F425045

General Info

Members Datasets Scaffolds Average Seq Length
369 178 738 273

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10356372|Ga0157380_103563722
Length 302
Sequence MWLKVLLTLLFAVSLLCAFVIKPGGRSEPGRTDDNDASAGVGRRLRLLTWNIGNGDLESETRAHDEDLAAVAQVILDNDADAVALQELTGEAQLKLLLSHLKNRYRGFVSSRGSGDRVEAVLIKNRRAPGERKSRADRSEVSVRFSNVPAGDKFAAAAIFRLQPDSPEIVVVSAHADAFNAARRRVFAAAIVDWTLSQSNSVAFIAGDFNFEVSTRNKNNLFTDNAKNDSESYAHLLKHFHDLGRDAGETSINDRRIDYVFGPPANVAVHRAEVLRDAAVGRMDHWPLLIEVDLSEVVVTNG

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
162 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
163 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
164 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
165 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
169 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.25
Rhizosphere 96.21
Stem 0
Stem Tuber 0
Unclassified 15.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10356372 3300014326 Bacteria 1371
2 JGI24751J29686_10000138 3300002459 Bacteria 36181
3 JGI25406J46586_10022463 3300003203 Bacteria 2513
4 JGI25406J46586_10029861 3300003203 Bacteria 2058
5 rootL2_10103756 3300003322 Bacteria 1473
6 Ga0065714_10002189 3300005288 Bacteria 128055
7 Ga0065704_10001246 3300005289 Bacteria 8685
8 Ga0065704_10084449 3300005289 Bacteria 3334
9 Ga0065712_10067733 3300005290 Bacteria 118568
10 Ga0065712_10187621 3300005290 Bacteria 1155
11 Ga0065715_10091762 3300005293 Bacteria 5567
12 Ga0065715_10095014 3300005293 Bacteria 4185
13 Ga0065715_10103900 3300005293 Bacteria 3000
14 Ga0065715_10114044 3300005293 Bacteria 2465
15 Ga0065707_10003683 3300005295 Bacteria 3778
16 Ga0065707_10010121 3300005295 Bacteria 2806
17 Ga0070690_100010808 3300005330 Bacteria 5324
18 Ga0070690_100127287 3300005330 Bacteria 1716
19 Ga0070670_100000229 3300005331 Bacteria 51545
20 Ga0068869_100099944 3300005334 Archaea 2193
21 Ga0068869_100250142 3300005334 Bacteria 1415
22 Ga0070680_100000115 3300005336 Bacteria 46887
23 Ga0070682_100002068 3300005337 Bacteria 11173
24 Ga0070682_100005279 3300005337 Bacteria 7188
25 Ga0068868_100017325 3300005338 Bacteria 5364
26 Ga0068868_100057863 3300005338 Bacteria 3063
27 Ga0068868_100224746 3300005338 Bacteria 1573
28 Ga0070687_100130427 3300005343 Bacteria 1450
29 Ga0070687_100168241 3300005343 Bacteria 1302
30 Ga0070692_10017993 3300005345 Unclassified 3389
31 Ga0070692_10258029 3300005345 Unclassified 1046
32 Ga0070668_100178959 3300005347 Bacteria 1731
33 Ga0070669_100009154 3300005353 Bacteria 7058
34 Ga0070669_100091198 3300005353 Bacteria 2285
35 Ga0070675_100082149 3300005354 Bacteria 2688
36 Ga0070675_100318142 3300005354 Bacteria 1374
37 Ga0070671_100028947 3300005355 Bacteria 4566
38 Ga0070673_100016853 3300005364 Bacteria 5180
39 Ga0070673_100182597 3300005364 Bacteria 1797
40 Ga0070673_100203381 3300005364 Bacteria 1706
41 Ga0070673_100447277 3300005364 Bacteria 1162
42 Ga0070667_100092070 3300005367 Bacteria 2608
43 Ga0070709_10371450 3300005434 Unclassified 1061
44 Ga0070701_10081919 3300005438 Bacteria 1749
45 Ga0070705_100010438 3300005440 Bacteria 4650
46 Ga0070705_100046748 3300005440 Bacteria 2497
47 Ga0070705_100056492 3300005440 Unclassified 2311
48 Ga0070700_100000022 3300005441 Bacteria 130126
49 Ga0070700_100003614 3300005441 Bacteria 7998
50 Ga0070694_100002196 3300005444 Bacteria 11575
51 Ga0070694_100027579 3300005444 Bacteria 3690
52 Ga0070694_100087586 3300005444 Bacteria 2178
53 Ga0070694_100116114 3300005444 Bacteria 1914
54 Ga0070694_100200400 3300005444 Bacteria 1487
55 Ga0070694_100329728 3300005444 Unclassified 1177
56 Ga0070708_100000833 3300005445 Bacteria 23241
57 Ga0070678_100302103 3300005456 Unclassified 1360
