metagRoot

F425114

General Info

Members	Datasets	Scaffolds	Average Seq Length
369	233	369	282

Family's Representative Sequence

Representative Sequence	3300037853\|Ga0436364_0250599\|Ga0436364_0250599_5787_6710
Length	307
Sequence	VIHAQTVVSGAANPAYLEEDPVAVAWKAAGEYSDIRYELGTGEDAGIAKITIDRPEVRNAFRPETVVELSSAFERAREDPEVGVVILTGEGPEAFCSGGDQRVRGQRGGYVTGADPAAAGAQPAVGRFHVTDLHIQIRRLPKPVVAMVAGYAIGGGHVLHVVCDLTIAAENARFGQSGPRVGSFDGGFGASVLSRLVGPKKAKEIWFLCRQYDAGEALAMGLINAVVPLERLEEETVRWCREMLALSPFALRLLKASFNADEDGLAGIQQLAHDANLLFYMSEEAQEGRDAYLQKRPPNFSQFPRRA

Samples

	Sample ID	Description	Type	Environment
1	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
2	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
3	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
4	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
5	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
6	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
7	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
8	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
9	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
10	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
11	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
12	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
13	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
14	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
15	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
16	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
17	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
18	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
19	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
20	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
21	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
22	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
23	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
24	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
25	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
26	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
27	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
28	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
29	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
30	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
31	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
32	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
33	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
34	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
35	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
36	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
37	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
38	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
39	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
40	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
41	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
42	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
43	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
44	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
45	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
46	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
47	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
48	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
49	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
50	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
51	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
52	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
53	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
54	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
55	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
56	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
57	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
58	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
59	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
60	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
61	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
62	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
63	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
64	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
65	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
66	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
67	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
68	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
69	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
70	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
90	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
92	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
93	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
94	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
95	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
96	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
97	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
98	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
99	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
100	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
101	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
102	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
103	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
104	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
105	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
106	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
107	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
108	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
109	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
110	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
111	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
112	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
113	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
114	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
115	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
116	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
117	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
118	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
119	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
120	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
121	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
122	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
123	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
124	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
125	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
126	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
127	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
128	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
129	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
130	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
131	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
132	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
133	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
134	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
135	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
136	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
137	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
138	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
139	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
140	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
141	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
142	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
143	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
144	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
145	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
146	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
147	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
148	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
149	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
150	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
151	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
152	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
153	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
154	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
155	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
156	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
157	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
158	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
159	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
160	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
161	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
162	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
163	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
164	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
165	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
166	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
167	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
168	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
169	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
170	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
171	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
172	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
173	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
174	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
175	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
176	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
177	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
178	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
179	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
180	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
181	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
182	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
183	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
184	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
185	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
186	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
187	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
188	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
189	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
190	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
191	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
192	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
193	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
194	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
195	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
196	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
197	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
198	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
204	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
205	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
206	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
207	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
208	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
209	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
210	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
212	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
213	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
214	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
216	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
218	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
219	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
220	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
221	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
222	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
223	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
224	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
225	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
226	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
227	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
228	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
229	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
230	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
231	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
232	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
233	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.73
Metatranscriptomes	0.27
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.36
Nodule	0
Rhizoplane	8.4
Rhizosphere	82.66
Stem	0
Stem Tuber	0
Unclassified	7.59

