F425055

General Info

Members Datasets Scaffolds Average Seq Length
369 181 369 642

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10047833|Ga0207699_100478332
Length 689
Sequence MPRCTLSLNGSRRRKIRVSRCASVLITETSSASRQSAIAAAKPSLSVSSASVRTASCRRHWRSAGEACAQSRSSDNAVTQAEDAFGFSVGRESLGIYNAGNARGFSPTSAGNLRIDGLYYDQAGFAASLVSPLVNSTSIKVGLSAQGYPFAAPSGIVDIGLRKPGDKAAASVVINGDSFGSAGIEIDGSSPISSSLGLAYGAVLSRVAFPDGTDNINHSQSLVLRWRPAKGIEIIPFWSLYNDYNDEAGVFYSPSAEFLPPLAKPHRFEGARWSDFRFTATNHGVLGNFTLASNTVLRVGAFRSVQDQKSSFTNILANELPDGTGERIVIADPPTKNTSVSGEVRLTHSVVDGPRLHLIHFSVRERDAHRQFGGSAVLDYGPGRIGQILDVPKPASFDFGEVSRQHLTQTTYGIAYDGRWRDVGEISFSVSKAHYRKTTAIPGDGSAVARSNPWLYNGTAAANLTKTVTIYAGYARGLEESGLAPPNAANRNSPLPTIITTQKDAGVRIVLGGVKLVGGVFDLTRPYFGFDSANVFRQVGTVESRGAELSVSGKVTPHIDLVAGGVFIDGKVTRDSGASGVIGSKPVGLSPHQLSLNANWKTPFDGLELDTTVINRAHAPGTTDNLVIIPAKWRLDIGSHYHFKLAKHDATLRLQVFNVTGGTGYNVQGSGFYGQNPSRYVQGFLSVDF

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 3.52
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002579 3300001979 Bacteria 8166
2 JGI24740J21852_10002705 3300001979 Bacteria 7960
3 JGI24737J22298_10000740 3300001990 Bacteria 11508
4 JGI25165J46597_1000039 3300003214 Bacteria 281327
5 Ga0070658_10010798 3300005327 Bacteria 7321
6 Ga0070658_10027830 3300005327 Bacteria 4536
7 Ga0070658_10033470 3300005327 Bacteria 4135
8 Ga0070658_10034508 3300005327 Bacteria 4070
9 Ga0070658_10037995 3300005327 Bacteria 3882
10 Ga0070658_10054399 3300005327 Bacteria 3250
11 Ga0070676_10030787 3300005328 Bacteria 3063
12 Ga0070683_100024621 3300005329 Bacteria 5394
13 Ga0070683_100075543 3300005329 Unclassified 3148
14 Ga0070683_100154208 3300005329 Bacteria 2178
15 Ga0070670_100018969 3300005331 Bacteria 5898
16 Ga0070666_10000235 3300005335 Bacteria 37441
17 Ga0070666_10024155 3300005335 Bacteria 3959
18 Ga0070680_100005976 3300005336 Bacteria 9232
19 Ga0070680_100109700 3300005336 Bacteria 2296
20 Ga0068868_100010535 3300005338 Bacteria 6699
21 Ga0068868_100048210 3300005338 Bacteria 3341
22 Ga0070660_100021233 3300005339 Bacteria 4785
23 Ga0070691_10005850 3300005341 Bacteria 5610
24 Ga0070661_100004481 3300005344 Bacteria 9633
25 Ga0070661_100018506 3300005344 Bacteria 4953
26 Ga0070661_100029933 3300005344 Bacteria 3932
27 Ga0070661_100031348 3300005344 Bacteria 3844
28 Ga0070692_10016239 3300005345 Bacteria 3540
29 Ga0070671_100016753 3300005355 Bacteria 5926
30 Ga0070674_100000446 3300005356 Bacteria 20838
31 Ga0070674_100018470 3300005356 Bacteria 4410
32 Ga0070674_100059937 3300005356 Bacteria 2651
33 Ga0070673_100000611 3300005364 Bacteria 19549
34 Ga0070673_100014657 3300005364 Bacteria 5472
35 Ga0070659_100004164 3300005366 Bacteria 10309
36 Ga0070659_100006725 3300005366 Bacteria 8311
37 Ga0070667_100047188 3300005367 Bacteria 3624
38 Ga0070709_10027245 3300005434 Bacteria 3396
39 Ga0070714_100013844 3300005435 Bacteria 6467
40 Ga0070714_100030661 3300005435 Bacteria 4478
41 Ga0070714_100156944 3300005435 Unclassified 2055
42 Ga0070713_100004830 3300005436 Bacteria 9128
43 Ga0070713_100040707 3300005436 Bacteria 3779
44 Ga0070713_100046967 3300005436 Bacteria 3546
45 Ga0070663_100010382 3300005455 Bacteria 5804
46 Ga0070663_100057919 3300005455 Bacteria 2781
47 Ga0070663_100064715 3300005455 Bacteria 2643
48 Ga0070678_100000335 3300005456 Bacteria 21923
49 Ga0070678_100003165 3300005456 Bacteria 9116
50 Ga0070678_100011265 3300005456 Bacteria 5508
51 Ga0070678_100024305 3300005456 Bacteria 4055
52 Ga0070662_100009905 3300005457 Bacteria 6243
53 Ga0070662_100023214 3300005457 Bacteria 4259
54 Ga0070662_100036126 3300005457 Bacteria 3493
55 Ga0070662_100042810 3300005457 Bacteria 3236
56 Ga0070681_10075029 3300005458 Bacteria 3342
57 Ga0070681_10116575 3300005458 Bacteria 2607
58 Ga0068867_100015247 3300005459 Bacteria 5449
59 Ga0070679_100139514 3300005530 Bacteria 2404
60 Ga0070684_100001781 3300005535 Bacteria 15732
61 Ga0070684_100025377 3300005535 Bacteria 4981
62 Ga0070684_100100949 3300005535 Bacteria 2577
63 Ga0068853_100023040 3300005539 Bacteria 5209
64 Ga0068853_100036855 3300005539 Bacteria 4160
65 Ga0068853_100067678 3300005539 Bacteria 3103
66 Ga0070672_100033381 3300005543 Bacteria 3897
67 Ga0070672_100035465 3300005543 Bacteria 3792
68 Ga0070672_100069994 3300005543 Bacteria 2787
69 Ga0070686_100005166 3300005544 Bacteria 7205
70 Ga0070693_100011984 3300005547 Bacteria 4378
71 Ga0070665_100000323 3300005548 Bacteria 73605
72 Ga0070665_100029212 3300005548 Bacteria 5549
73 Ga0068855_100022020 3300005563 Bacteria 7641
74 Ga0068855_100088732 3300005563 Bacteria 3572
75 Ga0068855_100128916 3300005563 Bacteria 2890
76 Ga0070664_100000247 3300005564 Bacteria 38997
77 Ga0070664_100008377 3300005564 Bacteria 8358
78 Ga0070664_100009084 3300005564 Bacteria 8065
79 Ga0070664_100011650 3300005564 Bacteria 7135
80 Ga0070664_100050563 3300005564 Bacteria 3518
81 Ga0070664_100057029 3300005564 Bacteria 3320
82 Ga0070664_100103634 3300005564 Unclassified 2477
83 Ga0068857_100015508 3300005577 Bacteria 6658
84 Ga0068857_100040752 3300005577 Bacteria 4118
85 Ga0068857_100094968 3300005577 Bacteria 2670
86 Ga0068857_100100618 3300005577 Bacteria 2593
87 Ga0068854_100008596 3300005578 Bacteria 6573
88 Ga0068854_100041198 3300005578 Bacteria 3262
89 Ga0068854_100060032 3300005578 Bacteria 2749
90 Ga0068856_100032278 3300005614 Bacteria 5126
91 Ga0068856_100050209 3300005614 Bacteria 4112
