 Ga0070666_103705591 221
129 3300005366 Ga0070659_100764238 Ga0070659_1007642382 221
130 3300005471 Ga0070698_100268372 Ga0070698_1002683722 221
131 3300025903 Ga0207680_10456356 Ga0207680_104563561 221
132 3300031507 Ga0307509_10223333 Ga0307509_102233332 221
133 3300041997 Ga0439431_0037868 Ga0439431_0037868_495_1172 221
134 3300031731 Ga0307405_10351971 Ga0307405_103519712 222
135 3300031824 Ga0307413_10357305 Ga0307413_103573052 222
136 3300031901 Ga0307406_10243185 Ga0307406_102431851 222
137 3300032004 Ga0307414_10244593 Ga0307414_102445932 222
138 3300032004 Ga0307414_10254960 Ga0307414_102549602 222
139 3300036401 Ga0373937_0449490 Ga0373937_0449490_412_1092 222
140 3300041452 Ga0451793_0642226 Ga0451793_0642226_125_808 222
141 3300003758 Ga0055532_1003039 Ga0055532_10030393 223
142 3300003760 Ga0055527_1000163 Ga0055527_10001633 223
143 3300003761 Ga0055535_1000347 Ga0055535_10003473 223
144 3300003762 Ga0055542_1000319 Ga0055542_10003198 223
145 3300003763 Ga0055529_1000345 Ga0055529_10003458 223
146 3300005272 Ga0065703_1018966 Ga0065703_10189665 223
147 3300006946 Ga0079104_1000542 Ga0079104_100054219 223
148 3300006946 Ga0079104_1010340 Ga0079104_10103402 223
149 3300009011 Ga0105251_10000036 Ga0105251_1000003617 223
150 3300009011 Ga0105251_10000576 Ga0105251_1000057623 223
151 3300009011 Ga0105251_10001087 Ga0105251_1000108717 223
152 3300009036 Ga0105244_10000019 Ga0105244_10000019165 223
153 3300009036 Ga0105244_10001040 Ga0105244_1000104024 223
154 3300009092 Ga0105250_10000021 Ga0105250_10000021184 223
155 3300009092 Ga0105250_10001621 Ga0105250_100016214 223
156 3300009101 Ga0105247_10000059 Ga0105247_1000005978 223
157 3300009174 Ga0105241_10000012 Ga0105241_10000012151 223
158 3300013100 Ga0157373_10000753 Ga0157373_1000075313 223
159 3300013104 Ga0157370_10177342 Ga0157370_101773422 223
160 3300013104 Ga0157370_10181761 Ga0157370_101817613 223
161 3300014497 Ga0182008_10030156 Ga0182008_100301562 223
162 3300017792 Ga0163161_10000126 Ga0163161_1000012654 223
163 3300025228 Ga0209672_100093 Ga0209672_10009347 223
164 3300025229 Ga0209147_100134 Ga0209147_10013448 223
165 3300025242 Ga0209258_100209 Ga0209258_10020948 223
166 3300025254 Ga0209148_1000184 Ga0209148_100018464 223
167 3300025272 Ga0209455_1000160 Ga0209455_100016048 223
168 3300025711 Ga0207696_1000061 Ga0207696_1000061184 223
169 3300025711 Ga0207696_1000079 Ga0207696_100007950 223
170 3300025728 Ga0207655_1000025 Ga0207655_1000025273 223
171 3300025728 Ga0207655_1000079 Ga0207655_100007936 223
172 3300025735 Ga0207713_1000051 Ga0207713_1000051171 223
173 3300025735 Ga0207713_1000054 Ga0207713_1000054151 223
174 3300025735 Ga0207713_1001067 Ga0207713_100106722 223
175 3300025900 Ga0207710_10000042 Ga0207710_10000042143 223
176 3300025911 Ga0207654_10000015 Ga0207654_10000015151 223
177 3300027111 Ga0209281_1000092 Ga0209281_1000092171 223
178 3300031456 Ga0307513_10018181 Ga0307513_100181814 223
179 3300031649 Ga0307514_10005246 Ga0307514_1000524610 223
180 3300041411 Ga0439466_0020545 Ga0439466_0020545_1024_1737 223
181 3300042006 Ga0439432_012128 Ga0439432_012128_90_803 223
182 3300046453 Ga0495627_000048 Ga0495627_000048_113808_114521 223
183 3300046458 Ga0495591_012727 Ga0495591_012727_26_736 223