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0058863_10674867	3300004799	Bacteria	1550
2	Ga0070683_100004551	3300005329	Bacteria	11445
3	Ga0070683_100015803	3300005329	Bacteria	6636
4	Ga0070683_100088114	3300005329	Bacteria	2912
5	Ga0070683_100294244	3300005329	Bacteria	1544
6	Ga0068869_100150098	3300005334	Bacteria	1807
7	Ga0070682_100138154	3300005337	Bacteria	1658
8	Ga0070691_10068536	3300005341	Bacteria	1718
9	Ga0070691_10113305	3300005341	Bacteria	1359
10	Ga0070692_10003320	3300005345	Bacteria	6502
11	Ga0070668_100034895	3300005347	Bacteria	3834
12	Ga0070668_100072277	3300005347	Bacteria	2688
13	Ga0070659_100000132	3300005366	Bacteria	56931
14	Ga0070709_10046917	3300005434	Bacteria	2689
15	Ga0070714_100000347	3300005435	Bacteria	34714
16	Ga0070714_100002418	3300005435	Bacteria	13753
17	Ga0070714_100132708	3300005435	Bacteria	2226
18	Ga0070713_100084647	3300005436	Bacteria	2714
19	Ga0070710_10000015	3300005437	Bacteria	103891
20	Ga0070710_10014740	3300005437	Bacteria	3939
21	Ga0070710_10095251	3300005437	Bacteria	1763
22	Ga0070710_10127062	3300005437	Bacteria	1550
23	Ga0070711_100037072	3300005439	Bacteria	3270
24	Ga0070700_100021869	3300005441	Bacteria	3722
25	Ga0070663_100008569	3300005455	Bacteria	6300
26	Ga0070678_100072040	3300005456	Bacteria	2589
27	Ga0070662_100035849	3300005457	Bacteria	3506
28	Ga0070681_10116109	3300005458	Bacteria	2614
29	Ga0070699_100094654	3300005518	Bacteria	2615
30	Ga0070684_100048758	3300005535	Bacteria	3675
31	Ga0070684_100068382	3300005535	Bacteria	3122
32	Ga0070684_100231954	3300005535	Bacteria	1685
33	Ga0070693_100165586	3300005547	Bacteria	1412
34	Ga0070665_100000040	3300005548	Bacteria	305480
35	Ga0070665_100494821	3300005548	Bacteria	1234
36	Ga0070704_100175705	3300005549	Bacteria	1708
37	Ga0068855_100113572	3300005563	Bacteria	3107
38	Ga0070664_100289455	3300005564	Bacteria	1479
39	Ga0068856_100101936	3300005614	Bacteria	2863
40	Ga0068864_100226652	3300005618	Bacteria	1727
41	Ga0068858_100026062	3300005842	Bacteria	5436
42	Ga0081455_10122827	3300005937	Bacteria	2043
43	Ga0081455_10155264	3300005937	Bacteria	1760
44	Ga0081538_10003395	3300005981	Bacteria	15070
45	Ga0081538_10013512	3300005981	Bacteria	6457
46	Ga0081539_10016236	3300005985	Bacteria	5337
47	Ga0070717_10000059	3300006028	Bacteria	92958
48	Ga0075365_10348955	3300006038	Bacteria	1043
49	Ga0070715_10008623	3300006163	Bacteria	3560
50	Ga0070712_100000050	3300006175	Bacteria	63870
51	Ga0070712_100040347	3300006175	Bacteria	3200
52	Ga0070712_100143080	3300006175	Bacteria	1827
53	Ga0070712_100330395	3300006175	Bacteria	1242
54	Ga0075430_100019700	3300006846	Bacteria	5740
55	Ga0075431_100042244	3300006847	Bacteria	4701
56	Ga0075431_100399942	3300006847	Bacteria	1375
57	Ga0075433_10078501	3300006852	Bacteria	2909
58	Ga0075434_100004527	3300006871	Bacteria	12547
59	Ga0075434_100196727	3300006871	Bacteria	2036
60	Ga0075429_100010346	3300006880	Bacteria	8071
61	Ga0075436_100037588	3300006914	Bacteria	3342
62	Ga0075435_100176965	3300007076	Bacteria	1802
63	Ga0105251_10095823	3300009011	Bacteria	1360
64	Ga0105240_10027031	3300009093	Bacteria	7521
65	Ga0105245_10365285	3300009098	Bacteria	1433
66	Ga0105248_10250706	3300009177	Bacteria	1993
67	Ga0105237_10189492	3300009545	Bacteria	2057
68	Ga0105238_10387136	3300009551	Bacteria	1390
69	Ga0105239_10103257	3300010375	Bacteria	3155
70	Ga0105246_10027129	3300011119	Bacteria	3750
71	Ga0157369_10350987	3300013105	Bacteria	1532
72	Ga0163162_10027867	3300013306	Bacteria	5588
73	Ga0157372_10275853	3300013307	Bacteria	1954
74	Ga0157375_10033314	3300013308	Bacteria	4894
75	Ga0163163_10303122	3300014325	Bacteria	1650
76	Ga0182008_10185538	3300014497	Bacteria	1054
77	Ga0157377_10002900	3300014745	Bacteria	7668
78	Ga0157379_10013412	3300014968	Bacteria	7179
79	Ga0213873_10013873	3300021358	Bacteria	1776
80	Ga0213876_10005199	3300021384	Bacteria	7176
81	Ga0213876_10018007	3300021384	Bacteria	3727
82	Ga0213876_10065246	3300021384	Bacteria	1921
83	Ga0213875_10048591	3300021388	Bacteria	1990
84	Ga0213875_10091217	3300021388	Bacteria	1421
85	Ga0207692_10000013	3300025898	Bacteria	103819
86	Ga0207692_10019158	3300025898	Bacteria	3087
87	Ga0207692_10091174	3300025898	Bacteria	1653
88	Ga0207692_10129247	3300025898	Bacteria	1424
89	Ga0207688_10002493	3300025901	Bacteria	9908
90	Ga0207699_10039268	3300025906	Bacteria	2718
91	Ga0207707_10113112	3300025912	Bacteria	2373
92	Ga0207693_10000151	3300025915	Bacteria	64033
93	Ga0207693_10049338	3300025915	Bacteria	3305
94	Ga0207663_10035548	3300025916	Bacteria	2990
95	Ga0207663_10035984	3300025916	Bacteria	2975
96	Ga0207662_10167460	3300025918	Bacteria	1408
97	Ga0207657_10209330	3300025919	Bacteria	1565
98	Ga0207652_10007274	3300025921	Bacteria	8920
99	Ga0207646_10477874	3300025922	Bacteria	1124
100	Ga0207687_10119106	3300025927	Bacteria	1972
101	Ga0207700_10131762	3300025928	Bacteria	2042
102	Ga0207664_10000310	3300025929	Bacteria	36142
103	Ga0207664_10001964	3300025929	Bacteria	13548
104	Ga0207664_10014367	3300025929	Bacteria	5716
105	Ga0207664_10028001	3300025929	Bacteria	4279
106	Ga0207664_10069413	3300025929	Bacteria	2834
107	Ga0207664_10263500	3300025929	Bacteria	1508
108	Ga0207690_10000075	3300025932	Bacteria	85885
109	Ga0207690_10109472	3300025932	Bacteria	1987
110	Ga0207706_10049496	3300025933	Bacteria	3714
111	Ga0207665_10016164	3300025939	Bacteria	4899
112	Ga0207711_10440998	3300025941	Bacteria	1212
113	Ga0207689_10013224	3300025942	Bacteria	7042
114	Ga0207668_10042653	3300025972	Bacteria	3074
115	Ga0207703_10000166	3300026035	Bacteria	76553
116	Ga0207703_10093514	3300026035	Bacteria	2532
117	Ga0207703_10421667	3300026035	Bacteria	1242
118	Ga0207678_10005456	3300026067	Bacteria	11373
119	Ga0207708_10001416	3300026075	Bacteria	17970
120	Ga0207702_10109744	3300026078	Bacteria	2450
121	Ga0207641_10127159	3300026088	Bacteria	2283
122	Ga0207676_10067278	3300026095	Bacteria	2861
123	Ga0207674_10088892	3300026116	Bacteria	3082
124	Ga0207674_10123323	3300026116	Bacteria	2557
125	Ga0207683_10410156	3300026121	Bacteria	1247
126	Ga0207428_10382853	3300027907	Bacteria	1032
127	Ga0268266_10000045	3300028379	Bacteria	312955
128	Ga0268266_10335552	3300028379	Bacteria	1418
129	Ga0265337_1000954	3300028556	Bacteria	15130
130	Ga0265326_10000023	3300028558	Bacteria	113142
131	Ga0265319_1001026	3300028563	Bacteria	17473
132	Ga0265319_1001094	3300028563	Bacteria	16853
133	Ga0265334_10000135	3300028573	Bacteria	46602
134	Ga0265318_10011540	3300028577	Bacteria	3798
135	Ga0265336_10000005	3300028666	Bacteria	399349
136	Ga0265336_10002256	3300028666	Bacteria	8084
137	Ga0265338_10000832	3300028800	Bacteria	52060
138	Ga0265338_10000902	3300028800	Bacteria	49948
139	Ga0265338_10020680	3300028800	Bacteria	6907
140	Ga0265338_10056552	3300028800	Bacteria	3478