92 Ga0068856_100136269 3300005614 Bacteria 2460
93 Ga0068852_100027627 3300005616 Bacteria 4627
94 Ga0068852_100032280 3300005616 Bacteria 4334
95 Ga0068852_100045947 3300005616 Bacteria 3718
96 Ga0068859_100044656 3300005617 Bacteria 4452
97 Ga0068859_100051449 3300005617 Bacteria 4141
98 Ga0068864_100001320 3300005618 Bacteria 20626
99 Ga0068864_100053069 3300005618 Bacteria 3496
100 Ga0068866_10011963 3300005718 Bacteria 3772
101 Ga0068866_10016400 3300005718 Bacteria 3312
102 Ga0068851_10002865 3300005834 Bacteria 7618
103 Ga0068851_10005947 3300005834 Bacteria 5554
104 Ga0068863_100016630 3300005841 Bacteria 7059
105 Ga0068863_100025254 3300005841 Bacteria 5663
106 Ga0068858_100000157 3300005842 Bacteria 72055
107 Ga0068858_100000926 3300005842 Bacteria 30421
108 Ga0068858_100002213 3300005842 Bacteria 19689
109 Ga0068858_100034593 3300005842 Bacteria 4687
110 Ga0068860_100095353 3300005843 Bacteria 2836
111 Ga0070717_10023468 3300006028 Bacteria 4888
112 Ga0070716_100013250 3300006173 Bacteria 4198
113 Ga0070712_100022155 3300006175 Bacteria 4181
114 Ga0097621_100018147 3300006237 Bacteria 5366
115 Ga0097621_100055585 3300006237 Bacteria 3233
116 Ga0097620_100044655 3300006931 Bacteria 4452
117 Ga0097620_100051448 3300006931 Bacteria 4141
118 Ga0105245_10002182 3300009098 Bacteria 17740
119 Ga0105245_10031696 3300009098 Bacteria 4679
120 Ga0105245_10043107 3300009098 Bacteria 4026
121 Ga0105247_10033906 3300009101 Bacteria 3108
122 Ga0105241_10043653 3300009174 Bacteria 3396
123 Ga0105241_10078789 3300009174 Bacteria 2575
124 Ga0105242_10018862 3300009176 Bacteria 5402
125 Ga0105248_10000259 3300009177 Bacteria 62005
126 Ga0105248_10026148 3300009177 Bacteria 6493
127 Ga0105248_10031877 3300009177 Bacteria 5890
128 Ga0105248_10046295 3300009177 Bacteria 4875
129 Ga0105248_10185160 3300009177 Bacteria 2347
130 Ga0105237_10009240 3300009545 Bacteria 10574
131 Ga0105238_10030456 3300009551 Bacteria 5493
132 Ga0105238_10031392 3300009551 Bacteria 5407
133 Ga0105238_10050979 3300009551 Bacteria 4165
134 Ga0105239_10085082 3300010375 Bacteria 3485
135 Ga0157373_10011869 3300013100 Bacteria 6400
136 Ga0157371_10000059 3300013102 Bacteria 170541
137 Ga0157371_10020704 3300013102 Bacteria 4838
138 Ga0157371_10024405 3300013102 Bacteria 4415
139 Ga0157371_10034479 3300013102 Bacteria 3630
140 Ga0157371_10042337 3300013102 Bacteria 3246
141 Ga0157370_10000244 3300013104 Bacteria 69583
142 Ga0157369_10026795 3300013105 Bacteria 6392
143 Ga0157369_10065968 3300013105 Bacteria 3894
144 Ga0157369_10099388 3300013105 Bacteria 3102
145 Ga0157374_10047999 3300013296 Bacteria 3961
146 Ga0157374_10137629 3300013296 Bacteria 2369
147 Ga0157378_10078617 3300013297 Bacteria 2976
148 Ga0163162_10013856 3300013306 Bacteria 7875
149 Ga0163162_10020524 3300013306 Bacteria 6491
150 Ga0163162_10049278 3300013306 Bacteria 4221
151 Ga0163162_10075182 3300013306 Bacteria 3438
152 Ga0157372_10026595 3300013307 Bacteria 6296
153 Ga0157372_10063253 3300013307 Bacteria 4148
154 Ga0157375_10038666 3300013308 Bacteria 4582
155 Ga0157379_10107778 3300014968 Bacteria 2501
156 Ga0157376_10013547 3300014969 Bacteria 6090
157 Ga0209437_101817 3300025233 Bacteria 4573
158 Ga0209233_1000052 3300025261 Bacteria 445813
159 Ga0207682_10006247 3300025893 Bacteria 4813
160 Ga0207642_10004223 3300025899 Bacteria 4621
161 Ga0207688_10007140 3300025901 Bacteria 6075
162 Ga0207680_10003465 3300025903 Bacteria 7435
163 Ga0207647_10001105 3300025904 Bacteria 20793
164 Ga0207647_10001172 3300025904 Bacteria 20191
165 Ga0207647_10002449 3300025904 Bacteria 14073
166 Ga0207647_10004841 3300025904 Bacteria 9955
167 Ga0207647_10024667 3300025904 Bacteria 3964
168 Ga0207699_10047833 3300025906 Unclassified 2509
169 Ga0207645_10029694 3300025907 Bacteria 3523
170 Ga0207705_10000203 3300025909 Bacteria 60016
171 Ga0207705_10043286 3300025909 Unclassified 3234
172 Ga0207705_10048113 3300025909 Bacteria 3067
173 Ga0207654_10001925 3300025911 Bacteria 10763
174 Ga0207695_10016733 3300025913 Bacteria 8565
175 Ga0207695_10052638 3300025913 Bacteria 4263
176 Ga0207671_10004995 3300025914 Bacteria 12418
177 Ga0207693_10021799 3300025915 Bacteria 5094
178 Ga0207662_10024402 3300025918 Bacteria 3480
179 Ga0207657_10002860 3300025919 Bacteria 18563
180 Ga0207657_10003792 3300025919 Bacteria 16074
181 Ga0207657_10014539 3300025919 Bacteria 7674
182 Ga0207657_10021121 3300025919 Bacteria 6134
183 Ga0207657_10024073 3300025919 Bacteria 5653
184 Ga0207657_10055690 3300025919 Bacteria 3415
185 Ga0207649_10003113 3300025920 Bacteria 9100
186 Ga0207649_10004703 3300025920 Bacteria 7387
187 Ga0207649_10019715 3300025920 Bacteria 3859
188 Ga0207694_10002312 3300025924 Bacteria 15590
189 Ga0207694_10107206 3300025924 Bacteria 2219
190 Ga0207650_10004763 3300025925 Bacteria 9268
191 Ga0207687_10002984 3300025927 Bacteria 11467
192 Ga0207687_10057226 3300025927 Bacteria 2738
193 Ga0207700_10086353 3300025928 Bacteria 2465
194 Ga0207664_10039259 3300025929 Bacteria 3675
195 Ga0207664_10043797 3300025929 Bacteria 3503
196 Ga0207644_10000576 3300025931 Bacteria 23579
197 Ga0207706_10005186 3300025933 Bacteria 12161
198 Ga0207706_10010733 3300025933 Bacteria 8367
199 Ga0207706_10011841 3300025933 Bacteria 7943
200 Ga0207706_10013081 3300025933 Bacteria 7551
201 Ga0207706_10037936 3300025933 Bacteria 4276