58 Ga0070662_100216008 3300005457 Bacteria 1528
59 Ga0070662_100239215 3300005457 Bacteria 1455
60 Ga0070681_10000336 3300005458 Bacteria 38138
61 Ga0070681_10002362 3300005458 Bacteria 17226
62 Ga0070681_10251483 3300005458 Archaea 1680
63 Ga0068867_100064528 3300005459 Bacteria 2723
64 Ga0068867_100653791 3300005459 Bacteria 923
65 Ga0070706_100008949 3300005467 Bacteria 9321
66 Ga0070706_100009369 3300005467 Bacteria 9117
67 Ga0070707_100038747 3300005468 Bacteria 4553
68 Ga0070698_100003271 3300005471 Bacteria 17804
69 Ga0070698_100016577 3300005471 Bacteria 7776
70 Ga0070698_100458220 3300005471 Unclassified 1211
71 Ga0070699_100006749 3300005518 Bacteria 9981
72 Ga0070699_100006813 3300005518 Bacteria 9942
73 Ga0070699_100044169 3300005518 Bacteria 3858
74 Ga0070679_100000256 3300005530 Bacteria 44524
75 Ga0070697_100022063 3300005536 Bacteria 5051
76 Ga0070697_100033945 3300005536 Bacteria 4112
77 Ga0070697_100175209 3300005536 Bacteria 1817
78 Ga0070697_100474709 3300005536 Unclassified 1092
79 Ga0068853_100005529 3300005539 Bacteria 9911
80 Ga0068853_100096355 3300005539 Bacteria 2610
81 Ga0070686_100011834 3300005544 Unclassified 4957
82 Ga0070695_100056441 3300005545 Bacteria 2534
83 Ga0070695_100133252 3300005545 Unclassified 1715
84 Ga0070696_100253882 3300005546 Bacteria 1331
85 Ga0070693_100002782 3300005547 Bacteria 8050
86 Ga0070693_100002890 3300005547 Bacteria 7925
87 Ga0070665_100084109 3300005548 Bacteria 3187
88 Ga0070704_100023577 3300005549 Unclassified 4024
89 Ga0068855_100268691 3300005563 Bacteria 1897
90 Ga0068857_100337663 3300005577 Unclassified 1393
91 Ga0068854_100026425 3300005578 Bacteria 3990
92 Ga0068856_100021598 3300005614 Bacteria 6256
93 Ga0070702_100002972 3300005615 Bacteria 7489
94 Ga0070702_100019607 3300005615 Unclassified 3532
95 Ga0070702_100038601 3300005615 Bacteria 2660
96 Ga0070702_100232879 3300005615 Bacteria 1239
97 Ga0068852_100044736 3300005616 Bacteria 3763
98 Ga0068852_100377045 3300005616 Unclassified 1391
99 Ga0068852_100706369 3300005616 Unclassified 1018
100 Ga0068859_100003420 3300005617 Bacteria 16147
101 Ga0068859_100067445 3300005617 Bacteria 3612
102 Ga0068859_100100947 3300005617 Bacteria 2942
103 Ga0068859_100177625 3300005617 Unclassified 2211
104 Ga0068859_100217640 3300005617 Unclassified 1997
105 Ga0068859_100278923 3300005617 Bacteria 1764
106 Ga0068859_100314221 3300005617 Unclassified 1660
107 Ga0068859_100337413 3300005617 Bacteria 1601
108 Ga0068864_100025605 3300005618 Bacteria 4971
109 Ga0068864_100035059 3300005618 Bacteria 4270
110 Ga0068864_100098960 3300005618 Bacteria 2583
111 Ga0068864_100225684 3300005618 Unclassified 1730
112 Ga0068864_100250746 3300005618 Bacteria 1643
113 Ga0068861_100001373 3300005719 Bacteria 15280
114 Ga0068861_100061052 3300005719 Bacteria 2892
115 Ga0068861_100120376 3300005719 Unclassified 2117
116 Ga0068861_100353128 3300005719 Unclassified 1290
117 Ga0068870_10023687 3300005840 Bacteria 3031
118 Ga0068870_10062691 3300005840 Unclassified 2004
119 Ga0068863_100606027 3300005841 Bacteria 1084
120 Ga0068858_100142804 3300005842 Bacteria 2248
121 Ga0068858_100680332 3300005842 Bacteria 1001
122 Ga0068860_100004165 3300005843 Bacteria 14825
123 Ga0068860_100062182 3300005843 Bacteria 3548
124 Ga0068860_100096229 3300005843 Bacteria 2822
125 Ga0068860_100131907 3300005843 Bacteria 2398
126 Ga0068860_100143095 3300005843 Bacteria 2299
127 Ga0068862_100033658 3300005844 Bacteria 4334
128 Ga0068862_100160238 3300005844 Bacteria 2008
129 Ga0068862_100231829 3300005844 Bacteria 1675
130 Ga0081539_10000193 3300005985 Bacteria 141450
131 Ga0081539_10000614 3300005985 Bacteria 72137