141	Ga0265324_10002430	3300029957	Bacteria	9559
142	Ga0265324_10006008	3300029957	Bacteria	5139
143	Ga0265340_10000001	3300031247	Bacteria	1647668
144	Ga0265339_10028100	3300031249	Bacteria	3202
145	Ga0265327_10079083	3300031251	Bacteria	1628
146	Ga0265316_10054388	3300031344	Bacteria	3134
147	Ga0265314_10217425	3300031711	Bacteria	1118
148	Ga0265342_10086229	3300031712	Bacteria	1805
149	Ga0307405_10009291	3300031731	Bacteria	5033
150	Ga0307405_10187688	3300031731	Bacteria	1490
151	Ga0307413_10025059	3300031824	Bacteria	3263
152	Ga0307413_10453566	3300031824	Bacteria	1018
153	Ga0307410_10266056	3300031852	Bacteria	1339
154	Ga0307407_10014350	3300031903	Bacteria	3877
155	Ga0307407_10114195	3300031903	Bacteria	1701
156	Ga0307409_100047833	3300031995	Bacteria	3250
157	Ga0307409_100625134	3300031995	Bacteria	1067
158	Ga0307416_100139353	3300032002	Bacteria	2201
159	Ga0307416_100551677	3300032002	Bacteria	1226
160	Ga0307411_10067417	3300032005	Bacteria	2408
161	Ga0307411_10182929	3300032005	Bacteria	1593
162	Ga0307415_100106681	3300032126	Bacteria	2068
163	Ga0373934_0023048	3300035086	Bacteria	2405
164	Ga0373944_0025750	3300035089	Bacteria	1734
165	Ga0373945_0089105	3300035116	Bacteria	1192
166	Ga0373956_0022064	3300035119	Bacteria	2721
167	Ga0373946_0050375	3300035171	Bacteria	1739
168	Ga0373955_0131997	3300035172	Bacteria	1458
169	Ga0373924_0079917	3300035410	Bacteria	1389
170	Ga0373933_0053793	3300035724	Bacteria	2411
171	Ga0373947_0023466	3300035725	Bacteria	3588
172	Ga0373937_0168022	3300036401	Bacteria	2057
173	Ga0373925_0149587	3300037068	Bacteria	1832
174	Ga0395898_0203067	3300037466	Bacteria	1892
175	Ga0436364_0139383	3300037853	Bacteria	1562
176	Ga0436364_0237688	3300037853	Bacteria	9977
177	Ga0436364_0250599	3300037853	Bacteria	7151
178	Ga0436364_0253679	3300037853	Bacteria	41160
179	Ga0436364_0445774	3300037853	Bacteria	40627
180	Ga0436364_0660713	3300037853	Bacteria	934
181	Ga0436364_0731334	3300037853	Bacteria	4558
182	Ga0436364_0826917	3300037853	Bacteria	3225
183	Ga0436364_0951097	3300037853	Bacteria	1306
184	Ga0436364_1070108	3300037853	Bacteria	933
185	Ga0395901_0304890	3300038443	Bacteria	1651
186	Ga0395901_0634512	3300038443	Bacteria	1074
187	Ga0436365_0265252	3300039437	Bacteria	11939
188	Ga0436365_0485793	3300039437	Bacteria	6881
189	Ga0436365_0605143	3300039437	Bacteria	8631
190	Ga0436365_0672875	3300039437	Bacteria	2453
191	Ga0436365_0782833	3300039437	Bacteria	6807
192	Ga0436365_1122560	3300039437	Bacteria	1791
193	Ga0436365_1188153	3300039437	Bacteria	27546
194	Ga0436365_1362313	3300039437	Bacteria	4781
195	Ga0436363_0983181	3300039450	Bacteria	38641
196	Ga0436363_1111979	3300039450	Bacteria	4350
197	Ga0436363_1147919	3300039450	Bacteria	11712
198	Ga0436362_0029475	3300039453	Bacteria	2997
199	Ga0436362_0080575	3300039453	Bacteria	1885
200	Ga0451853_0327660	3300041512	Bacteria	2461
201	Ga0466969_0146535	3300044656	Bacteria	1089
202	Ga0466966_0018082	3300044684	Bacteria	4653
203	Ga0466957_0298877	3300044842	Bacteria	1081
204	Ga0466960_0211245	3300044901	Bacteria	1064
205	Ga0466959_0080970	3300045049	Bacteria	2340
206	Ga0466959_0230113	3300045049	Bacteria	1283
207	Ga0466958_0012219	3300045836	Bacteria	4858
208	Ga0466967_0019586	3300045976	Bacteria	5446
209	Ga0466967_0129704	3300045976	Bacteria	2339
210	Ga0466967_0169348	3300045976	Bacteria	2054
211	Ga0466967_0257038	3300045976	Bacteria	1670
212	Ga0466967_0296995	3300045976	Bacteria	1553
213	Ga0466967_0414056	3300045976	Bacteria	1313
214	Ga0495592_0001378	3300046454	Bacteria	16804
215	Ga0495592_0002543	3300046454	Bacteria	12874
216	Ga0495592_0134349	3300046454	Bacteria	1727
217	Ga0495629_0153193	3300046459	Bacteria	1602
218	Ga0495641_0086762	3300046461	Bacteria	1400
219	Ga0495653_0010614	3300046463	Bacteria	7539
220	Ga0495662_0000133	3300046476	Bacteria	28271
221	Ga0495664_0034933	3300046477	Bacteria	2958
222	Ga0495608_0006223	3300046511	Bacteria	8470
223	Ga0495620_0000682	3300046515	Bacteria	21009
224	Ga0495628_0017004	3300046516	Bacteria	6060
225	Ga0495630_0073232	3300046517	Bacteria	2579
226	Ga0495644_0003632	3300046523	Bacteria	6079
227	Ga0495666_0018184	3300046526	Bacteria	3501
228	Ga0495640_0128911	3300046533	Bacteria	1638
229	Ga0495587_0004725	3300046536	Bacteria	8938
230	Ga0495667_0003180	3300046559	Bacteria	11011
231	Ga0495656_0161361	3300046615	Bacteria	1090
232	Ga0495635_0000005	3300046663	Bacteria	302178
233	Ga0495635_0005252	3300046663	Bacteria	9009
234	Ga0495588_0128108	3300046674	Bacteria	1339
235	Ga0495657_0006179	3300046675	Bacteria	9390
236	Ga0495599_0003333	3300046678	Bacteria	9379
237	Ga0495623_0100811	3300046679	Bacteria	1759
238	Ga0495646_0010257	3300046680	Bacteria	5958
239	Ga0495658_0087910	3300046683	Bacteria	1836
240	Ga0495624_0061799	3300046690	Bacteria	2345
241	Ga0495600_0005476	3300046809	Bacteria	7656
242	Ga0495600_0027329	3300046809	Bacteria	3686
243	Ga0495581_0121451	3300047315	Bacteria	1520
244	Ga0495604_0001647	3300047317	Bacteria	18361
245	Ga0495604_0025165	3300047317	Bacteria	4742
246	Ga0495674_0026841	3300047319	Bacteria	5267
247	Ga0495672_0058107	3300047320	Bacteria	2244
248	Ga0495676_0363054	3300047321	Bacteria	966
249	Ga0495680_0006957	3300047322	Bacteria	10437
250	Ga0495675_0011751	3300047444	Bacteria	5500
251	Ga0495685_008000	3300047447	Bacteria	3503
252	Ga0495684_0004091	3300047471	Bacteria	11391
253	Ga0496100_0006088	3300048903	Bacteria	6557
254	Ga0496100_0011675	3300048903	Bacteria	5006
255	Ga0496101_0000900	3300048904	Bacteria	17487
256	Ga0496102_0000053	3300048905	Bacteria	176385
257	Ga0496102_0125857	3300048905	Bacteria	2395
258	Ga0496103_0000162	3300048906	Bacteria	70675
259	Ga0496104_0040696	3300048907	Bacteria	4357
260	Ga0496104_0062466	3300048907	Bacteria	3531
261	Ga0496105_0016914	3300048908	Bacteria	5836
262	Ga0496106_0070588	3300048909	Bacteria	2668
263	Ga0496106_0091990	3300048909	Bacteria	2342
264	Ga0496107_0001976	3300048910	Bacteria	13047
265	Ga0496108_0027348	3300048911	Bacteria	4709
266	Ga0496108_0035705	3300048911	Bacteria	4133
267	Ga0496108_0264674	3300048911	Bacteria	1496
268	Ga0496109_0001482	3300048912	Bacteria	19487
269	Ga0496109_0011976	3300048912	Bacteria	7469
270	Ga0496110_0009901	3300048913	Bacteria	7729
271	Ga0496110_0054589	3300048913	Bacteria	3514
272	Ga0496110_0539171	3300048913	Bacteria	1061
273	Ga0496111_0067804	3300048914	Bacteria	2592
274	Ga0496111_0153087	3300048914	Bacteria	1711
275	Ga0496112_0000308	3300048915	Bacteria	31586
276	Ga0496112_0122310	3300048915	Bacteria	2573
277	Ga0496112_0527293	3300048915	Bacteria	1115
278	Ga0496113_0106359	3300048916	Bacteria	2179
279	Ga0496113_0214333	3300048916	Bacteria	1533
280	Ga0496114_0430421	3300048917	Bacteria	1169
281	Ga0496115_0000064	3300048918	Bacteria	99309
282	Ga0496115_0182702	3300048918	Bacteria	1733
283	Ga0496115_0366748	3300048918	Bacteria	1173