202 Ga0207706_10048427 3300025933 Bacteria 3759
203 Ga0207709_10000059 3300025935 Bacteria 211914
204 Ga0207669_10000330 3300025937 Bacteria 21753
205 Ga0207669_10065283 3300025937 Bacteria 2257
206 Ga0207691_10008104 3300025940 Bacteria 10091
207 Ga0207691_10021031 3300025940 Bacteria 6165
208 Ga0207691_10026738 3300025940 Bacteria 5415
209 Ga0207711_10000180 3300025941 Bacteria 68214
210 Ga0207711_10006536 3300025941 Bacteria 9815
211 Ga0207711_10011835 3300025941 Bacteria 7249
212 Ga0207711_10019569 3300025941 Bacteria 5636
213 Ga0207661_10090983 3300025944 Unclassified 2541
214 Ga0207679_10017952 3300025945 Bacteria 4729
215 Ga0207679_10055102 3300025945 Bacteria 2930
216 Ga0207679_10067113 3300025945 Bacteria 2690
217 Ga0207679_10090296 3300025945 Bacteria 2368
218 Ga0207667_10000002 3300025949 Bacteria 895662
219 Ga0207667_10010791 3300025949 Bacteria 10656
220 Ga0207667_10091573 3300025949 Bacteria 3141
221 Ga0207667_10170882 3300025949 Bacteria 2234
222 Ga0207651_10012079 3300025960 Bacteria 4865
223 Ga0207651_10023422 3300025960 Bacteria 3798
224 Ga0207640_10000441 3300025981 Bacteria 25269
225 Ga0207640_10034693 3300025981 Bacteria 3150
226 Ga0207658_10005874 3300025986 Bacteria 8393
227 Ga0207658_10034305 3300025986 Bacteria 3626
228 Ga0207677_10005778 3300026023 Bacteria 6728
229 Ga0207677_10023277 3300026023 Bacteria 3823
230 Ga0207703_10000095 3300026035 Bacteria 104227
231 Ga0207703_10008653 3300026035 Bacteria 8030
232 Ga0207703_10026815 3300026035 Bacteria 4538
233 Ga0207639_10000890 3300026041 Bacteria 20273
234 Ga0207639_10010033 3300026041 Bacteria 6547
235 Ga0207678_10019411 3300026067 Bacteria 5971
236 Ga0207678_10029931 3300026067 Bacteria 4754
237 Ga0207678_10071497 3300026067 Bacteria 2975
238 Ga0207702_10003172 3300026078 Bacteria 15210
239 Ga0207702_10008778 3300026078 Bacteria 8519
240 Ga0207702_10009483 3300026078 Bacteria 8177
241 Ga0207702_10030069 3300026078 Bacteria 4525
242 Ga0207702_10040871 3300026078 Bacteria 3887
243 Ga0207648_10008553 3300026089 Bacteria 9904
244 Ga0207648_10008840 3300026089 Bacteria 9701
245 Ga0207648_10044569 3300026089 Bacteria 3891
246 Ga0207676_10000971 3300026095 Bacteria 22156
247 Ga0207674_10002935 3300026116 Bacteria 21184
248 Ga0207674_10003891 3300026116 Bacteria 18169
249 Ga0207674_10009613 3300026116 Bacteria 11031
250 Ga0207674_10018505 3300026116 Bacteria 7570
251 Ga0207674_10098735 3300026116 Bacteria 2903
252 Ga0207674_10124969 3300026116 Bacteria 2538
253 Ga0207683_10000970 3300026121 Bacteria 26265
254 Ga0207683_10007210 3300026121 Bacteria 9532
255 Ga0207683_10008207 3300026121 Bacteria 8936
256 Ga0207683_10010892 3300026121 Bacteria 7755
257 Ga0207683_10012533 3300026121 Bacteria 7233
258 Ga0207698_10002457 3300026142 Bacteria 10985
259 Ga0207698_10030477 3300026142 Bacteria 3879
260 Ga0207698_10077008 3300026142 Bacteria 2672
261 Ga0268266_10000002 3300028379 Bacteria 3059047
262 Ga0268266_10063636 3300028379 Bacteria 3184
263 Ga0268266_10064917 3300028379 Bacteria 3155
264 Ga0307508_10001773 3300031616 Bacteria 23977
265 Ga0307410_10000124 3300031852 Bacteria 27240
266 Ga0307410_10013134 3300031852 Bacteria 4819
267 Ga0307416_100054254 3300032002 Unclassified 3221
268 Ga0307414_10006686 3300032004 Bacteria 6450
269 Ga0307414_10038347 3300032004 Bacteria 3217
270 Ga0307411_10001141 3300032005 Bacteria 10410
271 Ga0307415_100002442 3300032126 Bacteria 9278
272 Ga0373943_0003454 3300035170 Bacteria 7189
273 Ga0373946_0010622 3300035171 Unclassified 3413
274 Ga0373935_0005654 3300035692 Bacteria 7376
275 Ga0373925_0013495 3300037068 Bacteria 5914
276 Ga0395899_0003741 3300037312 Bacteria 12019
277 Ga0395899_0004956 3300037312 Bacteria 10359
278 Ga0395899_0036663 3300037312 Bacteria 3677
279 Ga0395899_0079034 3300037312 Bacteria 2396
280 Ga0395899_0081431 3300037312 Bacteria 2355
281 Ga0395900_0001457 3300037418 Bacteria 28209
282 Ga0395900_0011164 3300037418 Bacteria 9184
283 Ga0395900_0020419 3300037418 Bacteria 6762
284 Ga0395900_0051570 3300037418 Bacteria 4237
285 Ga0395900_0120948 3300037418 Bacteria 2686
286 Ga0395898_0003602 3300037466 Bacteria 17250
287 Ga0395898_0035277 3300037466 Bacteria 4976
288 Ga0395898_0044747 3300037466 Bacteria 4354
289 Ga0395898_0050984 3300037466 Bacteria 4048
290 Ga0395905_0003007 3300037471 Bacteria 18277
291 Ga0395905_0007093 3300037471 Bacteria 11200
292 Ga0395905_0010552 3300037471 Bacteria 8973
293 Ga0395905_0034281 3300037471 Bacteria 4766
294 Ga0395905_0046247 3300037471 Bacteria 4080
295 Ga0395905_0047338 3300037471 Bacteria 4030
296 Ga0395905_0048265 3300037471 Bacteria 3990
297 Ga0395905_0062392 3300037471 Bacteria 3486
298 Ga0395901_0001734 3300038443 Bacteria 22531
299 Ga0395901_0008249 3300038443 Bacteria 10525
300 Ga0395901_0021978 3300038443 Bacteria 6539
301 Ga0395901_0024326 3300038443 Bacteria 6215
302 Ga0395901_0107949 3300038443 Bacteria 2922
303 Ga0395901_0196228 3300038443 Bacteria 2116
304 Ga0436365_0274375 3300039437 Bacteria 8977
305 Ga0466966_0020701 3300044684 Bacteria 4323
306 Ga0466966_0021287 3300044684 Bacteria 4258
307 Ga0466961_0067038 3300044693 Bacteria 2280
308 Ga0466963_0001824 3300044694 Bacteria 11596
309 Ga0466963_0032737 3300044694 Bacteria 3368
310 Ga0466971_0007284 3300044719 Bacteria 4817
311 Ga0466957_0001958 3300044842 Bacteria 10946
312 Ga0466957_0013595 3300044842 Bacteria 4724