132 Ga0081539_10005808 3300005985 Bacteria 12272
133 Ga0081539_10102972 3300005985 Bacteria 1452
134 Ga0070716_100014262 3300006173 Bacteria 4069
135 Ga0097621_100003511 3300006237 Bacteria 10824
136 Ga0097621_100004561 3300006237 Bacteria 9669
137 Ga0097621_100015882 3300006237 Bacteria 5678
138 Ga0097621_100038990 3300006237 Bacteria 3814
139 Ga0068871_100023408 3300006358 Bacteria 4778
140 Ga0068871_100069189 3300006358 Bacteria 2898
141 Ga0075428_100127182 3300006844 Bacteria 2773
142 Ga0075428_100277604 3300006844 Bacteria 1803
143 Ga0075430_100072459 3300006846 Bacteria 2889
144 Ga0075431_100123231 3300006847 Bacteria 2674
145 Ga0075433_10159311 3300006852 Unclassified 2008
146 Ga0075433_10221800 3300006852 Bacteria 1679
147 Ga0075433_10265167 3300006852 Bacteria 1522
148 Ga0075433_10302332 3300006852 Bacteria 1417
149 Ga0075434_100043715 3300006871 Bacteria 4443
150 Ga0075434_100093033 3300006871 Bacteria 3018
151 Ga0068865_100039248 3300006881 Bacteria 3211
152 Ga0068865_100351181 3300006881 Bacteria 1195
153 Ga0075436_100011292 3300006914 Bacteria 6127
154 Ga0097620_100003420 3300006931 Bacteria 16147
155 Ga0097620_100067445 3300006931 Bacteria 3612
156 Ga0097620_100100944 3300006931 Bacteria 2942
157 Ga0097620_100177622 3300006931 Unclassified 2211
158 Ga0097620_100217644 3300006931 Unclassified 1997
159 Ga0097620_100278910 3300006931 Bacteria 1764
160 Ga0097620_100314211 3300006931 Unclassified 1660
161 Ga0097620_100337413 3300006931 Bacteria 1601
162 Ga0075435_100020304 3300007076 Bacteria 5087
163 Ga0075435_100360685 3300007076 Bacteria 1247
164 Ga0105240_10070032 3300009093 Bacteria 4340
165 Ga0105240_10126484 3300009093 Bacteria 3071
166 Ga0111539_10055292 3300009094 Bacteria 4718
167 Ga0111539_10079813 3300009094 Bacteria 3849
168 Ga0111539_10217619 3300009094 Bacteria 2225
169 Ga0111539_10372620 3300009094 Bacteria 1662
170 Ga0105245_10241587 3300009098 Bacteria 1751
171 Ga0105245_10422001 3300009098 Bacteria 1337
172 Ga0105247_10011552 3300009101 Bacteria 5319
173 Ga0114129_10024975 3300009147 Bacteria 8471
174 Ga0114129_10042951 3300009147 Bacteria 6362
175 Ga0114129_10064145 3300009147 Bacteria 5126
176 Ga0114129_10197578 3300009147 Bacteria 2727
177 Ga0114129_10808022 3300009147 Unclassified 1196
178 Ga0105243_10025479 3300009148 Bacteria 4520
179 Ga0105243_10632814 3300009148 Unclassified 1034
180 Ga0105241_10057615 3300009174 Bacteria 2981
181 Ga0105241_10071905 3300009174 Bacteria 2686
182 Ga0105241_10105227 3300009174 Bacteria 2250
183 Ga0105241_10190230 3300009174 Bacteria 1708
184 Ga0105241_10534009 3300009174 Bacteria 1051
185 Ga0105242_10082404 3300009176 Bacteria 2692
186 Ga0105248_10015165 3300009177 Bacteria 8491
187 Ga0105248_10079059 3300009177 Unclassified 3696
188 Ga0105237_10000199 3300009545 Bacteria 85277
189 Ga0105237_10085900 3300009545 Bacteria 3136
190 Ga0105237_10655577 3300009545 Bacteria 1056
191 Ga0105238_10000757 3300009551 Bacteria 33583
192 Ga0105238_10480826 3300009551 Bacteria 1241
193 Ga0105249_10003242 3300009553 Bacteria 14097
194 Ga0105249_10013467 3300009553 Bacteria 7221
195 Ga0105249_10019615 3300009553 Bacteria 6034
196 Ga0105249_10028981 3300009553 Bacteria 4999
197 Ga0105249_10084896 3300009553 Unclassified 2949
198 Ga0105239_10029199 3300010375 Bacteria 6063
199 Ga0105239_10131419 3300010375 Bacteria 2785
200 Ga0105239_10511530 3300010375 Unclassified 1366
201 Ga0105246_10137211 3300011119 Unclassified 1835
202 Ga0157373_10001437 3300013100 Bacteria 18176
203 Ga0157373_10026289 3300013100 Bacteria 4206
204 Ga0157371_10303047 3300013102 Unclassified 1157
205 Ga0157378_10760588 3300013297 Bacteria 992
206 Ga0163162_10042076 3300013306 Bacteria 4571