184 3300046471 Ga0495650_0000033 Ga0495650_0000033_163392_164102 223
185 3300046474 Ga0495605_0100728 Ga0495605_0100728_82_792 223
186 3300046491 Ga0495584_0015450 Ga0495584_0015450_3048_3758 223
187 3300046501 Ga0495607_0000007 Ga0495607_0000007_226308_226991 223
188 3300046501 Ga0495607_0058311 Ga0495607_0058311_976_1686 223
189 3300046507 Ga0495606_0000408 Ga0495606_0000408_7665_8375 223
190 3300046513 Ga0495616_0029479 Ga0495616_0029479_824_1534 223
191 3300046516 Ga0495628_0002144 Ga0495628_0002144_1154_1837 223
192 3300046520 Ga0495637_0072199 Ga0495637_0072199_227_940 223
193 3300046522 Ga0495643_0154251 Ga0495643_0154251_152_862 223
194 3300046524 Ga0495648_0016390 Ga0495648_0016390_2261_2971 223
195 3300046529 Ga0495652_0073685 Ga0495652_0073685_371_1054 223
196 3300046530 Ga0495654_0000020 Ga0495654_0000020_255284_255994 223
197 3300046530 Ga0495654_0000580 Ga0495654_0000580_12485_13198 223
198 3300046648 Ga0495611_0039807 Ga0495611_0039807_473_1183 223
199 3300046679 Ga0495623_0053409 Ga0495623_0053409_1591_2274 223
200 3300046692 Ga0495671_0021315 Ga0495671_0021315_1655_2365 223
201 3300046794 Ga0495589_0000025 Ga0495589_0000025_126108_126821 223
202 3300046794 Ga0495589_0002801 Ga0495589_0002801_3152_3862 223
203 3300046810 Ga0495660_0000011 Ga0495660_0000011_251669_252379 223
204 3300047320 Ga0495672_0000004 Ga0495672_0000004_329620_330330 223
205 3300047323 Ga0495683_0022561 Ga0495683_0022561_1262_1972 223
206 3300047323 Ga0495683_0022582 Ga0495683_0022582_1264_1974 223
207 3300047469 Ga0495673_0000023 Ga0495673_0000023_247752_248462 223
208 3300048088 Ga0495602_0179727 Ga0495602_0179727_138_821 223
209 3300048919 Ga0496116_0000009 Ga0496116_0000009_148349_149062 223
210 3300048920 Ga0496117_0022467 Ga0496117_0022467_1463_2176 223
211 3300048920 Ga0496117_0051731 Ga0496117_0051731_923_1636 223
212 3300048921 Ga0496118_0005259 Ga0496118_0005259_9333_10046 223
213 3300048922 Ga0496119_0027059 Ga0496119_0027059_2453_3166 223
214 3300048923 Ga0496120_0078312 Ga0496120_0078312_354_1067 223
215 3300049459 Ga0495678_007398 Ga0495678_007398_2454_3164 223
216 3300049460 Ga0495682_0000004 Ga0495682_0000004_248862_249572 223
217 3300049570 Ga0501033_0187251 Ga0501033_0187251_374_1057 223
218 3300049573 Ga0501037_0103866 Ga0501037_0103866_304_987 223
219 3300049574 Ga0501038_0098094 Ga0501038_0098094_1369_2052 223
220 3300049822 Ga0501035_0037436 Ga0501035_0037436_630_1313 223
221 3300049823 Ga0501044_0046585 Ga0501044_0046585_3088_3771 223
222 3300053126 Ga0500621_000001 Ga0500621_000001_334114_334824 223
223 3300002704 JGI25155J39150_1000129 JGI25155J39150_100012918 224
224 3300002704 JGI25155J39150_1000250 JGI25155J39150_10002506 224
225 3300002705 JGI25156J39149_1000110 JGI25156J39149_100011015 224
226 3300002705 JGI25156J39149_1000255 JGI25156J39149_100025527 224
227 3300002705 JGI25156J39149_1013818 JGI25156J39149_10138182 224
228 3300002737 JGI25162J39368_1000036 JGI25162J39368_1000036170 224
229 3300002737 JGI25162J39368_1009106 JGI25162J39368_10091062 224
230 3300002738 JGI25154J39366_1000156 JGI25154J39366_100015618 224
231 3300002738 JGI25154J39366_1000230 JGI25154J39366_10002305 224
232 3300002741 JGI25157J39369_1000241 JGI25157J39369_100024121 224
233 3300002771 JGI25163J39215_1003490 JGI25163J39215_10034902 224