313 Ga0466957_0040893 3300044842 Bacteria 2802
314 Ga0466957_0074050 3300044842 Unclassified 2112
315 Ga0466959_0017027 3300045049 Bacteria 5320
316 Ga0466958_0002377 3300045836 Bacteria 9413
317 Ga0466967_0012992 3300045976 Bacteria 6406
318 Ga0466967_0043973 3300045976 Bacteria 3870
319 Ga0466967_0053061 3300045976 Bacteria 3562
320 Ga0466967_0071437 3300045976 Bacteria 3108
321 Ga0466967_0072801 3300045976 Bacteria 3081
322 Ga0495638_0001273 3300046460 Bacteria 23502
323 Ga0495596_0015600 3300046500 Bacteria 3176
324 Ga0495583_0000412 3300046506 Bacteria 64931
325 Ga0495583_0003694 3300046506 Bacteria 11392
326 Ga0495643_0001380 3300046522 Bacteria 22714
327 Ga0495648_0002184 3300046524 Bacteria 18345
328 Ga0495663_0001625 3300046525 Bacteria 7032
329 Ga0495587_0014559 3300046536 Bacteria 4929
330 Ga0495621_0000006 3300046539 Bacteria 44306
331 Ga0495622_0009541 3300046557 Bacteria 4491
332 Ga0495668_0000016 3300046616 Bacteria 438197
333 Ga0495625_0000106 3300046660 Bacteria 125985
334 Ga0495625_0003922 3300046660 Bacteria 14303
335 Ga0495669_0000246 3300046684 Bacteria 31773
336 Ga0495649_0032274 3300046694 Bacteria 2885
337 Ga0495683_0001418 3300047323 Bacteria 15811
338 Ga0495687_000068 3300047443 Bacteria 161081
339 Ga0496101_0008586 3300048904 Bacteria 6678
340 Ga0496102_0000747 3300048905 Bacteria 31812
341 Ga0496103_0000221 3300048906 Bacteria 56381
342 Ga0496105_0000675 3300048908 Bacteria 22932
343 Ga0496107_0014670 3300048910 Bacteria 5485
344 Ga0496109_0066800 3300048912 Bacteria 3293
345 Ga0496110_0001279 3300048913 Bacteria 18019
346 Ga0496110_0123848 3300048913 Bacteria 2331
347 Ga0496112_0033969 3300048915 Bacteria 4961
348 Ga0496113_0023366 3300048916 Bacteria 4384
349 Ga0496114_0000019 3300048917 Bacteria 244365
350 Ga0496114_0002578 3300048917 Bacteria 13853
351 Ga0496115_0001801 3300048918 Bacteria 15349
352 Ga0496116_0003474 3300048919 Bacteria 15509
353 Ga0496117_0000324 3300048920 Bacteria 83876
354 Ga0496118_0000659 3300048921 Bacteria 56449
355 Ga0496119_0003771 3300048922 Bacteria 15509
356 Ga0496121_0001320 3300048924 Bacteria 42493
357 Ga0496122_0015729 3300048925 Bacteria 7213
358 Ga0496124_0000351 3300048927 Bacteria 84021
359 Ga0496124_0002194 3300048927 Bacteria 26062
360 Ga0496125_0010469 3300048928 Bacteria 9379
361 Ga0496126_0000321 3300048929 Bacteria 102445
362 Ga0500595_008479 3300053119 Bacteria 4194
363 Ga0500642_0001949 3300053130 Bacteria 5985
364 Ga0500658_0000044 3300053134 Bacteria 72423
365 Ga0500658_0000528 3300053134 Bacteria 16158
366 Ga0500636_0006524 3300053177 Bacteria 6702
367 Ga0500645_000002 3300053730 Bacteria 388892
368 Ga0466962_0006392 3300061719 Bacteria 5656
369 Ga0466962_0020239 3300061719 Bacteria 3199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10071497 Ga0207678_100714973 533
2 3300045976 Ga0466967_0071437 Ga0466967_0071437_851_2791 616
3 3300005455 Ga0070663_100064715 Ga0070663_1000647151 620
4 3300026089 Ga0207648_10044569 Ga0207648_100445692 624
5 3300037471 Ga0395905_0003007 Ga0395905_0003007_4853_6784 624
6 3300038443 Ga0395901_0107949 Ga0395901_0107949_518_2449 624
7 3300053134 Ga0500658_0000044 Ga0500658_0000044_26281_28212 624
8 3300061719 Ga0466962_0020239 Ga0466962_0020239_786_2669 624
9 3300006028 Ga0070717_10023468 Ga0070717_100234682 627
10 3300005327 Ga0070658_10037995 Ga0070658_100379952 628
11 3300013104 Ga0157370_10000244 Ga0157370_100002445 628
12 3300001979 JGI24740J21852_10002705 JGI24740J21852_100027056 629
13 3300005329 Ga0070683_100024621 Ga0070683_1000246212 629
14 3300009177 Ga0105248_10031877 Ga0105248_100318773 629
15 3300009545 Ga0105237_10009240 Ga0105237_100092405 629
16 3300009551 Ga0105238_10030456 Ga0105238_100304564 629
17 3300013100 Ga0157373_10011869 Ga0157373_100118691 629
18 3300013307 Ga0157372_10026595 Ga0157372_100265955 629
19 3300025945 Ga0207679_10017952 Ga0207679_100179522 629
20 3300037312 Ga0395899_0081431 Ga0395899_0081431_185_2086 629
21 3300045976 Ga0466967_0053061 Ga0466967_0053061_1007_2905 629
22 3300048915 Ga0496112_0033969 Ga0496112_0033969_1429_3330 629
23 3300048927 Ga0496124_0002194 Ga0496124_0002194_8026_9966 629
24 3300005456 Ga0070678_100024305 Ga0070678_1000243052 630
25 3300005457 Ga0070662_100042810 Ga0070662_1000428102 630
26 3300013296 Ga0157374_10047999 Ga0157374_100479993 630
27 3300026121 Ga0207683_10007210 Ga0207683_100072103 630
28 3300048917 Ga0496114_0000019 Ga0496114_0000019_92215_94161 632
29 3300005338 Ga0068868_100010535 Ga0068868_1000105354 633
30 3300005841 Ga0068863_100016630 Ga0068863_1000166307 633
31 3300037418 Ga0395900_0020419 Ga0395900_0020419_1121_3055 633
32 3300037471 Ga0395905_0034281 Ga0395905_0034281_1702_3636 633
33 3300038443 Ga0395901_0021978 Ga0395901_0021978_1794_3728 633
34 3300039437 Ga0436365_0274375 Ga0436365_0274375_119_2035 634
35 3300005436 Ga0070713_100040707 Ga0070713_1000407073 635
36 3300025919 Ga0207657_10021121 Ga0207657_100211214 635
37 3300025929 Ga0207664_10043797 Ga0207664_100437972 635
38 3300037466 Ga0395898_0050984 Ga0395898_0050984_1543_3480 635
39 3300037471 Ga0395905_0048265 Ga0395905_0048265_1849_3786 635
40 3300038443 Ga0395901_0024326 Ga0395901_0024326_3784_5721 635
41 3300005335 Ga0070666_10000235 Ga0070666_1000023515 636
42 3300005364 Ga0070673_100000611 Ga0070673_1000006112 636
43 3300005367 Ga0070667_100047188 Ga0070667_1000471883 636
