F425006

General Info

Members Datasets Scaffolds Average Seq Length
369 188 738 128

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10045997|Ga0105240_100459972
Length 133
Sequence MVSYRTPLGRARGLGSAKHGAGHWVSERVSAVALVPLVLWAVYSVLRLAAGDYGLAVHWIQEPLNATLTALTLAISFWHMHSGLRVVVEDYIHKPSTKTVLLLLNLFICGLAGALAIVSILKVALGAGIPGGV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
180 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
181 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
182 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
185 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
186 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 0
Rhizoplane 2.98
Rhizosphere 85.37
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10045997 3300009093 Bacteria 5533
2 Ga0070658_10250829 3300005327 Bacteria 1501
3 Ga0070658_10509915 3300005327 Bacteria 1039
4 Ga0070658_11318320 3300005327 Bacteria 627
5 Ga0070670_100000022 3300005331 Bacteria 199146
6 Ga0070670_100008284 3300005331 Bacteria 8852
7 Ga0070670_100064289 3300005331 Bacteria 3148
8 Ga0070666_10061848 3300005335 Bacteria 2535
9 Ga0070666_10069608 3300005335 Bacteria 2392
10 Ga0070680_100028839 3300005336 Bacteria 4454
11 Ga0070680_100454091 3300005336 Bacteria 1095
12 Ga0070682_101962339 3300005337 Bacteria 514
13 Ga0070660_100019021 3300005339 Bacteria 5029
14 Ga0070660_100116316 3300005339 Bacteria 2132
15 Ga0070668_100001210 3300005347 Bacteria 18336
16 Ga0070668_100001473 3300005347 Bacteria 16986
17 Ga0070668_100002730 3300005347 Bacteria 12988
18 Ga0070668_100005567 3300005347 Bacteria 9350
19 Ga0070668_100008709 3300005347 Bacteria 7535
20 Ga0070669_100365769 3300005353 Bacteria 1174
21 Ga0070669_101335898 3300005353 Bacteria 621
22 Ga0070671_100002674 3300005355 Bacteria 13814
23 Ga0070659_100000401 3300005366 Bacteria 32848
24 Ga0070659_100004146 3300005366 Bacteria 10334
25 Ga0070659_101016370 3300005366 Bacteria 728
26 Ga0070667_100000369 3300005367 Bacteria 49025
27 Ga0070667_100003026 3300005367 Bacteria 14453
28 Ga0070667_100003519 3300005367 Bacteria 13338
29 Ga0070667_100006181 3300005367 Bacteria 9958
30 Ga0070663_100665922 3300005455 Bacteria 882
31 Ga0070663_100893579 3300005455 Bacteria 767
32 Ga0070681_10024318 3300005458 Bacteria 6098
33 Ga0070707_102052967 3300005468 Bacteria 539
34 Ga0070679_100637585 3300005530 Bacteria 1008
35 Ga0070684_100414613 3300005535 Bacteria 1243
36 Ga0070684_101586239 3300005535 Bacteria 617
37 Ga0068853_100353822 3300005539 Bacteria 1367
38 Ga0068853_100455551 3300005539 Bacteria 1203
39 Ga0068853_101478529 3300005539 Bacteria 658
40 Ga0070665_100000744 3300005548 Bacteria 43397
41 Ga0070665_100001116 3300005548 Bacteria 33034
42 Ga0070665_100003682 3300005548 Bacteria 16246
43 Ga0070665_100069548 3300005548 Bacteria 3528
44 Ga0068855_100005132 3300005563 Bacteria 15968
45 Ga0068855_100664062 3300005563 Bacteria 1118
46 Ga0068856_100487553 3300005614 Bacteria 1253
47 Ga0068856_100712835 3300005614 Bacteria 1024
48 Ga0068856_101065371 3300005614 Bacteria 826
49 Ga0068852_100766509 3300005616 Bacteria 977
50 Ga0068852_101263947 3300005616 Bacteria 760
51 Ga0068852_101693451 3300005616 Bacteria 655
52 Ga0068859_100000658 3300005617 Bacteria 34599
53 Ga0068859_100002371 3300005617 Bacteria 19175
54 Ga0068859_100031461 3300005617 Bacteria 5329