284	Ga0496124_0081088	3300048927	Bacteria	2668
285	Ga0501291_009576	3300049514	Bacteria	1361
286	Ga0501031_0004414	3300049568	Bacteria	9116
287	Ga0501031_0041408	3300049568	Bacteria	3007
288	Ga0501032_0005864	3300049569	Bacteria	9085
289	Ga0501032_0024908	3300049569	Bacteria	4128
290	Ga0501033_0006358	3300049570	Bacteria	9257
291	Ga0501033_0007366	3300049570	Bacteria	8568
292	Ga0501034_0010877	3300049571	Bacteria	9452
293	Ga0501034_0062693	3300049571	Bacteria	3734
294	Ga0501036_0033960	3300049572	Bacteria	4314
295	Ga0501037_0012793	3300049573	Bacteria	6183
296	Ga0501037_0067197	3300049573	Bacteria	2610
297	Ga0501038_0046656	3300049574	Bacteria	3755
298	Ga0501038_0062765	3300049574	Bacteria	3173
299	Ga0501039_0041376	3300049575	Bacteria	3559
300	Ga0501042_0021057	3300049578	Bacteria	4541
301	Ga0501042_0081775	3300049578	Bacteria	2315
302	Ga0501043_0006837	3300049579	Bacteria	9105
303	Ga0501043_0177269	3300049579	Bacteria	1661
304	Ga0501046_0008257	3300049580	Bacteria	9091
305	Ga0501046_0020691	3300049580	Bacteria	5439
306	Ga0501047_0001820	3300049581	Bacteria	20607
307	Ga0501047_0008972	3300049581	Bacteria	9441
308	Ga0501047_0135944	3300049581	Bacteria	2338
309	Ga0501047_0437010	3300049581	Bacteria	1139
310	Ga0501048_0006225	3300049582	Bacteria	9077
311	Ga0501048_0092320	3300049582	Bacteria	2135
312	Ga0501048_0104450	3300049582	Bacteria	1999
313	Ga0501067_0021563	3300049583	Bacteria	3565
314	Ga0501068_0101970	3300049584	Bacteria	1779
315	Ga0501069_0002861	3300049585	Bacteria	8846
316	Ga0501069_0003238	3300049585	Bacteria	8349
317	Ga0501069_0079785	3300049585	Bacteria	1842
318	Ga0501069_0217555	3300049585	Bacteria	1109
319	Ga0501070_0001586	3300049586	Bacteria	20190
320	Ga0501070_0003017	3300049586	Bacteria	14659
321	Ga0501070_0192023	3300049586	Bacteria	1678
322	Ga0501073_0006102	3300049589	Bacteria	8993
323	Ga0501074_0037001	3300049590	Bacteria	3537
324	Ga0501075_0005540	3300049591	Bacteria	8641
325	Ga0501075_0164338	3300049591	Bacteria	1693
326	Ga0501076_0094952	3300049592	Bacteria	2401
327	Ga0501079_0043587	3300049741	Bacteria	3463
328	Ga0501079_0058945	3300049741	Bacteria	2962
329	Ga0501079_0295297	3300049741	Bacteria	1267
330	Ga0501080_0020071	3300049742	Bacteria	6185
331	Ga0501080_0061677	3300049742	Bacteria	3490
332	Ga0501080_0100572	3300049742	Bacteria	2682
333	Ga0501083_0005372	3300049744	Bacteria	9064
334	Ga0501083_0014897	3300049744	Bacteria	5438
335	Ga0501035_0002000	3300049822	Bacteria	20369
336	Ga0501035_0046669	3300049822	Bacteria	3896
337	Ga0501044_0011407	3300049823	Bacteria	9625
338	Ga0501044_0096997	3300049823	Bacteria	2969
339	Ga0501044_0157183	3300049823	Bacteria	2252
340	Ga0501045_0048802	3300049824	Bacteria	3086
341	Ga0501045_0089901	3300049824	Bacteria	2268
342	nmdc:mga0yw44_319079_c1	3300050492	Bacteria	1043
343	nmdc:mga09592_14146_c1	3300050508	Bacteria	6511
344	nmdc:mga0qj67_3250_c1	3300050509	Bacteria	11704
345	nmdc:mga06r32_469836_c1	3300050510	Bacteria	1236
346	nmdc:mga06r32_67948_c1	3300050510	Bacteria	3442
347	nmdc:mga08y16_744352_c1	3300050511	Bacteria	977
348	nmdc:mga0n895_119543_c1	3300050512	Bacteria	2656
349	nmdc:mga0rr50_171657_c1	3300050513	Bacteria	1767
350	Ga0495601_0191488	3300053077	Bacteria	1336
351	Ga0495612_0001111	3300053078	Bacteria	11021
352	Ga0495655_0006908	3300053083	Bacteria	2087
353	Ga0495595_0004524	3300053084	Bacteria	5595
354	Ga0495595_0076136	3300053084	Bacteria	1592
355	Ga0495619_0000602	3300053085	Bacteria	23838
356	Ga0495619_0004168	3300053085	Bacteria	9235
357	Ga0495619_0216655	3300053085	Bacteria	1326
358	Ga0495619_0262007	3300053085	Bacteria	1198
359	Ga0495619_0285593	3300053085	Bacteria	1143
360	Ga0500556_0000244	3300053104	Bacteria	44183
361	Ga0500616_0014312	3300053153	Bacteria	4563
362	Ga0500616_0129428	3300053153	Bacteria	1194
363	Ga0501082_0010059	3300060353	Bacteria	8152
364	Ga0501082_0047324	3300060353	Bacteria	3706
365	Ga0501082_0303904	3300060353	Bacteria	1389
366	Ga0466962_0047549	3300061719	Bacteria	2050
367	Ga0466962_0202865	3300061719	Bacteria	969
368	Ga0530510_0024998	3300061734	Bacteria	4269
369	Ga0530510_0595285	3300061734	Bacteria	841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300061734	Ga0530510_0595285	Ga0530510_0595285_14_754	246
2	3300037853	Ga0436364_0237688	Ga0436364_0237688_5118_5975	261
3	3300031824	Ga0307413_10453566	Ga0307413_104535661	265
4	3300005329	Ga0070683_100294244	Ga0070683_1002942442	269
5	3300005345	Ga0070692_10003320	Ga0070692_100033202	269
6	3300005535	Ga0070684_100068382	Ga0070684_1000683822	269
7	3300005535	Ga0070684_100231954	Ga0070684_1002319542	269
8	3300006175	Ga0070712_100040347	Ga0070712_1000403473	269
9	3300025919	Ga0207657_10209330	Ga0207657_102093302	269
10	3300026121	Ga0207683_10410156	Ga0207683_104101562	269
11	3300032005	Ga0307411_10182929	Ga0307411_101829292	269
12	3300038443	Ga0395901_0304890	Ga0395901_0304890_20_838	269
13	3300045049	Ga0466959_0080970	Ga0466959_0080970_94_915	269
14	3300045976	Ga0466967_0169348	Ga0466967_0169348_300_1118	269
15	3300045976	Ga0466967_0414056	Ga0466967_0414056_155_976	269
16	3300047320	Ga0495672_0058107	Ga0495672_0058107_1010_1834	269
17	3300048927	Ga0496124_0081088	Ga0496124_0081088_221_1042	269
18	3300053153	Ga0500616_0129428	Ga0500616_0129428_305_1123	269
19	3300005547	Ga0070693_100165586	Ga0070693_1001655862	270
20	3300005981	Ga0081538_10013512	Ga0081538_100135126	270
21	3300006847	Ga0075431_100399942	Ga0075431_1003999422	270
22	3300026116	Ga0207674_10088892	Ga0207674_100888923	270
23	3300037853	Ga0436364_0139383	Ga0436364_0139383_647_1501	270
24	3300039437	Ga0436365_0672875	Ga0436365_0672875_1161_2015	270
25	3300048911	Ga0496108_0264674	Ga0496108_0264674_216_1046	270
26	3300048912	Ga0496109_0001482	Ga0496109_0001482_5932_6762	270
27	3300048913	Ga0496110_0539171	Ga0496110_0539171_31_861	270
28	3300049591	Ga0501075_0164338	Ga0501075_0164338_749_1636	270
29	3300049824	Ga0501045_0048802	Ga0501045_0048802_2120_3007	270
30	3300050510	nmdc:mga06r32_469836_c1	nmdc:mga06r32_469836_c1_195_1040	270
31	3300060353	Ga0501082_0303904	Ga0501082_0303904_192_1079	270
32	3300061734	Ga0530510_0024998	Ga0530510_0024998_1778_2665	270
33	3300005366	Ga0070659_100000132	Ga0070659_10000013223	271
34	3300005435	Ga0070714_100000347	Ga0070714_10000034722	271
35	3300005435	Ga0070714_100002418	Ga0070714_1000024186	271
36	3300005435	Ga0070714_100132708	Ga0070714_1001327082	271
37	3300005437	Ga0070710_10000015	Ga0070710_1000001522	271
38	3300005564	Ga0070664_100289455	Ga0070664_1002894552	271
39	3300005937	Ga0081455_10122827	Ga0081455_101228271	271
40	3300006028	Ga0070717_10000059	Ga0070717_1000005961	271
41	3300006880	Ga0075429_100010346	Ga0075429_1000103464	271
42	3300009093	Ga0105240_10027031	Ga0105240_100270316	271
43	3300011119	Ga0105246_10027129	Ga0105246_100271294	271