44 3300005617 Ga0068859_100051449 Ga0068859_1000514493 636
45 3300005842 Ga0068858_100002213 Ga0068858_10000221313 636
46 3300005843 Ga0068860_100095353 Ga0068860_1000953532 636
47 3300006931 Ga0097620_100051448 Ga0097620_1000514483 636
48 3300009098 Ga0105245_10043107 Ga0105245_100431073 636
49 3300009177 Ga0105248_10000259 Ga0105248_1000025922 636
50 3300013296 Ga0157374_10137629 Ga0157374_101376292 636
51 3300025903 Ga0207680_10003465 Ga0207680_100034653 636
52 3300025904 Ga0207647_10001172 Ga0207647_100011723 636
53 3300025941 Ga0207711_10000180 Ga0207711_1000018035 636
54 3300025960 Ga0207651_10023422 Ga0207651_100234223 636
55 3300025986 Ga0207658_10005874 Ga0207658_100058749 636
56 3300044842 Ga0466957_0040893 Ga0466957_0040893_611_2551 636
57 3300003214 JGI25165J46597_1000039 JGI25165J46597_1000039190 637
58 3300005335 Ga0070666_10024155 Ga0070666_100241552 637
59 3300005434 Ga0070709_10027245 Ga0070709_100272452 637
60 3300005435 Ga0070714_100013844 Ga0070714_1000138443 637
61 3300005436 Ga0070713_100046967 Ga0070713_1000469673 637
62 3300005577 Ga0068857_100100618 Ga0068857_1001006182 637
63 3300006173 Ga0070716_100013250 Ga0070716_1000132502 637
64 3300006175 Ga0070712_100022155 Ga0070712_1000221553 637
65 3300025233 Ga0209437_101817 Ga0209437_1018174 637
66 3300025261 Ga0209233_1000052 Ga0209233_1000052345 637
67 3300025915 Ga0207693_10021799 Ga0207693_100217994 637
68 3300025928 Ga0207700_10086353 Ga0207700_100863531 637
69 3300025940 Ga0207691_10021031 Ga0207691_100210315 637
70 3300026078 Ga0207702_10008778 Ga0207702_100087781 637
71 3300026116 Ga0207674_10124969 Ga0207674_101249692 637
72 3300032004 Ga0307414_10038347 Ga0307414_100383472 637
73 3300035692 Ga0373935_0005654 Ga0373935_0005654_2530_4512 637
74 3300037418 Ga0395900_0051570 Ga0395900_0051570_1055_2998 637
75 3300037466 Ga0395898_0035277 Ga0395898_0035277_2772_4715 637
76 3300005435 Ga0070714_100030661 Ga0070714_1000306612 638
77 3300005436 Ga0070713_100004830 Ga0070713_1000048301 638
78 3300005577 Ga0068857_100015508 Ga0068857_1000155086 638
79 3300005614 Ga0068856_100032278 Ga0068856_1000322782 638
80 3300005616 Ga0068852_100032280 Ga0068852_1000322802 638
81 3300025906 Ga0207699_10047833 Ga0207699_100478332 638
82 3300025929 Ga0207664_10039259 Ga0207664_100392592 638
83 3300025945 Ga0207679_10090296 Ga0207679_100902962 638
84 3300025949 Ga0207667_10170882 Ga0207667_101708822 638
85 3300026078 Ga0207702_10030069 Ga0207702_100300694 638
86 3300026116 Ga0207674_10009613 Ga0207674_100096133 638
87 3300031852 Ga0307410_10013134 Ga0307410_100131344 638
88 3300032002 Ga0307416_100054254 Ga0307416_1000542542 638
89 3300032004 Ga0307414_10006686 Ga0307414_100066866 638
90 3300032005 Ga0307411_10001141 Ga0307411_100011415 638
91 3300032126 Ga0307415_100002442 Ga0307415_1000024424 638
92 3300037312 Ga0395899_0079034 Ga0395899_0079034_27_1955 638
93 3300037418 Ga0395900_0120948 Ga0395900_0120948_418_2382 638
94 3300037471 Ga0395905_0010552 Ga0395905_0010552_6511_8439 638
95 3300037471 Ga0395905_0047338 Ga0395905_0047338_1974_3902 638
96 3300037471 Ga0395905_0062392 Ga0395905_0062392_740_2758 638
97 3300044684 Ga0466966_0020701 Ga0466966_0020701_1426_3354 638
98 3300044684 Ga0466966_0021287 Ga0466966_0021287_1121_3052 638
99 3300044693 Ga0466961_0067038 Ga0466961_0067038_283_2211 638
100 3300044694 Ga0466963_0032737 Ga0466963_0032737_864_2792 638
101 3300044719 Ga0466971_0007284 Ga0466971_0007284_1523_3451 638
102 3300044842 Ga0466957_0001958 Ga0466957_0001958_4283_6211 638
103 3300044842 Ga0466957_0074050 Ga0466957_0074050_42_1970 638
104 3300045049 Ga0466959_0017027 Ga0466959_0017027_230_2161 638
105 3300045836 Ga0466958_0002377 Ga0466958_0002377_4189_6117 638
106 3300045976 Ga0466967_0043973 Ga0466967_0043973_1556_3484 638
107 3300061719 Ga0466962_0006392 Ga0466962_0006392_2456_4384 638
108 3300005327 Ga0070658_10027830 Ga0070658_100278302 639
109 3300005327 Ga0070658_10033470 Ga0070658_100334703 639
110 3300005327 Ga0070658_10034508 Ga0070658_100345083 639
111 3300005328 Ga0070676_10030787 Ga0070676_100307871 639
112 3300005329 Ga0070683_100154208 Ga0070683_1001542081 639
113 3300005331 Ga0070670_100018969 Ga0070670_1000189696 639
114 3300005336 Ga0070680_100005976 Ga0070680_1000059766 639
115 3300005336 Ga0070680_100109700 Ga0070680_1001097002 639
116 3300005338 Ga0068868_100048210 Ga0068868_1000482103 639
117 3300005339 Ga0070660_100021233 Ga0070660_1000212333 639
118 3300005341 Ga0070691_10005850 Ga0070691_100058502 639
119 3300005344 Ga0070661_100004481 Ga0070661_1000044816 639
120 3300005344 Ga0070661_100029933 Ga0070661_1000299332 639
121 3300005344 Ga0070661_100031348 Ga0070661_1000313482 639
122 3300005345 Ga0070692_10016239 Ga0070692_100162392 639
123 3300005355 Ga0070671_100016753 Ga0070671_1000167533 639
124 3300005356 Ga0070674_100059937 Ga0070674_1000599372 639
125 3300005364 Ga0070673_100014657 Ga0070673_1000146573 639
126 3300005366 Ga0070659_100004164 Ga0070659_10000416410 639
127 3300005455 Ga0070663_100010382 Ga0070663_1000103823 639
128 3300005455 Ga0070663_100057919 Ga0070663_1000579192 639
129 3300005456 Ga0070678_100011265 Ga0070678_1000112654 639
130 3300005457 Ga0070662_100009905 Ga0070662_1000099053 639
131 3300005457 Ga0070662_100023214 Ga0070662_1000232143 639
132 3300005457 Ga0070662_100036126 Ga0070662_1000361262 639