55 Ga0068859_100252251 3300005617 Bacteria 1855
56 Ga0068864_100000839 3300005618 Bacteria 25903
57 Ga0068864_100034804 3300005618 Bacteria 4286
58 Ga0068864_100062080 3300005618 Bacteria 3237
59 Ga0068864_100206550 3300005618 Bacteria 1807
60 Ga0068864_100274540 3300005618 Bacteria 1572
61 Ga0068861_100009086 3300005719 Bacteria 6852
62 Ga0068861_100377255 3300005719 Bacteria 1252
63 Ga0068851_10753081 3300005834 Bacteria 603
64 Ga0068863_100000066 3300005841 Bacteria 117816
65 Ga0068863_100000119 3300005841 Bacteria 82539
66 Ga0068863_100038762 3300005841 Bacteria 4533
67 Ga0068863_100060862 3300005841 Bacteria 3570
68 Ga0068858_100000136 3300005842 Bacteria 77380
69 Ga0068858_100021034 3300005842 Bacteria 6095
70 Ga0068858_100033113 3300005842 Bacteria 4799
71 Ga0068858_100124584 3300005842 Bacteria 2412
72 Ga0068860_100000507 3300005843 Bacteria 48348
73 Ga0068860_100004156 3300005843 Bacteria 14835
74 Ga0068860_100030325 3300005843 Bacteria 5202
75 Ga0068860_100365218 3300005843 Bacteria 1423
76 Ga0068860_100859794 3300005843 Bacteria 922
77 Ga0068862_100000551 3300005844 Bacteria 39201
78 Ga0068862_100009027 3300005844 Bacteria 8252
79 Ga0068862_100051355 3300005844 Bacteria 3526
80 Ga0068862_100128830 3300005844 Bacteria 2237
81 Ga0068862_100332362 3300005844 Bacteria 1405
82 Ga0068862_100601767 3300005844 Bacteria 1055
83 Ga0068862_101139085 3300005844 Bacteria 776
84 Ga0068862_101997535 3300005844 Bacteria 590
85 Ga0068871_100936490 3300006358 Bacteria 804
86 Ga0068865_100006425 3300006881 Bacteria 7169
87 Ga0097620_100000658 3300006931 Bacteria 34599
88 Ga0097620_100002370 3300006931 Bacteria 19175
89 Ga0097620_100031461 3300006931 Bacteria 5329
90 Ga0097620_100252252 3300006931 Bacteria 1855
91 Ga0105250_10160827 3300009092 Bacteria 938
92 Ga0105250_10464539 3300009092 Bacteria 570
93 Ga0105240_10001530 3300009093 Bacteria 39246
94 Ga0105240_10046105 3300009093 Bacteria 5525
95 Ga0105240_11050806 3300009093 Bacteria 869
96 Ga0105240_12652391 3300009093 Unclassified 517
97 Ga0105245_10502665 3300009098 Bacteria 1228
98 Ga0105247_10072342 3300009101 Bacteria 2158
99 Ga0105247_10159895 3300009101 Bacteria 1491
100 Ga0105242_10234684 3300009176 Bacteria 1646
101 Ga0105248_10015425 3300009177 Bacteria 8422
102 Ga0105248_10059658 3300009177 Bacteria 4286
103 Ga0105248_10085556 3300009177 Bacteria 3548
104 Ga0105248_10733043 3300009177 Bacteria 1115
105 Ga0105248_11030793 3300009177 Bacteria 930
106 Ga0105237_10396084 3300009545 Bacteria 1386
107 Ga0105237_10723863 3300009545 Bacteria 1002
108 Ga0105237_11430168 3300009545 Bacteria 698
109 Ga0105238_10040122 3300009551 Bacteria 4744
110 Ga0105238_10074414 3300009551 Bacteria 3389
111 Ga0105238_10695259 3300009551 Bacteria 1029
112 Ga0105249_10000729 3300009553 Bacteria 29775
113 Ga0105249_10702952 3300009553 Bacteria 1071
114 Ga0105249_10749035 3300009553 Bacteria 1039
115 Ga0105249_10883060 3300009553 Bacteria 961
116 Ga0105239_10095925 3300010375 Bacteria 3276
117 Ga0105239_12318384 3300010375 Bacteria 625
118 Ga0105246_11984339 3300011119 Bacteria 561
119 Ga0157370_10669649 3300013104 Bacteria 948
120 Ga0157369_10500153 3300013105 Bacteria 1258
121 Ga0157369_12491339 3300013105 Bacteria 524
122 Ga0157374_11334266 3300013296 Bacteria 740
123 Ga0163162_10045864 3300013306 Bacteria 4380