44	3300014497	Ga0182008_10185538	Ga0182008_101855381	271
45	3300025898	Ga0207692_10000013	Ga0207692_1000001377	271
46	3300025918	Ga0207662_10167460	Ga0207662_101674602	271
47	3300025929	Ga0207664_10000310	Ga0207664_1000031022	271
48	3300025929	Ga0207664_10001964	Ga0207664_1000196410	271
49	3300025929	Ga0207664_10263500	Ga0207664_102635002	271
50	3300025932	Ga0207690_10000075	Ga0207690_100000752	271
51	3300028379	Ga0268266_10335552	Ga0268266_103355522	271
52	3300028558	Ga0265326_10000023	Ga0265326_1000002368	271
53	3300028563	Ga0265319_1001026	Ga0265319_100102617	271
54	3300028573	Ga0265334_10000135	Ga0265334_1000013520	271
55	3300028666	Ga0265336_10002256	Ga0265336_100022566	271
56	3300028800	Ga0265338_10000902	Ga0265338_1000090225	271
57	3300028800	Ga0265338_10056552	Ga0265338_100565522	271
58	3300029957	Ga0265324_10002430	Ga0265324_100024306	271
59	3300031711	Ga0265314_10217425	Ga0265314_102174252	271
60	3300031731	Ga0307405_10009291	Ga0307405_100092915	271
61	3300031824	Ga0307413_10025059	Ga0307413_100250593	271
62	3300031903	Ga0307407_10014350	Ga0307407_100143502	271
63	3300031995	Ga0307409_100047833	Ga0307409_1000478333	271
64	3300032002	Ga0307416_100139353	Ga0307416_1001393532	271
65	3300032002	Ga0307416_100551677	Ga0307416_1005516771	271
66	3300032005	Ga0307411_10067417	Ga0307411_100674172	271
67	3300032126	Ga0307415_100106681	Ga0307415_1001066812	271
68	3300035116	Ga0373945_0089105	Ga0373945_0089105_302_1177	271
69	3300038443	Ga0395901_0634512	Ga0395901_0634512_199_1026	271
70	3300044842	Ga0466957_0298877	Ga0466957_0298877_55_879	271
71	3300044901	Ga0466960_0211245	Ga0466960_0211245_180_1037	271
72	3300045976	Ga0466967_0129704	Ga0466967_0129704_35_859	271
73	3300045976	Ga0466967_0296995	Ga0466967_0296995_552_1376	271
74	3300049514	Ga0501291_009576	Ga0501291_009576_206_1054	271
75	3300049568	Ga0501031_0004414	Ga0501031_0004414_7912_8769	271
76	3300049569	Ga0501032_0005864	Ga0501032_0005864_7902_8759	271
77	3300049570	Ga0501033_0006358	Ga0501033_0006358_8046_8903	271
78	3300049571	Ga0501034_0010877	Ga0501034_0010877_355_1212	271
79	3300049571	Ga0501034_0062693	Ga0501034_0062693_1526_2383	271
80	3300049573	Ga0501037_0067197	Ga0501037_0067197_1427_2284	271
81	3300049574	Ga0501038_0046656	Ga0501038_0046656_2544_3401	271
82	3300049575	Ga0501039_0041376	Ga0501039_0041376_353_1210	271
83	3300049578	Ga0501042_0081775	Ga0501042_0081775_34_891	271
84	3300049579	Ga0501043_0006837	Ga0501043_0006837_355_1212	271
85	3300049580	Ga0501046_0008257	Ga0501046_0008257_327_1184	271
86	3300049581	Ga0501047_0001820	Ga0501047_0001820_9082_9927	271
87	3300049581	Ga0501047_0008972	Ga0501047_0008972_355_1212	271
88	3300049581	Ga0501047_0437010	Ga0501047_0437010_134_979	271
89	3300049582	Ga0501048_0006225	Ga0501048_0006225_7881_8738	271
90	3300049583	Ga0501067_0021563	Ga0501067_0021563_2433_3302	271
91	3300049585	Ga0501069_0003238	Ga0501069_0003238_355_1212	271
92	3300049586	Ga0501070_0001586	Ga0501070_0001586_18979_19836	271
93	3300049586	Ga0501070_0192023	Ga0501070_0192023_402_1247	271
94	3300049589	Ga0501073_0006102	Ga0501073_0006102_7808_8665	271
95	3300049590	Ga0501074_0037001	Ga0501074_0037001_2354_3211	271
96	3300049741	Ga0501079_0043587	Ga0501079_0043587_2259_3116	271
97	3300049742	Ga0501080_0020071	Ga0501080_0020071_285_1142	271
98	3300049744	Ga0501083_0005372	Ga0501083_0005372_322_1179	271
99	3300049822	Ga0501035_0002000	Ga0501035_0002000_355_1212	271
100	3300049823	Ga0501044_0011407	Ga0501044_0011407_8414_9271	271
101	3300049823	Ga0501044_0157183	Ga0501044_0157183_1137_1982	271
102	3300049824	Ga0501045_0089901	Ga0501045_0089901_1165_2022	271
103	3300050508	nmdc:mga09592_14146_c1	nmdc:mga09592_14146_c1_3918_4745	271
104	3300060353	Ga0501082_0010059	Ga0501082_0010059_6942_7799	271
105	3300061719	Ga0466962_0202865	Ga0466962_0202865_11_835	271
106	3300004799	Ga0058863_10674867	Ga0058863_106748672	272
107	3300005329	Ga0070683_100004551	Ga0070683_1000045519	272
108	3300005329	Ga0070683_100015803	Ga0070683_1000158032	272
109	3300005329	Ga0070683_100088114	Ga0070683_1000881143	272
110	3300005334	Ga0068869_100150098	Ga0068869_1001500982	272
111	3300005337	Ga0070682_100138154	Ga0070682_1001381542	272
112	3300005341	Ga0070691_10068536	Ga0070691_100685362	272
113	3300005341	Ga0070691_10113305	Ga0070691_101133052	272
114	3300005347	Ga0070668_100034895	Ga0070668_1000348952	272
115	3300005347	Ga0070668_100072277	Ga0070668_1000722773	272
116	3300005434	Ga0070709_10046917	Ga0070709_100469173	272
117	3300005436	Ga0070713_100084647	Ga0070713_1000846473	272
118	3300005437	Ga0070710_10014740	Ga0070710_100147403	272
119	3300005437	Ga0070710_10095251	Ga0070710_100952512	272
120	3300005437	Ga0070710_10127062	Ga0070710_101270622	272
121	3300005439	Ga0070711_100037072	Ga0070711_1000370723	272
122	3300005441	Ga0070700_100021869	Ga0070700_1000218694	272
123	3300005455	Ga0070663_100008569	Ga0070663_1000085691	272
124	3300005456	Ga0070678_100072040	Ga0070678_1000720403	272
125	3300005457	Ga0070662_100035849	Ga0070662_1000358494	272
126	3300005458	Ga0070681_10116109	Ga0070681_101161092	272
127	3300005518	Ga0070699_100094654	Ga0070699_1000946542	272
128	3300005535	Ga0070684_100048758	Ga0070684_1000487582	272
129	3300005548	Ga0070665_100000040	Ga0070665_10000004029	272
130	3300005548	Ga0070665_100494821	Ga0070665_1004948211	272
131	3300005549	Ga0070704_100175705	Ga0070704_1001757052	272
132	3300005563	Ga0068855_100113572	Ga0068855_1001135723	272
133	3300005614	Ga0068856_100101936	Ga0068856_1001019363	272
134	3300005618	Ga0068864_100226652	Ga0068864_1002266523	272
135	3300005842	Ga0068858_100026062	Ga0068858_1000260622	272
136	3300005937	Ga0081455_10155264	Ga0081455_101552642	272
137	3300005981	Ga0081538_10003395	Ga0081538_1000339511	272
138	3300005985	Ga0081539_10016236	Ga0081539_100162365	272
139	3300006038	Ga0075365_10348955	Ga0075365_103489551	272
140	3300006163	Ga0070715_10008623	Ga0070715_100086233	272
141	3300006175	Ga0070712_100000050	Ga0070712_10000005027	272
142	3300006175	Ga0070712_100143080	Ga0070712_1001430803	272
143	3300006175	Ga0070712_100330395	Ga0070712_1003303952	272
144	3300006846	Ga0075430_100019700	Ga0075430_1000197004	272
145	3300006847	Ga0075431_100042244	Ga0075431_1000422442	272
146	3300006852	Ga0075433_10078501	Ga0075433_100785012	272
147	3300006871	Ga0075434_100004527	Ga0075434_1000045276	272
148	3300006871	Ga0075434_100196727	Ga0075434_1001967272	272
149	3300006914	Ga0075436_100037588	Ga0075436_1000375882	272
150	3300007076	Ga0075435_100176965	Ga0075435_1001769652	272
151	3300009011	Ga0105251_10095823	Ga0105251_100958232	272
152	3300009098	Ga0105245_10365285	Ga0105245_103652852	272
153	3300009177	Ga0105248_10250706	Ga0105248_102507061	272
154	3300009545	Ga0105237_10189492	Ga0105237_101894923	272
155	3300009551	Ga0105238_10387136	Ga0105238_103871362	272