133 3300005458 Ga0070681_10075029 Ga0070681_100750292 639
134 3300005458 Ga0070681_10116575 Ga0070681_101165752 639
135 3300005459 Ga0068867_100015247 Ga0068867_1000152474 639
136 3300005530 Ga0070679_100139514 Ga0070679_1001395141 639
137 3300005535 Ga0070684_100001781 Ga0070684_1000017814 639
138 3300005535 Ga0070684_100100949 Ga0070684_1001009492 639
139 3300005539 Ga0068853_100023040 Ga0068853_1000230403 639
140 3300005539 Ga0068853_100036855 Ga0068853_1000368553 639
141 3300005539 Ga0068853_100067678 Ga0068853_1000676781 639
142 3300005543 Ga0070672_100033381 Ga0070672_1000333813 639
143 3300005543 Ga0070672_100035465 Ga0070672_1000354653 639
144 3300005544 Ga0070686_100005166 Ga0070686_1000051663 639
145 3300005547 Ga0070693_100011984 Ga0070693_1000119842 639
146 3300005548 Ga0070665_100029212 Ga0070665_1000292125 639
147 3300005563 Ga0068855_100088732 Ga0068855_1000887322 639
148 3300005564 Ga0070664_100009084 Ga0070664_1000090847 639
149 3300005564 Ga0070664_100011650 Ga0070664_1000116504 639
150 3300005564 Ga0070664_100050563 Ga0070664_1000505632 639
151 3300005564 Ga0070664_100057029 Ga0070664_1000570292 639
152 3300005564 Ga0070664_100103634 Ga0070664_1001036342 639
153 3300005577 Ga0068857_100040752 Ga0068857_1000407522 639
154 3300005577 Ga0068857_100094968 Ga0068857_1000949682 639
155 3300005578 Ga0068854_100008596 Ga0068854_1000085965 639
156 3300005578 Ga0068854_100041198 Ga0068854_1000411982 639
157 3300005614 Ga0068856_100050209 Ga0068856_1000502092 639
158 3300005614 Ga0068856_100136269 Ga0068856_1001362691 639
159 3300005616 Ga0068852_100027627 Ga0068852_1000276273 639
160 3300005616 Ga0068852_100045947 Ga0068852_1000459473 639
161 3300005617 Ga0068859_100044656 Ga0068859_1000446563 639
162 3300005718 Ga0068866_10011963 Ga0068866_100119632 639
163 3300005718 Ga0068866_10016400 Ga0068866_100164002 639
164 3300005834 Ga0068851_10002865 Ga0068851_100028655 639
165 3300005834 Ga0068851_10005947 Ga0068851_100059473 639
166 3300005841 Ga0068863_100025254 Ga0068863_1000252544 639
167 3300005842 Ga0068858_100034593 Ga0068858_1000345933 639
168 3300006237 Ga0097621_100018147 Ga0097621_1000181473 639
169 3300006931 Ga0097620_100044655 Ga0097620_1000446553 639
170 3300009098 Ga0105245_10031696 Ga0105245_100316963 639
171 3300009101 Ga0105247_10033906 Ga0105247_100339063 639
172 3300009174 Ga0105241_10043653 Ga0105241_100436533 639
173 3300009174 Ga0105241_10078789 Ga0105241_100787892 639
174 3300009176 Ga0105242_10018862 Ga0105242_100188623 639
175 3300009177 Ga0105248_10026148 Ga0105248_100261482 639
176 3300009177 Ga0105248_10185160 Ga0105248_101851602 639
177 3300009551 Ga0105238_10031392 Ga0105238_100313923 639
178 3300009551 Ga0105238_10050979 Ga0105238_100509792 639
179 3300010375 Ga0105239_10085082 Ga0105239_100850822 639
180 3300013102 Ga0157371_10020704 Ga0157371_100207043 639
181 3300013102 Ga0157371_10034479 Ga0157371_100344794 639
182 3300013102 Ga0157371_10042337 Ga0157371_100423372 639
183 3300013105 Ga0157369_10099388 Ga0157369_100993882 639
184 3300013297 Ga0157378_10078617 Ga0157378_100786172 639
185 3300013306 Ga0163162_10020524 Ga0163162_100205243 639
186 3300013306 Ga0163162_10075182 Ga0163162_100751823 639
187 3300013307 Ga0157372_10063253 Ga0157372_100632534 639
188 3300013308 Ga0157375_10038666 Ga0157375_100386664 639
189 3300014968 Ga0157379_10107778 Ga0157379_101077782 639
190 3300014969 Ga0157376_10013547 Ga0157376_100135475 639
191 3300025893 Ga0207682_10006247 Ga0207682_100062473 639
192 3300025899 Ga0207642_10004223 Ga0207642_100042233 639
193 3300025901 Ga0207688_10007140 Ga0207688_100071405 639
194 3300025904 Ga0207647_10001105 Ga0207647_100011054 639
195 3300025904 Ga0207647_10004841 Ga0207647_100048417 639
196 3300025904 Ga0207647_10024667 Ga0207647_100246674 639
197 3300025909 Ga0207705_10048113 Ga0207705_100481132 639
198 3300025913 Ga0207695_10052638 Ga0207695_100526383 639
199 3300025918 Ga0207662_10024402 Ga0207662_100244023 639
200 3300025919 Ga0207657_10003792 Ga0207657_100037927 639
201 3300025919 Ga0207657_10014539 Ga0207657_100145396 639
202 3300025919 Ga0207657_10024073 Ga0207657_100240734 639
203 3300025919 Ga0207657_10055690 Ga0207657_100556903 639
204 3300025920 Ga0207649_10004703 Ga0207649_100047032 639
205 3300025924 Ga0207694_10107206 Ga0207694_101072062 639
206 3300025927 Ga0207687_10057226 Ga0207687_100572262 639
207 3300025931 Ga0207644_10000576 Ga0207644_1000057623 639
208 3300025933 Ga0207706_10010733 Ga0207706_100107333 639
209 3300025933 Ga0207706_10011841 Ga0207706_100118415 639
210 3300025933 Ga0207706_10013081 Ga0207706_100130812 639
211 3300025933 Ga0207706_10048427 Ga0207706_100484272 639
212 3300025937 Ga0207669_10065283 Ga0207669_100652831 639
213 3300025940 Ga0207691_10008104 Ga0207691_100081047 639
214 3300025941 Ga0207711_10019569 Ga0207711_100195694 639
215 3300025945 Ga0207679_10055102 Ga0207679_100551022 639
216 3300025945 Ga0207679_10067113 Ga0207679_100671132 639
217 3300025949 Ga0207667_10010791 Ga0207667_100107917 639
218 3300025949 Ga0207667_10091573 Ga0207667_100915732 639
219 3300025960 Ga0207651_10012079 Ga0207651_100120793 639
220 3300025981 Ga0207640_10034693 Ga0207640_100346931 639
221 3300025986 Ga0207658_10034305 Ga0207658_100343053 639
222 3300026023 Ga0207677_10005778 Ga0207677_100057784 639
223 3300026023 Ga0207677_10023277 Ga0207677_100232773 639