124 Ga0163162_10083085 3300013306 Bacteria 3276
125 Ga0163162_10308761 3300013306 Bacteria 1714
126 Ga0157372_11921943 3300013307 Bacteria 680
127 Ga0157375_10226254 3300013308 Bacteria 2029
128 Ga0157375_11541527 3300013308 Bacteria 785
129 Ga0163163_10153373 3300014325 Bacteria 2347
130 Ga0163163_10275781 3300014325 Bacteria 1733
131 Ga0157379_10014780 3300014968 Bacteria 6846
132 Ga0157379_10160102 3300014968 Bacteria 2032
133 Ga0157379_10451462 3300014968 Bacteria 1187
134 Ga0157376_10906854 3300014969 Bacteria 900
135 Ga0163161_10387805 3300017792 Bacteria 1118
136 Ga0213876_10051493 3300021384 Bacteria 2176
137 Ga0213876_10074615 3300021384 Bacteria 1792
138 Ga0209148_1045450 3300025254 Bacteria 589
139 Ga0209148_1051810 3300025254 Bacteria 526
140 Ga0207696_1087832 3300025711 Bacteria 854
141 Ga0207710_10052110 3300025900 Bacteria 1839
142 Ga0207710_10169953 3300025900 Bacteria 1065
143 Ga0207680_10043398 3300025903 Bacteria 2637
144 Ga0207680_10083183 3300025903 Bacteria 2017
145 Ga0207680_10456866 3300025903 Bacteria 907
146 Ga0207680_10564106 3300025903 Bacteria 813
147 Ga0207705_10002440 3300025909 Bacteria 14339
148 Ga0207705_10123106 3300025909 Bacteria 1926
149 Ga0207705_10357722 3300025909 Bacteria 1125
150 Ga0207707_10015023 3300025912 Bacteria 6742
151 Ga0207695_10001848 3300025913 Bacteria 33178
152 Ga0207695_10101108 3300025913 Bacteria 2878
153 Ga0207695_10628676 3300025913 Bacteria 955
154 Ga0207695_10676260 3300025913 Bacteria 913
155 Ga0207660_10001844 3300025917 Bacteria 14129
156 Ga0207660_10958758 3300025917 Bacteria 698
157 Ga0207657_10002603 3300025919 Bacteria 19515
158 Ga0207657_10142211 3300025919 Bacteria 1960
159 Ga0207652_10002518 3300025921 Bacteria 15400
160 Ga0207681_10026115 3300025923 Bacteria 3764
161 Ga0207681_10045136 3300025923 Bacteria 2957
162 Ga0207681_10961215 3300025923 Bacteria 716
163 Ga0207694_10032459 3300025924 Bacteria 3997
164 Ga0207694_10180623 3300025924 Bacteria 1711
165 Ga0207694_10383312 3300025924 Bacteria 1167
166 Ga0207650_10000016 3300025925 Bacteria 361958
167 Ga0207650_10302331 3300025925 Bacteria 1307
168 Ga0207650_10383625 3300025925 Bacteria 1161
169 Ga0207650_10463000 3300025925 Bacteria 1056
170 Ga0207687_11221693 3300025927 Bacteria 646
171 Ga0207644_10001773 3300025931 Bacteria 13962
172 Ga0207690_10000315 3300025932 Bacteria 32724
173 Ga0207690_10783554 3300025932 Bacteria 787
174 Ga0207686_10433937 3300025934 Bacteria 1007
175 Ga0207704_10005030 3300025938 Bacteria 6081
176 Ga0207711_10007306 3300025941 Bacteria 9252
177 Ga0207711_10016569 3300025941 Bacteria 6120
178 Ga0207711_10208493 3300025941 Bacteria 1785
179 Ga0207711_10957526 3300025941 Bacteria 795
180 Ga0207711_11181764 3300025941 Bacteria 706
181 Ga0207667_10001958 3300025949 Bacteria 25792
182 Ga0207667_10640291 3300025949 Bacteria 1069
183 Ga0207667_10693544 3300025949 Bacteria 1021
184 Ga0207712_10000917 3300025961 Bacteria 21324
185 Ga0207712_10584724 3300025961 Bacteria 964
186 Ga0207712_10760319 3300025961 Bacteria 849
187 Ga0207668_10000019 3300025972 Bacteria 152108
188 Ga0207668_10001237 3300025972 Bacteria 15209
189 Ga0207668_10003918 3300025972 Bacteria 8777
190 Ga0207668_10004384 3300025972 Bacteria 8290
191 Ga0207668_10079734 3300025972 Bacteria 2369