156	3300010375	Ga0105239_10103257	Ga0105239_101032573	272
157	3300013105	Ga0157369_10350987	Ga0157369_103509872	272
158	3300013306	Ga0163162_10027867	Ga0163162_100278677	272
159	3300013307	Ga0157372_10275853	Ga0157372_102758532	272
160	3300013308	Ga0157375_10033314	Ga0157375_100333143	272
161	3300014325	Ga0163163_10303122	Ga0163163_103031222	272
162	3300014745	Ga0157377_10002900	Ga0157377_100029004	272
163	3300014968	Ga0157379_10013412	Ga0157379_100134126	272
164	3300021358	Ga0213873_10013873	Ga0213873_100138732	272
165	3300021384	Ga0213876_10005199	Ga0213876_100051992	272
166	3300021384	Ga0213876_10018007	Ga0213876_100180074	272
167	3300021384	Ga0213876_10065246	Ga0213876_100652462	272
168	3300021388	Ga0213875_10048591	Ga0213875_100485912	272
169	3300021388	Ga0213875_10091217	Ga0213875_100912171	272
170	3300025898	Ga0207692_10019158	Ga0207692_100191582	272
171	3300025898	Ga0207692_10091174	Ga0207692_100911742	272
172	3300025898	Ga0207692_10129247	Ga0207692_101292472	272
173	3300025901	Ga0207688_10002493	Ga0207688_100024938	272
174	3300025906	Ga0207699_10039268	Ga0207699_100392683	272
175	3300025912	Ga0207707_10113112	Ga0207707_101131124	272
176	3300025915	Ga0207693_10000151	Ga0207693_1000015126	272
177	3300025915	Ga0207693_10049338	Ga0207693_100493383	272
178	3300025916	Ga0207663_10035548	Ga0207663_100355482	272
179	3300025916	Ga0207663_10035984	Ga0207663_100359842	272
180	3300025921	Ga0207652_10007274	Ga0207652_100072748	272
181	3300025922	Ga0207646_10477874	Ga0207646_104778741	272
182	3300025927	Ga0207687_10119106	Ga0207687_101191062	272
183	3300025928	Ga0207700_10131762	Ga0207700_101317622	272
184	3300025929	Ga0207664_10014367	Ga0207664_100143673	272
185	3300025929	Ga0207664_10028001	Ga0207664_100280014	272
186	3300025929	Ga0207664_10069413	Ga0207664_100694132	272
187	3300025932	Ga0207690_10109472	Ga0207690_101094722	272
188	3300025933	Ga0207706_10049496	Ga0207706_100494962	272
189	3300025939	Ga0207665_10016164	Ga0207665_100161642	272
190	3300025941	Ga0207711_10440998	Ga0207711_104409981	272
191	3300025942	Ga0207689_10013224	Ga0207689_100132245	272
192	3300025972	Ga0207668_10042653	Ga0207668_100426532	272
193	3300026035	Ga0207703_10000166	Ga0207703_1000016649	272
194	3300026035	Ga0207703_10093514	Ga0207703_100935142	272
195	3300026035	Ga0207703_10421667	Ga0207703_104216671	272
196	3300026067	Ga0207678_10005456	Ga0207678_100054568	272
197	3300026075	Ga0207708_10001416	Ga0207708_100014166	272
198	3300026078	Ga0207702_10109744	Ga0207702_101097442	272
199	3300026088	Ga0207641_10127159	Ga0207641_101271593	272
200	3300026095	Ga0207676_10067278	Ga0207676_100672783	272
201	3300026116	Ga0207674_10123323	Ga0207674_101233232	272
202	3300027907	Ga0207428_10382853	Ga0207428_103828531	272
203	3300028379	Ga0268266_10000045	Ga0268266_1000004532	272
204	3300028556	Ga0265337_1000954	Ga0265337_10009543	272
205	3300028563	Ga0265319_1001094	Ga0265319_100109410	272
206	3300028577	Ga0265318_10011540	Ga0265318_100115403	272
207	3300028666	Ga0265336_10000005	Ga0265336_10000005383	272
208	3300028800	Ga0265338_10000832	Ga0265338_100008323	272
209	3300028800	Ga0265338_10020680	Ga0265338_100206803	272
210	3300029957	Ga0265324_10006008	Ga0265324_100060083	272
211	3300031247	Ga0265340_10000001	Ga0265340_100000011198	272
212	3300031249	Ga0265339_10028100	Ga0265339_100281002	272
213	3300031251	Ga0265327_10079083	Ga0265327_100790832	272
214	3300031344	Ga0265316_10054388	Ga0265316_100543883	272
215	3300031712	Ga0265342_10086229	Ga0265342_100862292	272
216	3300031731	Ga0307405_10187688	Ga0307405_101876881	272
217	3300031852	Ga0307410_10266056	Ga0307410_102660561	272
218	3300031903	Ga0307407_10114195	Ga0307407_101141952	272
219	3300031995	Ga0307409_100625134	Ga0307409_1006251341	272
220	3300035086	Ga0373934_0023048	Ga0373934_0023048_1404_2279	272
221	3300035089	Ga0373944_0025750	Ga0373944_0025750_788_1648	272
222	3300035119	Ga0373956_0022064	Ga0373956_0022064_253_1128	272
223	3300035171	Ga0373946_0050375	Ga0373946_0050375_586_1461	272
224	3300035172	Ga0373955_0131997	Ga0373955_0131997_411_1286	272
225	3300035410	Ga0373924_0079917	Ga0373924_0079917_503_1363	272
226	3300035724	Ga0373933_0053793	Ga0373933_0053793_233_1108	272
227	3300035725	Ga0373947_0023466	Ga0373947_0023466_1491_2366	272
228	3300036401	Ga0373937_0168022	Ga0373937_0168022_215_1090	272
229	3300037068	Ga0373925_0149587	Ga0373925_0149587_399_1274	272
230	3300037466	Ga0395898_0203067	Ga0395898_0203067_33_860	272
231	3300037853	Ga0436364_0250599	Ga0436364_0250599_5787_6710	272
232	3300037853	Ga0436364_0253679	Ga0436364_0253679_37842_38702	272
233	3300037853	Ga0436364_0445774	Ga0436364_0445774_7758_8618	272
234	3300037853	Ga0436364_0660713	Ga0436364_0660713_39_899	272
235	3300037853	Ga0436364_0731334	Ga0436364_0731334_1920_2780	272
236	3300037853	Ga0436364_0826917	Ga0436364_0826917_122_982	272
237	3300037853	Ga0436364_0951097	Ga0436364_0951097_325_1197	272
238	3300037853	Ga0436364_1070108	Ga0436364_1070108_25_885	272
239	3300039437	Ga0436365_0265252	Ga0436365_0265252_8068_8928	272
240	3300039437	Ga0436365_0485793	Ga0436365_0485793_3861_4721	272
241	3300039437	Ga0436365_0605143	Ga0436365_0605143_1349_2209	272
242	3300039437	Ga0436365_0782833	Ga0436365_0782833_2098_2961	272
243	3300039437	Ga0436365_1122560	Ga0436365_1122560_709_1569	272
244	3300039437	Ga0436365_1188153	Ga0436365_1188153_23978_24838	272
245	3300039437	Ga0436365_1362313	Ga0436365_1362313_2777_3637	272
246	3300039450	Ga0436363_0983181	Ga0436363_0983181_30644_31504	272
247	3300039450	Ga0436363_1111979	Ga0436363_1111979_2432_3292	272
248	3300039450	Ga0436363_1147919	Ga0436363_1147919_4647_5507	272
249	3300039453	Ga0436362_0029475	Ga0436362_0029475_1885_2745	272
250	3300039453	Ga0436362_0080575	Ga0436362_0080575_662_1522	272
251	3300041512	Ga0451853_0327660	Ga0451853_0327660_1235_2071	272
252	3300044656	Ga0466969_0146535	Ga0466969_0146535_67_930	272
253	3300044684	Ga0466966_0018082	Ga0466966_0018082_2778_3602	272
254	3300045049	Ga0466959_0230113	Ga0466959_0230113_315_1139	272
255	3300045836	Ga0466958_0012219	Ga0466958_0012219_1733_2617	272
256	3300045976	Ga0466967_0019586	Ga0466967_0019586_1439_2323	272
257	3300045976	Ga0466967_0257038	Ga0466967_0257038_518_1378	272
258	3300046454	Ga0495592_0001378	Ga0495592_0001378_2465_3331	272
259	3300046454	Ga0495592_0002543	Ga0495592_0002543_5575_6450	272
260	3300046454	Ga0495592_0134349	Ga0495592_0134349_532_1392	272
261	3300046459	Ga0495629_0153193	Ga0495629_0153193_499_1374	272
262	3300046461	Ga0495641_0086762	Ga0495641_0086762_214_1089	272
263	3300046463	Ga0495653_0010614	Ga0495653_0010614_5315_6190	272
264	3300046476	Ga0495662_0000133	Ga0495662_0000133_1040_1906	272
265	3300046477	Ga0495664_0034933	Ga0495664_0034933_1590_2465	272
266	3300046511	Ga0495608_0006223	Ga0495608_0006223_4242_5117	272