207 Ga0163162_10047576 3300013306 Bacteria 4299
208 Ga0163162_10063012 3300013306 Bacteria 3749
209 Ga0163162_10132631 3300013306 Unclassified 2600
210 Ga0163162_10920729 3300013306 Unclassified 986
211 Ga0157372_10172841 3300013307 Bacteria 2500
212 Ga0157375_10009873 3300013308 Bacteria 8396
213 Ga0157375_10272401 3300013308 Bacteria 1855
214 Ga0157375_10306157 3300013308 Bacteria 1753
215 Ga0157375_10317133 3300013308 Bacteria 1723
216 Ga0163163_10003830 3300014325 Bacteria 12806
217 Ga0163163_10006094 3300014325 Unclassified 10497
218 Ga0163163_10066606 3300014325 Bacteria 3578
219 Ga0163163_10120174 3300014325 Bacteria 2661
220 Ga0163163_10356737 3300014325 Unclassified 1518
221 Ga0163163_10535776 3300014325 Unclassified 1233
222 Ga0163163_10730452 3300014325 Bacteria 1054
223 Ga0157380_10001327 3300014326 Bacteria 16073
224 Ga0157377_10278728 3300014745 Unclassified 1095
225 Ga0157377_10310619 3300014745 Unclassified 1044
226 Ga0157376_10006206 3300014969 Bacteria 8422
227 Ga0157376_10130088 3300014969 Bacteria 2245
228 Ga0207697_10083682 3300025315 Bacteria 1346
229 Ga0207653_10004350 3300025885 Bacteria 4447
230 Ga0207710_10002265 3300025900 Bacteria 9006
231 Ga0207647_10033053 3300025904 Bacteria 3316
232 Ga0207647_10203215 3300025904 Unclassified 1146
233 Ga0207643_10005224 3300025908 Bacteria 6944
234 Ga0207684_10000355 3300025910 Bacteria 62655
235 Ga0207684_10013605 3300025910 Bacteria 7033
236 Ga0207654_10019161 3300025911 Bacteria 3606
237 Ga0207654_10072682 3300025911 Unclassified 2048
238 Ga0207707_10000190 3300025912 Bacteria 64802
239 Ga0207707_10042776 3300025912 Bacteria 3952
240 Ga0207707_10157268 3300025912 Bacteria 1988
241 Ga0207695_10053437 3300025913 Bacteria 4225
242 Ga0207671_10001695 3300025914 Bacteria 24956
243 Ga0207671_10023150 3300025914 Bacteria 4686
244 Ga0207660_10000117 3300025917 Bacteria 46029
245 Ga0207662_10043251 3300025918 Bacteria 2657
246 Ga0207652_10000028 3300025921 Bacteria 150429
247 Ga0207681_10003994 3300025923 Bacteria 9154
248 Ga0207681_10023400 3300025923 Bacteria 3951
249 Ga0207681_10076103 3300025923 Bacteria 2356
250 Ga0207681_10133255 3300025923 Bacteria 1840
251 Ga0207694_10000644 3300025924 Bacteria 31507
252 Ga0207650_10000061 3300025925 Bacteria 149822
253 Ga0207650_10069403 3300025925 Bacteria 2648
254 Ga0207659_10072617 3300025926 Bacteria 2516
255 Ga0207706_10211683 3300025933 Bacteria 1699
256 Ga0207686_10049377 3300025934 Bacteria 2611
257 Ga0207691_10018811 3300025940 Bacteria 6543
258 Ga0207711_10004468 3300025941 Bacteria 11924
259 Ga0207711_10061241 3300025941 Unclassified 3245
260 Ga0207711_10080349 3300025941 Bacteria 2848
261 Ga0207711_10106019 3300025941 Bacteria 2493
262 Ga0207689_10009396 3300025942 Bacteria 8445
263 Ga0207689_10039409 3300025942 Unclassified 3911
264 Ga0207689_10182132 3300025942 Bacteria 1732
265 Ga0207651_10001878 3300025960 Bacteria 9833
266 Ga0207651_10290175 3300025960 Bacteria 1356
267 Ga0207712_10001222 3300025961 Bacteria 17735
268 Ga0207712_10052782 3300025961 Bacteria 2849
269 Ga0207712_10087293 3300025961 Unclassified 2287
270 Ga0207712_10171418 3300025961 Bacteria 1697
271 Ga0207658_10063349 3300025986 Bacteria 2771
272 Ga0207658_10621763 3300025986 Bacteria 972
273 Ga0207677_10067702 3300026023 Bacteria 2502
274 Ga0207703_10250305 3300026035 Bacteria 1597
275 Ga0207703_10286232 3300026035 Bacteria 1498
276 Ga0207703_10420174 3300026035 Bacteria 1244
277 Ga0207639_10117523 3300026041 Bacteria 2179
278 Ga0207639_10274171 3300026041 Bacteria 1481
279 Ga0207708_10000040 3300026075 Bacteria 130242
280 Ga0207708_10005872 3300026075 Bacteria 9078
281 Ga0207708_10310454 3300026075 Bacteria 1285