234 3300002772 JGI25164J39214_1002954 JGI25164J39214_10029542 224
235 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022190 224
236 3300003323 rootH1_10184868 rootH1_101848682 224
237 3300003751 Ga0055538_1000002 Ga0055538_1000002875 224
238 3300003751 Ga0055538_1000011 Ga0055538_1000011167 224
239 3300003752 Ga0055539_1000002 Ga0055539_1000002875 224
240 3300003752 Ga0055539_1000016 Ga0055539_1000016190 224
241 3300003756 Ga0055533_1000004 Ga0055533_1000004875 224
242 3300003756 Ga0055533_1000019 Ga0055533_1000019190 224
243 3300003758 Ga0055532_1000015 Ga0055532_1000015283 224
244 3300003759 Ga0055525_1000002 Ga0055525_1000002875 224
245 3300003759 Ga0055525_1000042 Ga0055525_1000042170 224
246 3300003761 Ga0055535_1005475 Ga0055535_10054752 224
247 3300003841 Ga0055541_1000017 Ga0055541_1000017124 224
248 3300003841 Ga0055541_1000043 Ga0055541_100004387 224
249 3300005331 Ga0070670_100033229 Ga0070670_1000332293 224
250 3300005563 Ga0068855_100000065 Ga0068855_10000006515 224
251 3300005563 Ga0068855_100003861 Ga0068855_10000386115 224
252 3300005563 Ga0068855_100041964 Ga0068855_1000419646 224
253 3300005578 Ga0068854_100425248 Ga0068854_1004252481 224
254 3300005614 Ga0068856_100021164 Ga0068856_1000211645 224
255 3300005616 Ga0068852_100005403 Ga0068852_1000054032 224
256 3300006051 Ga0075364_10035439 Ga0075364_100354393 224
257 3300006946 Ga0079104_1000037 Ga0079104_100003711 224
258 3300009011 Ga0105251_10063135 Ga0105251_100631352 224
259 3300009092 Ga0105250_10007581 Ga0105250_100075813 224
260 3300009093 Ga0105240_10003969 Ga0105240_100039697 224
261 3300009093 Ga0105240_10005768 Ga0105240_1000576817 224
262 3300009148 Ga0105243_10007340 Ga0105243_100073405 224
263 3300009545 Ga0105237_10135707 Ga0105237_101357072 224
264 3300009551 Ga0105238_10034748 Ga0105238_100347483 224
265 3300014497 Ga0182008_10138104 Ga0182008_101381042 224
266 3300014497 Ga0182008_10355180 Ga0182008_103551802 224
267 3300015261 Ga0182006_1006664 Ga0182006_10066642 224
268 3300015262 Ga0182007_10005445 Ga0182007_100054458 224
269 3300015262 Ga0182007_10010247 Ga0182007_100102472 224
270 3300015265 Ga0182005_1001639 Ga0182005_10016392 224
271 3300021361 Ga0213872_10003001 Ga0213872_100030016 224
272 3300025206 Ga0209435_100021 Ga0209435_100021135 224
273 3300025206 Ga0209435_100502 Ga0209435_1005023 224
274 3300025224 Ga0209784_100002 Ga0209784_1000021094 224
275 3300025224 Ga0209784_100019 Ga0209784_100019268 224
276 3300025225 Ga0209566_100003 Ga0209566_1000031094 224
277 3300025225 Ga0209566_100017 Ga0209566_100017268 224
278 3300025226 Ga0209674_100004 Ga0209674_1000041094 224
279 3300025226 Ga0209674_100031 Ga0209674_100031268 224
280 3300025228 Ga0209672_106251 Ga0209672_1062512 224
281 3300025229 Ga0209147_100004 Ga0209147_100004847 224
282 3300025230 Ga0209563_100006 Ga0209563_1000061094 224
283 3300025230 Ga0209563_100035 Ga0209563_100035268 224
284 3300025231 Ga0207427_100819 Ga0207427_10081914 224
285 3300025233 Ga0209437_100038 Ga0209437_100038268 224
286 3300025233 Ga0209437_100045 Ga0209437_100045193 224
287 3300025242 Ga0209258_100083 Ga0209258_10008362 224
288 3300025246 Ga0209646_1000020 Ga0209646_1000020342 224
289 3300025246 Ga0209646_1000074 Ga0209646_1000074135 224
290 3300025250 Ga0209026_1000058 Ga0209026_100005868 224