192 Ga0207640_10897776 3300025981 Bacteria 774
193 Ga0207658_10000384 3300025986 Bacteria 43187
194 Ga0207658_10004069 3300025986 Bacteria 10210
195 Ga0207658_10046728 3300025986 Bacteria 3163
196 Ga0207658_10644373 3300025986 Bacteria 954
197 Ga0207677_11755374 3300026023 Bacteria 576
198 Ga0207703_10000065 3300026035 Bacteria 126087
199 Ga0207703_10033973 3300026035 Bacteria 4045
200 Ga0207703_10036267 3300026035 Bacteria 3924
201 Ga0207703_10128946 3300026035 Bacteria 2181
202 Ga0207639_10586678 3300026041 Bacteria 1026
203 Ga0207639_10976554 3300026041 Bacteria 793
204 Ga0207678_10257813 3300026067 Bacteria 1494
205 Ga0207678_10390270 3300026067 Bacteria 1204
206 Ga0207702_10325124 3300026078 Bacteria 1466
207 Ga0207641_10000011 3300026088 Bacteria 384362
208 Ga0207641_10002114 3300026088 Bacteria 18794
209 Ga0207641_10011447 3300026088 Bacteria 7283
210 Ga0207641_10040921 3300026088 Bacteria 3883
211 Ga0207641_10348647 3300026088 Bacteria 1410
212 Ga0207641_10402128 3300026088 Bacteria 1315
213 Ga0207641_12188896 3300026088 Archaea 553
214 Ga0207676_10000148 3300026095 Bacteria 61016
215 Ga0207676_10000408 3300026095 Bacteria 36341
216 Ga0207676_10126935 3300026095 Bacteria 2162
217 Ga0207676_11436020 3300026095 Bacteria 686
218 Ga0207674_11110550 3300026116 Bacteria 760
219 Ga0207675_100017063 3300026118 Bacteria 6783
220 Ga0207683_11643050 3300026121 Bacteria 592
221 Ga0207698_11220718 3300026142 Bacteria 766
222 Ga0209981_1017874 3300027378 Bacteria 1002
223 Ga0210000_1003770 3300027462 Bacteria 2192
224 Ga0209983_1064761 3300027665 Bacteria 810
225 Ga0268266_10000003 3300028379 Bacteria 1701703
226 Ga0268266_10000611 3300028379 Bacteria 48682
227 Ga0268266_10008520 3300028379 Bacteria 9112
228 Ga0268266_10034780 3300028379 Bacteria 4286
229 Ga0268266_10451982 3300028379 Bacteria 1221
230 Ga0268266_10569653 3300028379 Bacteria 1086
231 Ga0268265_10000798 3300028380 Bacteria 29969
232 Ga0268265_10009309 3300028380 Bacteria 6639
233 Ga0268265_10137992 3300028380 Bacteria 2037
234 Ga0268265_10261259 3300028380 Bacteria 1539
235 Ga0268264_10000207 3300028381 Bacteria 120086
236 Ga0268264_10024208 3300028381 Bacteria 4956
237 Ga0268264_10037659 3300028381 Bacteria 3988
238 Ga0268264_10499210 3300028381 Bacteria 1186
239 Ga0268264_10848318 3300028381 Bacteria 915
240 Ga0265337_1011927 3300028556 Bacteria 2976
241 Ga0265327_10021239 3300031251 Bacteria 3922
242 Ga0265327_10110564 3300031251 Bacteria 1314
243 Ga0307513_10000873 3300031456 Bacteria 43622
244 Ga0307513_10175153 3300031456 Bacteria 2017
245 Ga0307408_100932004 3300031548 Unclassified 797
246 Ga0307408_101076496 3300031548 Bacteria 745
247 Ga0307405_10381202 3300031731 Bacteria 1098
248 Ga0307405_12008483 3300031731 Bacteria 518
249 Ga0307413_11582498 3300031824 Bacteria 581
250 Ga0307406_10324665 3300031901 Bacteria 1192
251 Ga0307412_10170016 3300031911 Bacteria 1629
252 Ga0307409_100100639 3300031995 Bacteria 2396
253 Ga0307414_10297825 3300032004 Bacteria 1363
254 Ga0307414_10404461 3300032004 Bacteria 1186
255 Ga0307411_10042936 3300032005 Bacteria 2890
256 Ga0307510_10074057 3300033180 Bacteria 3368
257 Ga0373933_0138558 3300035724 Bacteria 1535
258 Ga0395899_0002650 3300037312 Bacteria 14420
259 Ga0395899_0042380 3300037312 Bacteria 3398
260 Ga0395899_0156351 3300037312 Bacteria 1613