282 Ga0207641_10273177 3300026088 Bacteria 1587
283 Ga0207641_10799918 3300026088 Unclassified 933
284 Ga0207648_10025251 3300026089 Bacteria 5294
285 Ga0207648_10038164 3300026089 Bacteria 4227
286 Ga0207648_10302177 3300026089 Bacteria 1435
287 Ga0207676_10032608 3300026095 Bacteria 3927
288 Ga0207676_10134738 3300026095 Unclassified 2106
289 Ga0207676_10209196 3300026095 Bacteria 1729
290 Ga0207676_10505885 3300026095 Bacteria 1148
291 Ga0207674_10025119 3300026116 Bacteria 6357
292 Ga0207674_10130950 3300026116 Bacteria 2472
293 Ga0207674_10359405 3300026116 Bacteria 1408
294 Ga0207674_10629395 3300026116 Archaea 1036
295 Ga0207675_100003882 3300026118 Bacteria 14530
296 Ga0207675_100005219 3300026118 Bacteria 12502
297 Ga0207675_100044402 3300026118 Bacteria 4153
298 Ga0207683_10173174 3300026121 Bacteria 1955
299 Ga0207698_10272204 3300026142 Unclassified 1562
300 Ga0207698_10295086 3300026142 Bacteria 1506
301 Ga0207428_10143494 3300027907 Bacteria 1821
302 Ga0207428_10195838 3300027907 Bacteria 1522
303 Ga0268265_10246824 3300028380 Unclassified 1579
304 Ga0268265_10396608 3300028380 Bacteria 1274
305 Ga0268264_10064578 3300028381 Bacteria 3081
306 Ga0268264_10086270 3300028381 Bacteria 2696
307 Ga0268264_10137134 3300028381 Bacteria 2177
308 Ga0268264_10201004 3300028381 Bacteria 1823
309 Ga0307513_10166038 3300031456 Bacteria 2092
310 Ga0307408_100110205 3300031548 Bacteria 2113
311 Ga0307405_10017349 3300031731 Bacteria 3948
312 Ga0307405_10081443 3300031731 Bacteria 2116
313 Ga0307413_10091826 3300031824 Unclassified 1980
314 Ga0307416_100116464 3300032002 Bacteria 2369
315 Ga0307414_10391045 3300032004 Bacteria 1205
316 Ga0373940_0064578 3300035088 Unclassified 1054
317 Ga0373951_0001070 3300035091 Bacteria 7339
318 Ga0373941_0010516 3300035115 Bacteria 2366
319 Ga0373937_0224331 3300036401 Bacteria 1769
320 Ga0395899_0137399 3300037312 Bacteria 1742
321 Ga0395900_0090558 3300037418 Bacteria 3144
322 Ga0395900_0400413 3300037418 Bacteria 1337
323 Ga0395898_0105597 3300037466 Bacteria 2701
324 Ga0395898_0382622 3300037466 Unclassified 1342
325 Ga0395901_0095169 3300038443 Unclassified 3121
326 Ga0439458_0000953 3300042157 Bacteria 7452
327 Ga0451576_0144781 3300045051 Archaea 2478
328 Ga0495663_0000211 3300046525 Bacteria 23313
329 Ga0495668_0210119 3300046616 Unclassified 1065
330 Ga0495589_0088713 3300046794 Bacteria 1502
331 Ga0496102_0013085 3300048905 Bacteria 7181
332 Ga0496104_0052320 3300048907 Bacteria 3857
333 Ga0496104_0251590 3300048907 Bacteria 1680
334 Ga0496107_0163956 3300048910 Bacteria 1648
335 Ga0496107_0194073 3300048910 Bacteria 1509
336 Ga0496110_0126312 3300048913 Bacteria 2308
337 Ga0496112_0130250 3300048915 Bacteria 2487
338 Ga0496112_0138496 3300048915 Bacteria 2404
339 Ga0496112_0398254 3300048915 Bacteria 1317
340 Ga0496112_0720077 3300048915 Bacteria 925
341 Ga0496113_0129477 3300048916 Unclassified 1979
342 Ga0496113_0266164 3300048916 Bacteria 1370
343 Ga0501293_001422 3300049516 Bacteria 1808
344 Ga0501296_002676 3300049519 Bacteria 1877
345 Ga0501297_005469 3300049520 Bacteria 1330
346 Ga0501298_000395 3300049521 Bacteria 5927
347 Ga0501299_018597 3300049522 Bacteria 1250
348 Ga0501235_004426 3300049669 Bacteria 3034
349 Ga0501225_0020385 3300049705 Bacteria 1832
350 Ga0501283_001993 3300049779 Bacteria 2643
351 Ga0501212_017498 3300049851 Bacteria 1085
352 nmdc:mga05p37_276168_c1 3300050507 Bacteria 2006
353 nmdc:mga05p37_85067_c1 3300050507 Bacteria 3897
354 nmdc:mga05p37_991967_c1 3300050507 Bacteria 893
355 nmdc:mga09592_72593_c1 3300050508 Bacteria 2922
356 nmdc:mga0qj67_145889_c1 3300050509 Bacteria 1919