267	3300046515	Ga0495620_0000682	Ga0495620_0000682_17704_18573	272
268	3300046516	Ga0495628_0017004	Ga0495628_0017004_1262_2137	272
269	3300046517	Ga0495630_0073232	Ga0495630_0073232_1420_2295	272
270	3300046523	Ga0495644_0003632	Ga0495644_0003632_2760_3626	272
271	3300046526	Ga0495666_0018184	Ga0495666_0018184_1911_2771	272
272	3300046533	Ga0495640_0128911	Ga0495640_0128911_469_1344	272
273	3300046536	Ga0495587_0004725	Ga0495587_0004725_677_1552	272
274	3300046559	Ga0495667_0003180	Ga0495667_0003180_4806_5681	272
275	3300046615	Ga0495656_0161361	Ga0495656_0161361_47_925	272
276	3300046663	Ga0495635_0000005	Ga0495635_0000005_272781_273647	272
277	3300046663	Ga0495635_0005252	Ga0495635_0005252_4242_5117	272
278	3300046674	Ga0495588_0128108	Ga0495588_0128108_353_1183	272
279	3300046675	Ga0495657_0006179	Ga0495657_0006179_4274_5149	272
280	3300046678	Ga0495599_0003333	Ga0495599_0003333_2818_3693	272
281	3300046679	Ga0495623_0100811	Ga0495623_0100811_313_1188	272
282	3300046680	Ga0495646_0010257	Ga0495646_0010257_3997_4872	272
283	3300046683	Ga0495658_0087910	Ga0495658_0087910_698_1534	272
284	3300046690	Ga0495624_0061799	Ga0495624_0061799_1177_2052	272
285	3300046809	Ga0495600_0005476	Ga0495600_0005476_2541_3416	272
286	3300046809	Ga0495600_0027329	Ga0495600_0027329_79_945	272
287	3300047315	Ga0495581_0121451	Ga0495581_0121451_590_1450	272
288	3300047317	Ga0495604_0001647	Ga0495604_0001647_3549_4424	272
289	3300047317	Ga0495604_0025165	Ga0495604_0025165_604_1473	272
290	3300047319	Ga0495674_0026841	Ga0495674_0026841_3592_4452	272
291	3300047321	Ga0495676_0363054	Ga0495676_0363054_16_873	272
292	3300047322	Ga0495680_0006957	Ga0495680_0006957_4242_5117	272
293	3300047444	Ga0495675_0011751	Ga0495675_0011751_681_1556	272
294	3300047447	Ga0495685_008000	Ga0495685_008000_1366_2232	272
295	3300047471	Ga0495684_0004091	Ga0495684_0004091_677_1552	272
296	3300048903	Ga0496100_0006088	Ga0496100_0006088_1059_1895	272
297	3300048903	Ga0496100_0011675	Ga0496100_0011675_631_1494	272
298	3300048904	Ga0496101_0000900	Ga0496101_0000900_7773_8609	272
299	3300048905	Ga0496102_0000053	Ga0496102_0000053_64582_65448	272
300	3300048905	Ga0496102_0125857	Ga0496102_0125857_1346_2182	272
301	3300048906	Ga0496103_0000162	Ga0496103_0000162_12113_12979	272
302	3300048907	Ga0496104_0040696	Ga0496104_0040696_1863_2690	272
303	3300048907	Ga0496104_0062466	Ga0496104_0062466_1654_2514	272
304	3300048908	Ga0496105_0016914	Ga0496105_0016914_4112_4972	272
305	3300048909	Ga0496106_0070588	Ga0496106_0070588_1637_2464	272
306	3300048909	Ga0496106_0091990	Ga0496106_0091990_514_1350	272
307	3300048910	Ga0496107_0001976	Ga0496107_0001976_4456_5292	272
308	3300048911	Ga0496108_0027348	Ga0496108_0027348_2421_3248	272
309	3300048911	Ga0496108_0035705	Ga0496108_0035705_1419_2279	272
310	3300048912	Ga0496109_0011976	Ga0496109_0011976_5862_6722	272
311	3300048913	Ga0496110_0009901	Ga0496110_0009901_1851_2711	272
312	3300048913	Ga0496110_0054589	Ga0496110_0054589_860_1687	272
313	3300048914	Ga0496111_0067804	Ga0496111_0067804_1134_1994	272
314	3300048914	Ga0496111_0153087	Ga0496111_0153087_191_1051	272
315	3300048915	Ga0496112_0000308	Ga0496112_0000308_13388_14224	272
316	3300048915	Ga0496112_0122310	Ga0496112_0122310_716_1576	272
317	3300048915	Ga0496112_0527293	Ga0496112_0527293_32_859	272
318	3300048916	Ga0496113_0106359	Ga0496113_0106359_812_1672	272
319	3300048916	Ga0496113_0214333	Ga0496113_0214333_455_1282	272
320	3300048917	Ga0496114_0430421	Ga0496114_0430421_121_966	272
321	3300048918	Ga0496115_0000064	Ga0496115_0000064_63738_64601	272
322	3300048918	Ga0496115_0182702	Ga0496115_0182702_455_1291	272
323	3300048918	Ga0496115_0366748	Ga0496115_0366748_148_1008	272
324	3300049568	Ga0501031_0041408	Ga0501031_0041408_1265_2098	272
325	3300049569	Ga0501032_0024908	Ga0501032_0024908_2628_3461	272
326	3300049570	Ga0501033_0007366	Ga0501033_0007366_937_1770	272
327	3300049572	Ga0501036_0033960	Ga0501036_0033960_2263_3096	272
328	3300049573	Ga0501037_0012793	Ga0501037_0012793_2638_3471	272
329	3300049574	Ga0501038_0062765	Ga0501038_0062765_2007_2840	272
330	3300049578	Ga0501042_0021057	Ga0501042_0021057_947_1780	272
331	3300049579	Ga0501043_0177269	Ga0501043_0177269_298_1131	272
332	3300049580	Ga0501046_0020691	Ga0501046_0020691_4313_5146	272
333	3300049581	Ga0501047_0135944	Ga0501047_0135944_987_1841	272
334	3300049582	Ga0501048_0092320	Ga0501048_0092320_725_1579	272
335	3300049582	Ga0501048_0104450	Ga0501048_0104450_773_1606	272
336	3300049584	Ga0501068_0101970	Ga0501068_0101970_284_1117	272
337	3300049585	Ga0501069_0002861	Ga0501069_0002861_1308_2162	272
338	3300049585	Ga0501069_0079785	Ga0501069_0079785_738_1571	272
339	3300049585	Ga0501069_0217555	Ga0501069_0217555_129_959	272
340	3300049586	Ga0501070_0003017	Ga0501070_0003017_1896_2729	272
341	3300049591	Ga0501075_0005540	Ga0501075_0005540_7433_8299	272
342	3300049592	Ga0501076_0094952	Ga0501076_0094952_932_1789	272
343	3300049741	Ga0501079_0058945	Ga0501079_0058945_235_1068	272
344	3300049741	Ga0501079_0295297	Ga0501079_0295297_116_970	272
345	3300049742	Ga0501080_0061677	Ga0501080_0061677_518_1351	272
346	3300049742	Ga0501080_0100572	Ga0501080_0100572_1406_2260	272
347	3300049744	Ga0501083_0014897	Ga0501083_0014897_3445_4278	272
348	3300049822	Ga0501035_0046669	Ga0501035_0046669_2148_2981	272
349	3300049823	Ga0501044_0096997	Ga0501044_0096997_1102_1935	272
350	3300050492	nmdc:mga0yw44_319079_c1	nmdc:mga0yw44_319079_c1_98_940	272
351	3300050509	nmdc:mga0qj67_3250_c1	nmdc:mga0qj67_3250_c1_2424_3251	272
352	3300050510	nmdc:mga06r32_67948_c1	nmdc:mga06r32_67948_c1_1005_1832	272
353	3300050511	nmdc:mga08y16_744352_c1	nmdc:mga08y16_744352_c1_56_883	272
354	3300050512	nmdc:mga0n895_119543_c1	nmdc:mga0n895_119543_c1_931_1758	272
355	3300050513	nmdc:mga0rr50_171657_c1	nmdc:mga0rr50_171657_c1_153_980	272
356	3300053077	Ga0495601_0191488	Ga0495601_0191488_312_1187	272
357	3300053078	Ga0495612_0001111	Ga0495612_0001111_8311_9177	272
358	3300053083	Ga0495655_0006908	Ga0495655_0006908_943_1770	272
359	3300053084	Ga0495595_0004524	Ga0495595_0004524_874_1743	272
360	3300053084	Ga0495595_0076136	Ga0495595_0076136_13_888	272
361	3300053085	Ga0495619_0000602	Ga0495619_0000602_158_1024	272
362	3300053085	Ga0495619_0004168	Ga0495619_0004168_5696_6586	272
363	3300053085	Ga0495619_0216655	Ga0495619_0216655_224_1099	272
364	3300053085	Ga0495619_0262007	Ga0495619_0262007_73_918	272
365	3300053085	Ga0495619_0285593	Ga0495619_0285593_123_992	272
366	3300053104	Ga0500556_0000244	Ga0500556_0000244_42091_42924	272
367	3300053153	Ga0500616_0014312	Ga0500616_0014312_1351_2184	272
368	3300060353	Ga0501082_0047324	Ga0501082_0047324_540_1373	272
369	3300061719	Ga0466962_0047549	Ga0466962_0047549_625_1485	272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