224 3300026035 Ga0207703_10026815 Ga0207703_100268153 639
225 3300026041 Ga0207639_10010033 Ga0207639_100100332 639
226 3300026067 Ga0207678_10019411 Ga0207678_100194116 639
227 3300026067 Ga0207678_10029931 Ga0207678_100299312 639
228 3300026078 Ga0207702_10009483 Ga0207702_100094835 639
229 3300026078 Ga0207702_10040871 Ga0207702_100408713 639
230 3300026089 Ga0207648_10008553 Ga0207648_100085533 639
231 3300026089 Ga0207648_10008840 Ga0207648_100088404 639
232 3300026116 Ga0207674_10003891 Ga0207674_1000389114 639
233 3300026116 Ga0207674_10018505 Ga0207674_100185057 639
234 3300026116 Ga0207674_10098735 Ga0207674_100987352 639
235 3300026121 Ga0207683_10010892 Ga0207683_100108923 639
236 3300026121 Ga0207683_10012533 Ga0207683_100125334 639
237 3300026142 Ga0207698_10002457 Ga0207698_100024576 639
238 3300026142 Ga0207698_10030477 Ga0207698_100304773 639
239 3300026142 Ga0207698_10077008 Ga0207698_100770082 639
240 3300028379 Ga0268266_10063636 Ga0268266_100636362 639
241 3300028379 Ga0268266_10064917 Ga0268266_100649173 639
242 3300031852 Ga0307410_10000124 Ga0307410_1000012424 639
243 3300035170 Ga0373943_0003454 Ga0373943_0003454_4935_6863 639
244 3300035171 Ga0373946_0010622 Ga0373946_0010622_1146_3074 639
245 3300037068 Ga0373925_0013495 Ga0373925_0013495_1307_3235 639
246 3300044694 Ga0466963_0001824 Ga0466963_0001824_9613_11544 639
247 3300044842 Ga0466957_0013595 Ga0466957_0013595_1576_3507 639
248 3300045976 Ga0466967_0012992 Ga0466967_0012992_2312_4243 639
249 3300046539 Ga0495621_0000006 Ga0495621_0000006_2624_4558 639
250 3300048904 Ga0496101_0008586 Ga0496101_0008586_3517_5448 639
251 3300048910 Ga0496107_0014670 Ga0496107_0014670_3523_5454 639
252 3300048912 Ga0496109_0066800 Ga0496109_0066800_32_1963 639
253 3300048913 Ga0496110_0001279 Ga0496110_0001279_639_2570 639
254 3300001979 JGI24740J21852_10002579 JGI24740J21852_100025792 640
255 3300001990 JGI24737J22298_10000740 JGI24737J22298_100007407 640
256 3300005327 Ga0070658_10010798 Ga0070658_100107987 640
257 3300005327 Ga0070658_10054399 Ga0070658_100543992 640
258 3300005329 Ga0070683_100075543 Ga0070683_1000755432 640
259 3300005344 Ga0070661_100018506 Ga0070661_1000185065 640
260 3300005356 Ga0070674_100000446 Ga0070674_1000004468 640
261 3300005356 Ga0070674_100018470 Ga0070674_1000184705 640
262 3300005366 Ga0070659_100006725 Ga0070659_1000067259 640
263 3300005435 Ga0070714_100156944 Ga0070714_1001569441 640
264 3300005456 Ga0070678_100000335 Ga0070678_1000003357 640
265 3300005456 Ga0070678_100003165 Ga0070678_1000031657 640
266 3300005535 Ga0070684_100025377 Ga0070684_1000253775 640
267 3300005543 Ga0070672_100069994 Ga0070672_1000699942 640
268 3300005548 Ga0070665_100000323 Ga0070665_1000003237 640
269 3300005563 Ga0068855_100022020 Ga0068855_1000220202 640
270 3300005563 Ga0068855_100128916 Ga0068855_1001289162 640
271 3300005564 Ga0070664_100000247 Ga0070664_10000024731 640
272 3300005564 Ga0070664_100008377 Ga0070664_1000083775 640
273 3300005578 Ga0068854_100060032 Ga0068854_1000600322 640
274 3300005618 Ga0068864_100001320 Ga0068864_1000013202 640
275 3300005618 Ga0068864_100053069 Ga0068864_1000530693 640
276 3300005842 Ga0068858_100000157 Ga0068858_1000001572 640
277 3300005842 Ga0068858_100000926 Ga0068858_10000092625 640
278 3300006237 Ga0097621_100055585 Ga0097621_1000555852 640
279 3300009098 Ga0105245_10002182 Ga0105245_100021829 640
280 3300009177 Ga0105248_10046295 Ga0105248_100462958 640
281 3300013102 Ga0157371_10000059 Ga0157371_1000005959 640
282 3300013102 Ga0157371_10024405 Ga0157371_100244053 640
283 3300013105 Ga0157369_10026795 Ga0157369_100267952 640
284 3300013105 Ga0157369_10065968 Ga0157369_100659682 640
285 3300013306 Ga0163162_10013856 Ga0163162_100138563 640
286 3300013306 Ga0163162_10049278 Ga0163162_100492783 640
287 3300025904 Ga0207647_10002449 Ga0207647_1000244910 640
288 3300025907 Ga0207645_10029694 Ga0207645_100296943 640
289 3300025909 Ga0207705_10000203 Ga0207705_1000020314 640
290 3300025909 Ga0207705_10043286 Ga0207705_100432862 640
291 3300025911 Ga0207654_10001925 Ga0207654_100019258 640
292 3300025913 Ga0207695_10016733 Ga0207695_100167333 640
293 3300025914 Ga0207671_10004995 Ga0207671_1000499511 640
294 3300025919 Ga0207657_10002860 Ga0207657_1000286011 640
295 3300025920 Ga0207649_10003113 Ga0207649_100031137 640
296 3300025920 Ga0207649_10019715 Ga0207649_100197153 640
297 3300025924 Ga0207694_10002312 Ga0207694_1000231214 640
298 3300025925 Ga0207650_10004763 Ga0207650_100047637 640
299 3300025927 Ga0207687_10002984 Ga0207687_100029845 640
300 3300025933 Ga0207706_10005186 Ga0207706_100051865 640
301 3300025933 Ga0207706_10037936 Ga0207706_100379362 640
302 3300025935 Ga0207709_10000059 Ga0207709_1000005945 640
303 3300025937 Ga0207669_10000330 Ga0207669_1000033026 640
304 3300025940 Ga0207691_10026738 Ga0207691_100267385 640
305 3300025941 Ga0207711_10006536 Ga0207711_100065364 640
306 3300025941 Ga0207711_10011835 Ga0207711_100118351 640
307 3300025944 Ga0207661_10090983 Ga0207661_100909832 640
308 3300025949 Ga0207667_10000002 Ga0207667_10000002100 640
309 3300025981 Ga0207640_10000441 Ga0207640_1000044114 640
310 3300026035 Ga0207703_10000095 Ga0207703_1000009562 640
311 3300026035 Ga0207703_10008653 Ga0207703_100086535 640
312 3300026041 Ga0207639_10000890 Ga0207639_1000089017 640
313 3300026078 Ga0207702_10003172 Ga0207702_100031722 640