291 3300025253 Ga0209677_100003 Ga0209677_1000031094 224
292 3300025253 Ga0209677_100020 Ga0209677_100020268 224
293 3300025256 Ga0209759_1000046 Ga0209759_100004667 224
294 3300025256 Ga0209759_1000073 Ga0209759_1000073148 224
295 3300025261 Ga0209233_1000049 Ga0209233_1000049268 224
296 3300025272 Ga0209455_1003374 Ga0209455_10033742 224
297 3300025292 Ga0209676_1049409 Ga0209676_10494092 224
298 3300025298 Ga0209050_1001566 Ga0209050_100156622 224
299 3300025913 Ga0207695_10001256 Ga0207695_1000125617 224
300 3300025913 Ga0207695_10003202 Ga0207695_1000320214 224
301 3300025913 Ga0207695_10016352 Ga0207695_100163522 224
302 3300025914 Ga0207671_10036947 Ga0207671_100369472 224
303 3300025924 Ga0207694_10003828 Ga0207694_100038282 224
304 3300025924 Ga0207694_10057960 Ga0207694_100579603 224
305 3300025935 Ga0207709_10000167 Ga0207709_100001672 224
306 3300025949 Ga0207667_10000025 Ga0207667_1000002556 224
307 3300025949 Ga0207667_10455392 Ga0207667_104553921 224
308 3300025981 Ga0207640_10438669 Ga0207640_104386692 224
309 3300026078 Ga0207702_10018384 Ga0207702_100183845 224
310 3300026116 Ga0207674_10177515 Ga0207674_101775152 224
311 3300026142 Ga0207698_10031659 Ga0207698_100316593 224
312 3300027111 Ga0209281_1000002 Ga0209281_1000002795 224
313 3300031251 Ga0265327_10018399 Ga0265327_100183992 224
314 3300031911 Ga0307412_10000263 Ga0307412_1000026318 224
315 3300039447 Ga0436361_0097666 Ga0436361_0097666_17566_18243 224
316 3300039447 Ga0436361_0505039 Ga0436361_0505039_106_783 224
317 3300046454 Ga0495592_0105778 Ga0495592_0105778_694_1380 224
318 3300046462 Ga0495651_0111527 Ga0495651_0111527_1082_1768 224
319 3300046463 Ga0495653_0006090 Ga0495653_0006090_8027_8713 224
320 3300046511 Ga0495608_0038654 Ga0495608_0038654_2264_2950 224
321 3300046514 Ga0495618_0076252 Ga0495618_0076252_1210_1896 224
322 3300046516 Ga0495628_0026095 Ga0495628_0026095_1155_1841 224
323 3300046516 Ga0495628_0307920 Ga0495628_0307920_286_972 224
324 3300046529 Ga0495652_0008199 Ga0495652_0008199_3168_3893 224
325 3300046530 Ga0495654_0138663 Ga0495654_0138663_82_756 224
326 3300046543 Ga0495645_0102463 Ga0495645_0102463_500_1246 224
327 3300046660 Ga0495625_0005408 Ga0495625_0005408_2839_3513 224
328 3300046674 Ga0495588_0002145 Ga0495588_0002145_2382_3068 224
329 3300046678 Ga0495599_0052676 Ga0495599_0052676_450_1136 224
330 3300046679 Ga0495623_0069567 Ga0495623_0069567_834_1520 224
331 3300046680 Ga0495646_0000310 Ga0495646_0000310_16538_17263 224
332 3300046680 Ga0495646_0020792 Ga0495646_0020792_2919_3605 224
333 3300046690 Ga0495624_0068032 Ga0495624_0068032_1484_2209 224
334 3300046809 Ga0495600_0011464 Ga0495600_0011464_4642_5328 224
335 3300047317 Ga0495604_0073230 Ga0495604_0073230_1261_1947 224
336 3300047470 Ga0495681_0002066 Ga0495681_0002066_5323_6009 224
337 3300048088 Ga0495602_0357361 Ga0495602_0357361_113_799 224
338 3300048919 Ga0496116_0003384 Ga0496116_0003384_5717_6400 224
339 3300048919 Ga0496116_0004430 Ga0496116_0004430_831_1505 224
340 3300048919 Ga0496116_0038435 Ga0496116_0038435_1287_1970 224
341 3300048920 Ga0496117_0014437 Ga0496117_0014437_2224_2907 224
342 3300048921 Ga0496118_0013341 Ga0496118_0013341_1365_2048 224
343 3300048921 Ga0496118_0016848 Ga0496118_0016848_667_1350 224