357 nmdc:mga06r32_100405_c1 3300050510 Bacteria 2839
358 nmdc:mga08y16_126025_c1 3300050511 Bacteria 2664
359 nmdc:mga08y16_139896_c1 3300050511 Bacteria 2516
360 nmdc:mga08y16_237028_c1 3300050511 Bacteria 1886
361 nmdc:mga08y16_29459_c1 3300050511 Bacteria 5784
362 nmdc:mga0n895_155044_c1 3300050512 Bacteria 2321
363 nmdc:mga0n895_91755_c1 3300050512 Bacteria 3040
364 nmdc:mga0rr50_7761_c1 3300050513 Bacteria 6648
365 nmdc:mga08x19_16358_c1 3300050514 Bacteria 4524
366 nmdc:mga0a205_300216_c1 3300050515 Bacteria 1479
367 nmdc:mga0a205_42292_c1 3300050515 Bacteria 4390
368 nmdc:mga0a205_653228_c1 3300050515 Unclassified 903
369 nmdc:mga0a205_75239_c1 3300050515 Bacteria 3263
370 Ga0157380_10356372
371 JGI24751J29686_10000138
372 JGI25406J46586_10022463
373 JGI25406J46586_10029861
374 rootL2_10103756
375 Ga0065714_10002189
376 Ga0065704_10001246
377 Ga0065704_10084449
378 Ga0065712_10067733
379 Ga0065712_10187621
380 Ga0065715_10091762
381 Ga0065715_10095014
382 Ga0065715_10103900
383 Ga0065715_10114044
384 Ga0065707_10003683
385 Ga0065707_10010121
386 Ga0070690_100010808
387 Ga0070690_100127287
388 Ga0070670_100000229
389 Ga0068869_100099944
390 Ga0068869_100250142
391 Ga0070680_100000115
392 Ga0070682_100002068
393 Ga0070682_100005279
394 Ga0068868_100017325
395 Ga0068868_100057863
396 Ga0068868_100224746
397 Ga0070687_100130427
398 Ga0070687_100168241
399 Ga0070692_10017993
400 Ga0070692_10258029
401 Ga0070668_100178959
402 Ga0070669_100009154
403 Ga0070669_100091198
404 Ga0070675_100082149
405 Ga0070675_100318142
406 Ga0070671_100028947
407 Ga0070673_100016853
408 Ga0070673_100182597
409 Ga0070673_100203381
410 Ga0070673_100447277
411 Ga0070667_100092070
412 Ga0070709_10371450
413 Ga0070701_10081919
414 Ga0070705_100010438
415 Ga0070705_100046748
416 Ga0070705_100056492
417 Ga0070700_100000022
418 Ga0070700_100003614
419 Ga0070694_100002196
420 Ga0070694_100027579
421 Ga0070694_100087586
422 Ga0070694_100116114
423 Ga0070694_100200400
424 Ga0070694_100329728
425 Ga0070708_100000833
426 Ga0070678_100302103
427 Ga0070662_100216008
428 Ga0070662_100239215
429 Ga0070681_10000336
430 Ga0070681_10002362
431 Ga0070681_10251483
432 Ga0068867_100064528
433 Ga0068867_100653791
434 Ga0070706_100008949
435 Ga0070706_100009369
436 Ga0070707_100038747
437 Ga0070698_100003271
438 Ga0070698_100016577
439 Ga0070698_100458220
440 Ga0070699_100006749
441 Ga0070699_100006813
442 Ga0070699_100044169
443 Ga0070679_100000256
444 Ga0070697_100022063
445 Ga0070697_100033945
446 Ga0070697_100175209
447 Ga0070697_100474709
448 Ga0068853_100005529
449 Ga0068853_100096355
450 Ga0070686_100011834
451 Ga0070695_100056441
452 Ga0070695_100133252
453 Ga0070696_100253882
454 Ga0070693_100002782
455 Ga0070693_100002890
456 Ga0070665_100084109
457 Ga0070704_100023577
458 Ga0068855_100268691
459 Ga0068857_100337663
460 Ga0068854_100026425
461 Ga0068856_100021598
462 Ga0070702_100002972
463 Ga0070702_100019607
464 Ga0070702_100038601
465 Ga0070702_100232879
466 Ga0068852_100044736
467 Ga0068852_100377045
468 Ga0068852_100706369
469 Ga0068859_100003420
470 Ga0068859_100067445
471 Ga0068859_100100947
472 Ga0068859_100177625
473 Ga0068859_100217640
474 Ga0068859_100278923
475 Ga0068859_100314221
476 Ga0068859_100337413
477 Ga0068864_100025605
478 Ga0068864_100035059
479 Ga0068864_100098960
480 Ga0068864_100225684
481 Ga0068864_100250746
482 Ga0068861_100001373
483 Ga0068861_100061052
484 Ga0068861_100120376
485 Ga0068861_100353128
486 Ga0068870_10023687
487 Ga0068870_10062691
488 Ga0068863_100606027
489 Ga0068858_100142804
490 Ga0068858_100680332
491 Ga0068860_100004165
492 Ga0068860_100062182
493 Ga0068860_100096229
494 Ga0068860_100131907
495 Ga0068860_100143095