314 3300026095 Ga0207676_10000971 Ga0207676_100009712 640
315 3300026116 Ga0207674_10002935 Ga0207674_100029359 640
316 3300026121 Ga0207683_10000970 Ga0207683_100009707 640
317 3300026121 Ga0207683_10008207 Ga0207683_100082073 640
318 3300028379 Ga0268266_10000002 Ga0268266_100000023014 640
319 3300031616 Ga0307508_10001773 Ga0307508_1000177319 640
320 3300037312 Ga0395899_0003741 Ga0395899_0003741_6072_8006 640
321 3300037312 Ga0395899_0004956 Ga0395899_0004956_4069_6003 640
322 3300037312 Ga0395899_0036663 Ga0395899_0036663_1449_3380 640
323 3300037418 Ga0395900_0001457 Ga0395900_0001457_8989_10920 640
324 3300037418 Ga0395900_0011164 Ga0395900_0011164_4014_5948 640
325 3300037466 Ga0395898_0003602 Ga0395898_0003602_5340_7274 640
326 3300037466 Ga0395898_0044747 Ga0395898_0044747_513_2444 640
327 3300037471 Ga0395905_0007093 Ga0395905_0007093_6030_7964 640
328 3300037471 Ga0395905_0046247 Ga0395905_0046247_491_2422 640
329 3300038443 Ga0395901_0001734 Ga0395901_0001734_16305_18239 640
330 3300038443 Ga0395901_0008249 Ga0395901_0008249_8009_9940 640
331 3300038443 Ga0395901_0196228 Ga0395901_0196228_97_2031 640
332 3300045976 Ga0466967_0072801 Ga0466967_0072801_547_2478 640
333 3300046460 Ga0495638_0001273 Ga0495638_0001273_2504_4438 640
334 3300046500 Ga0495596_0015600 Ga0495596_0015600_116_2038 640
335 3300046506 Ga0495583_0000412 Ga0495583_0000412_2176_4113 640
336 3300046506 Ga0495583_0003694 Ga0495583_0003694_137_2089 640
337 3300046522 Ga0495643_0001380 Ga0495643_0001380_833_2755 640
338 3300046524 Ga0495648_0002184 Ga0495648_0002184_13533_15455 640
339 3300046525 Ga0495663_0001625 Ga0495663_0001625_3097_5019 640
340 3300046536 Ga0495587_0014559 Ga0495587_0014559_422_2359 640
341 3300046557 Ga0495622_0009541 Ga0495622_0009541_808_2745 640
342 3300046616 Ga0495668_0000016 Ga0495668_0000016_24124_26046 640
343 3300046660 Ga0495625_0000106 Ga0495625_0000106_62949_64871 640
344 3300046660 Ga0495625_0003922 Ga0495625_0003922_392_2344 640
345 3300046684 Ga0495669_0000246 Ga0495669_0000246_22352_24274 640
346 3300046694 Ga0495649_0032274 Ga0495649_0032274_206_2128 640
347 3300047323 Ga0495683_0001418 Ga0495683_0001418_2203_4125 640
348 3300047443 Ga0495687_000068 Ga0495687_000068_73106_75028 640
349 3300048905 Ga0496102_0000747 Ga0496102_0000747_19319_21241 640
350 3300048906 Ga0496103_0000221 Ga0496103_0000221_23254_25176 640
351 3300048908 Ga0496105_0000675 Ga0496105_0000675_19101_21023 640
352 3300048913 Ga0496110_0123848 Ga0496110_0123848_157_2079 640
353 3300048916 Ga0496113_0023366 Ga0496113_0023366_872_2794 640
354 3300048917 Ga0496114_0002578 Ga0496114_0002578_3996_5918 640
355 3300048918 Ga0496115_0001801 Ga0496115_0001801_8465_10387 640
356 3300048919 Ga0496116_0003474 Ga0496116_0003474_1445_3367 640
357 3300048920 Ga0496117_0000324 Ga0496117_0000324_23171_25093 640
358 3300048921 Ga0496118_0000659 Ga0496118_0000659_23240_25162 640
359 3300048922 Ga0496119_0003771 Ga0496119_0003771_10545_12467 640
360 3300048924 Ga0496121_0001320 Ga0496121_0001320_19348_21270 640
361 3300048925 Ga0496122_0015729 Ga0496122_0015729_3935_5857 640
362 3300048927 Ga0496124_0000351 Ga0496124_0000351_23261_25183 640
363 3300048928 Ga0496125_0010469 Ga0496125_0010469_4156_6078 640
364 3300048929 Ga0496126_0000321 Ga0496126_0000321_31287_33209 640
365 3300053119 Ga0500595_008479 Ga0500595_008479_2247_4184 640
366 3300053130 Ga0500642_0001949 Ga0500642_0001949_838_2760 640
367 3300053134 Ga0500658_0000528 Ga0500658_0000528_13816_15747 640
368 3300053177 Ga0500636_0006524 Ga0500636_0006524_2249_4171 640
369 3300053730 Ga0500645_000002 Ga0500645_000002_311009_312931 640

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i97-assembly1.cif.gz_A structure of the ferrioxamine b transporter foxa from pseudomonas aeruginosa in complex with ferrioxamine b and a c-terminal tonb fragment 0.8542 56 640
6z8a-assembly1.cif.gz_A outer membrane foxa in complex with nocardamine 0.8482 65 640
2fcp-assembly1.cif.gz_A ferric hydroxamate uptake receptor (fhua) from e.coli 0.8405 62 640
8b14-assembly1.cif.gz_A t5 receptor binding protein pb5 in complex with its e. coli receptor fhua 0.8363 62 640
8a60-assembly1.cif.gz_A crystal structure of fhua in complex with the superinfection exclusion lipoprotein llp 0.8298 60 640
ID Description Score Start End Superfamily
3qlbB02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8338 115 640 2.40.170.20
1fi1A02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8315 120 638 2.40.170.20
3qlbB02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8195 115 640 2.40.170.20
1xkwA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8082 114 640 2.40.170.20
1xkwA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8054 114 640 2.40.170.20
ID Description Score Start End GO Terms
AF-A0A660NIE9-F1-model_v4 TonB-dependent receptor 0.9296 536 640 GO:0009279
GO:0015344
AF-A0A5B8S522-F1-model_v4 TonB-dependent receptor 0.9214 19 640 GO:0009279
GO:0015344
AF-A0A1L6JB22-F1-model_v4 TonB-dependent receptor 0.9165 357 640 GO:0009279
GO:0015344
AF-A0A178GMS9-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.916 9 640 GO:0009279
GO:0015344
AF-A0A7G9SEZ6-F1-model_v4 TonB-dependent receptor 0.9113 6 640 GO:0009279
GO:0015344

Feature Viewer

pLDDT pTM Quality
81.28 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map