344 3300048921 Ga0496118_0030108 Ga0496118_0030108_1838_2512 224
345 3300048922 Ga0496119_0016716 Ga0496119_0016716_1534_2217 224
346 3300048923 Ga0496120_0010017 Ga0496120_0010017_5376_6059 224
347 3300048924 Ga0496121_0002277 Ga0496121_0002277_26014_26697 224
348 3300048924 Ga0496121_0102690 Ga0496121_0102690_173_856 224
349 3300048924 Ga0496121_0168458 Ga0496121_0168458_109_783 224
350 3300048925 Ga0496122_0000021 Ga0496122_0000021_172149_172832 224
351 3300048925 Ga0496122_0000887 Ga0496122_0000887_36548_37222 224
352 3300048925 Ga0496122_0056659 Ga0496122_0056659_2168_2851 224
353 3300048926 Ga0496123_0000180 Ga0496123_0000180_36725_37399 224
354 3300048926 Ga0496123_0000426 Ga0496123_0000426_47922_48605 224
355 3300048927 Ga0496124_0162899 Ga0496124_0162899_991_1674 224
356 3300048927 Ga0496124_0339871 Ga0496124_0339871_58_741 224
357 3300048928 Ga0496125_0000005 Ga0496125_0000005_336902_337585 224
358 3300048928 Ga0496125_0003534 Ga0496125_0003534_7463_8137 224
359 3300048928 Ga0496125_0080345 Ga0496125_0080345_311_994 224
360 3300048928 Ga0496125_0096427 Ga0496125_0096427_807_1490 224
361 3300048928 Ga0496125_0307179 Ga0496125_0307179_212_886 224
362 3300048929 Ga0496126_0048672 Ga0496126_0048672_2408_3091 224
363 3300050491 nmdc:mga00v17_36909_c1 nmdc:mga00v17_36909_c1_1590_2276 224
364 3300053077 Ga0495601_0090240 Ga0495601_0090240_152_838 224
365 3300053093 Ga0500651_0006783 Ga0500651_0006783_5825_6517 224
366 3300053119 Ga0500595_008202 Ga0500595_008202_981_1667 224
367 3300053125 Ga0500618_002684 Ga0500618_002684_2794_3477 224
368 3300053125 Ga0500618_004092 Ga0500618_004092_927_1604 224
369 3300053154 Ga0500619_001472 Ga0500619_001472_3237_3923 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11010

DUF2848

Protein of unknown function (DUF2848)

46

239

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7o-assembly4.cif.gz_D crystal structure of hpce 0.7216 18 219
1nr9-assembly1.cif.gz_B crystal structure of escherichia coli 1262 (apc5008), putative isomerase 0.6889 1 218
1nr9-assembly1.cif.gz_B crystal structure of escherichia coli 1262 (apc5008), putative isomerase 0.686 1 218
3s52-assembly2.cif.gz_C crystal structure of a putative fumarylacetoacetate hydrolase family protein from yersinia pestis co92 0.6815 1 215
4dbf-assembly1.cif.gz_B crystal structures of cg1458 0.6804 11 222
ID Description Score Start End Superfamily
1gttA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7149 17 219 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7027 14 222 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.6973 16 222 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.6912 14 222 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.6886 16 222 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A0E8BUT6-F1-model_v4 Protein of uncharacterized function (DUF2848) 0.9852 119 224
AF-A0A6P1BX04-F1-model_v4 DUF2848 domain-containing protein 0.9783 44 224 GO:0003824
AF-A0A7C6NS89-F1-model_v4 DUF2848 family protein 0.9753 106 224
AF-A0A6P1BX04-F1-model_v4 DUF2848 domain-containing protein 0.973 44 224 GO:0003824
AF-S3N2F9-F1-model_v4 Uncharacterized protein 0.9687 72 224 GO:0003824

Feature Viewer

pLDDT pTM Quality
93.15 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map