42

304

0.94 PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

47

278

0.85 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4els-assembly1.cif.gz_C	structure of e. coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with bicarbonate	0.9634	2	249
3t89-assembly1.cif.gz_C	crystal structure of escherichia coli menb, the 1,4-dihydroxy-2-naphthoyl-coa synthase in vitamin k2 biosynthesis	0.961	1	250
4elx-assembly1.cif.gz_C	structure of apo e.coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl	0.9605	2	247
3h02-assembly3.cif.gz_F	2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.	0.9597	2	247
4elw-assembly1.cif.gz_C	structure of e. coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate	0.9543	1	248

ID	Description	Score	Start	End	Superfamily
af_Q2FZL5_3_210_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9703	2	207	3.90.226.10
3rsiC01	Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;	0.9622	13	66	3.30.300.220
af_Q2FZL5_3_210_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9566	2	207	3.90.226.10
3t8aC02	Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain	0.939	211	248	1.10.12.10
4qiiB01	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9367	5	208	3.90.226.10

ID	Description	Score	Start	End	GO Terms
AF-I3S660-F1-model_v4	1,4-dihydroxy-2-naphthoyl-CoA synthase	0.9673	1	119	GO:0003824
AF-A0A453F670-F1-model_v4	Naphthoate synthase	0.961	1	113	GO:0005829 GO:0008935 GO:0009234
AF-A0A651H4Y8-F1-model_v4	1,4-dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36)	0.9573	1	162	GO:0005829 GO:0008935 GO:0009234
AF-A0A844F8R8-F1-model_v4	deleted	0.9562	2	183
AF-A0A1F8IZW8-F1-model_v4	1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36)	0.9528	1	272	GO:0005829 GO:0008935 GO:0009234

Feature Viewer

pLDDT	pTM	Quality
89.38	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F425114

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

42

304

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

47

278

0.85

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map