496 Ga0068862_100033658
497 Ga0068862_100160238
498 Ga0068862_100231829
499 Ga0081539_10000193
500 Ga0081539_10000614
501 Ga0081539_10005808
502 Ga0081539_10102972
503 Ga0070716_100014262
504 Ga0097621_100003511
505 Ga0097621_100004561
506 Ga0097621_100015882
507 Ga0097621_100038990
508 Ga0068871_100023408
509 Ga0068871_100069189
510 Ga0075428_100127182
511 Ga0075428_100277604
512 Ga0075430_100072459
513 Ga0075431_100123231
514 Ga0075433_10159311
515 Ga0075433_10221800
516 Ga0075433_10265167
517 Ga0075433_10302332
518 Ga0075434_100043715
519 Ga0075434_100093033
520 Ga0068865_100039248
521 Ga0068865_100351181
522 Ga0075436_100011292
523 Ga0097620_100003420
524 Ga0097620_100067445
525 Ga0097620_100100944
526 Ga0097620_100177622
527 Ga0097620_100217644
528 Ga0097620_100278910
529 Ga0097620_100314211
530 Ga0097620_100337413
531 Ga0075435_100020304
532 Ga0075435_100360685
533 Ga0105240_10070032
534 Ga0105240_10126484
535 Ga0111539_10055292
536 Ga0111539_10079813
537 Ga0111539_10217619
538 Ga0111539_10372620
539 Ga0105245_10241587
540 Ga0105245_10422001
541 Ga0105247_10011552
542 Ga0114129_10024975
543 Ga0114129_10042951
544 Ga0114129_10064145
545 Ga0114129_10197578
546 Ga0114129_10808022
547 Ga0105243_10025479
548 Ga0105243_10632814
549 Ga0105241_10057615
550 Ga0105241_10071905
551 Ga0105241_10105227
552 Ga0105241_10190230
553 Ga0105241_10534009
554 Ga0105242_10082404
555 Ga0105248_10015165
556 Ga0105248_10079059
557 Ga0105237_10000199
558 Ga0105237_10085900
559 Ga0105237_10655577
560 Ga0105238_10000757
561 Ga0105238_10480826
562 Ga0105249_10003242
563 Ga0105249_10013467
564 Ga0105249_10019615
565 Ga0105249_10028981
566 Ga0105249_10084896
567 Ga0105239_10029199
568 Ga0105239_10131419
569 Ga0105239_10511530
570 Ga0105246_10137211
571 Ga0157373_10001437
572 Ga0157373_10026289
573 Ga0157371_10303047
574 Ga0157378_10760588
575 Ga0163162_10042076
576 Ga0163162_10047576
577 Ga0163162_10063012
578 Ga0163162_10132631
579 Ga0163162_10920729
580 Ga0157372_10172841
581 Ga0157375_10009873
582 Ga0157375_10272401
583 Ga0157375_10306157
584 Ga0157375_10317133
585 Ga0163163_10003830
586 Ga0163163_10006094
587 Ga0163163_10066606
588 Ga0163163_10120174
589 Ga0163163_10356737
590 Ga0163163_10535776
591 Ga0163163_10730452
592 Ga0157380_10001327
593 Ga0157377_10278728
594 Ga0157377_10310619
595 Ga0157376_10006206
596 Ga0157376_10130088
597 Ga0207697_10083682
598 Ga0207653_10004350
599 Ga0207710_10002265
600 Ga0207647_10033053
601 Ga0207647_10203215
602 Ga0207643_10005224
603 Ga0207684_10000355
604 Ga0207684_10013605
605 Ga0207654_10019161
606 Ga0207654_10072682
607 Ga0207707_10000190
608 Ga0207707_10042776
609 Ga0207707_10157268
610 Ga0207695_10053437
611 Ga0207671_10001695
612 Ga0207671_10023150
613 Ga0207660_10000117
614 Ga0207662_10043251
615 Ga0207652_10000028
616 Ga0207681_10003994
617 Ga0207681_10023400
618 Ga0207681_10076103
619 Ga0207681_10133255
620 Ga0207694_10000644
621 Ga0207650_10000061
622 Ga0207650_10069403
623 Ga0207659_10072617
624 Ga0207706_10211683
625 Ga0207686_10049377
626 Ga0207691_10018811
627 Ga0207711_10004468
628 Ga0207711_10061241
629 Ga0207711_10080349
630 Ga0207711_10106019
631 Ga0207689_10009396
632 Ga0207689_10039409
633 Ga0207689_10182132
634 Ga0207651_10001878
635 Ga0207651_10290175
636 Ga0207712_10001222
637 Ga0207712_10052782
638 Ga0207712_10087293
639 Ga0207712_10171418
640 Ga0207658_10063349
641 Ga0207658_10621763
642 Ga0207677_10067702
643 Ga0207703_10250305
644 Ga0207703_10286232
645 Ga0207703_10420174
646 Ga0207639_10117523
647 Ga0207639_10274171
648 Ga0207708_10000040
649 Ga0207708_10005872
650 Ga0207708_10310454
651 Ga0207641_10273177
652 Ga0207641_10799918
653 Ga0207648_10025251
654 Ga0207648_10038164
655 Ga0207648_10302177
656 Ga0207676_10032608
657 Ga0207676_10134738
658 Ga0207676_10209196
659 Ga0207676_10505885
660 Ga0207674_10025119
661 Ga0207674_10130950
662 Ga0207674_10359405
663 Ga0207674_10629395
664 Ga0207675_100003882
665 Ga0207675_100005219
666 Ga0207675_100044402
667 Ga0207683_10173174
668 Ga0207698_10272204
669 Ga0207698_10295086
670 Ga0207428_10143494
671 Ga0207428_10195838
672 Ga0268265_10246824
673 Ga0268265_10396608
674 Ga0268264_10064578
675 Ga0268264_10086270
676 Ga0268264_10137134
677 Ga0268264_10201004
678 Ga0307513_10166038
679 Ga0307408_100110205
680 Ga0307405_10017349
681 Ga0307405_10081443
682 Ga0307413_10091826
683 Ga0307416_100116464
684 Ga0307414_10391045
685 Ga0373940_0064578
686 Ga0373951_0001070
687 Ga0373941_0010516
688 Ga0373937_0224331
689 Ga0395899_0137399
690 Ga0395900_0090558
691 Ga0395900_0400413
692 Ga0395898_0105597
693 Ga0395898_0382622
694 Ga0395901_0095169
695 Ga0439458_0000953
696 Ga0451576_0144781
697 Ga0495663_0000211
698 Ga0495668_0210119
699 Ga0495589_0088713
700 Ga0496102_0013085
701 Ga0496104_0052320
702 Ga0496104_0251590
703 Ga0496107_0163956
704 Ga0496107_0194073
705 Ga0496110_0126312
706 Ga0496112_0130250
707 Ga0496112_0138496
708 Ga0496112_0398254
709 Ga0496112_0720077
710 Ga0496113_0129477
711 Ga0496113_0266164
712 Ga0501293_001422
713 Ga0501296_002676
714 Ga0501297_005469
715 Ga0501298_000395
716 Ga0501299_018597
717 Ga0501235_004426
718 Ga0501225_0020385
719 Ga0501283_001993
720 Ga0501212_017498
721 nmdc:mga05p37_276168_c1
722 nmdc:mga05p37_85067_c1
723 nmdc:mga05p37_991967_c1
724 nmdc:mga09592_72593_c1
725 nmdc:mga0qj67_145889_c1
726 nmdc:mga06r32_100405_c1
727 nmdc:mga08y16_126025_c1
728 nmdc:mga08y16_139896_c1
729 nmdc:mga08y16_237028_c1
730 nmdc:mga08y16_29459_c1
731 nmdc:mga0n895_155044_c1
732 nmdc:mga0n895_91755_c1
733 nmdc:mga0rr50_7761_c1
734 nmdc:mga08x19_16358_c1
735 nmdc:mga0a205_300216_c1
736 nmdc:mga0a205_42292_c1
737 nmdc:mga0a205_653228_c1
738 nmdc:mga0a205_75239_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

48

287

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
5inn-assembly3.cif.gz_C mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations 0.7863 39 273
5inm-assembly3.cif.gz_C mouse tdp2 protein, apo state with variable dna-binding grasp conformations 0.7769 40 271
5inn-assembly3.cif.gz_C mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations 0.7706 39 273
5inn-assembly5.cif.gz_E mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations 0.7674 39 273
6bt2-assembly1.cif.gz_A structure of the human nocturnin catalytic domain with bound sulfate anion 0.7649 39 273
ID Description Score Start End Superfamily
af_K7LWA0_1_126_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7503 42 171 3.60.10.10
af_I1MFA3_195_446_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7467 66 273 3.60.10.10
af_A0A0G2L2B6_26_265_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7428 39 272 3.60.10.10
af_A0A0G2KJV6_22_258_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7408 39 271 3.60.10.10
af_Q10L30_209_491_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7383 66 273 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A7W1KY32-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.8781 106 273 GO:0003824
AF-A0A7W1KY32-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.854 106 273 GO:0003824
AF-A0A2V8RXI9-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.8383 151 249
AF-A0A7W0RSM7-F1-model_v4 Endonuclease/exonuclease/phosphatase family protein 0.8261 1 273 GO:0004519
GO:0004527
AF-A0A1F9CHS0-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.8212 3 273 GO:0003824

Map