261 Ga0395899_0648261 3300037312 Bacteria 667
262 Ga0395900_0000844 3300037418 Bacteria 40400
263 Ga0395900_0012276 3300037418 Bacteria 8761
264 Ga0395900_0019033 3300037418 Bacteria 7000
265 Ga0395900_0431643 3300037418 Bacteria 1276
266 Ga0395898_0041217 3300037466 Bacteria 4561
267 Ga0395898_0183232 3300037466 Bacteria 2001
268 Ga0395898_0250634 3300037466 Bacteria 1689
269 Ga0395905_0016609 3300037471 Bacteria 6996
270 Ga0395905_0152651 3300037471 Bacteria 2172
271 Ga0395905_0198069 3300037471 Bacteria 1883
272 Ga0395905_1230024 3300037471 Bacteria 652
273 Ga0436364_1412295 3300037853 Bacteria 2961
274 Ga0395901_0000052 3300038443 Bacteria 165888
275 Ga0395901_0048016 3300038443 Bacteria 4433
276 Ga0395901_0110710 3300038443 Bacteria 2883
277 Ga0395901_0377047 3300038443 Bacteria 1460
278 Ga0395901_0510964 3300038443 Bacteria 1222
279 Ga0436365_0397229 3300039437 Bacteria 2247
280 Ga0436365_0582657 3300039437 Bacteria 2672
281 Ga0436365_0817187 3300039437 Bacteria 4090
282 Ga0436365_0864244 3300039437 Bacteria 1138
283 Ga0451793_0136051 3300041452 Bacteria 762
284 Ga0439448_0241254 3300042005 Bacteria 637
285 Ga0466961_0149769 3300044693 Bacteria 1457
286 Ga0466963_0860092 3300044694 Bacteria 639
287 Ga0495592_0838507 3300046454 Bacteria 544
288 Ga0495590_0212708 3300046457 Bacteria 713
289 Ga0495629_0013215 3300046459 Bacteria 5961
290 Ga0495651_0245144 3300046462 Bacteria 1227
291 Ga0495594_0260908 3300046499 Bacteria 987
292 Ga0495583_0033560 3300046506 Bacteria 2468
293 Ga0495583_0361863 3300046506 Bacteria 572
294 Ga0495606_0049101 3300046507 Bacteria 2770
295 Ga0495610_0046980 3300046512 Bacteria 2126
296 Ga0495620_0007333 3300046515 Bacteria 6001
297 Ga0495628_0215909 3300046516 Bacteria 1442
298 Ga0495628_0466646 3300046516 Bacteria 915
299 Ga0495643_0015593 3300046522 Bacteria 4488
300 Ga0495648_0182158 3300046524 Bacteria 1067
301 Ga0495654_0328219 3300046530 Bacteria 619
302 Ga0495609_0067790 3300046538 Bacteria 1571
303 Ga0495597_0012073 3300046542 Bacteria 4174
304 Ga0495645_0010210 3300046543 Bacteria 6578
305 Ga0495622_0000495 3300046557 Bacteria 24692
306 Ga0495668_0032030 3300046616 Bacteria 2960
307 Ga0495625_0262410 3300046660 Bacteria 1117
308 Ga0495669_0095544 3300046684 Bacteria 1376
309 Ga0495613_0098420 3300046689 Bacteria 2114
310 Ga0495672_0061633 3300047320 Bacteria 2161
311 Ga0495687_026064 3300047443 Bacteria 2756
312 Ga0495593_0093012 3300047673 Bacteria 1552
313 Ga0496101_0697075 3300048904 Bacteria 802
314 Ga0496102_0204290 3300048905 Bacteria 1862
315 Ga0496102_0325710 3300048905 Bacteria 1447
316 Ga0496106_0236647 3300048909 Bacteria 1459
317 Ga0496106_0886252 3300048909 Bacteria 705
318 Ga0496107_0239888 3300048910 Bacteria 1349
319 Ga0496110_0776154 3300048913 Bacteria 862
320 Ga0496112_0097345 3300048915 Bacteria 2913
321 Ga0496113_0353621 3300048916 Bacteria 1179
322 Ga0496115_0096042 3300048918 Bacteria 2426
323 Ga0496116_0138666 3300048919 Bacteria 1372
324 Ga0496117_0008205 3300048920 Bacteria 9961
325 Ga0496118_0006590 3300048921 Bacteria 12681
326 Ga0496119_0045915 3300048922 Bacteria 2733
327 Ga0496121_0000035 3300048924 Bacteria 374316
328 Ga0501299_009322 3300049522 Bacteria 1616
329 Ga0501033_0007881 3300049570 Bacteria 8253
330 Ga0501033_0154849 3300049570 Bacteria 1652
331 Ga0501033_0342015 3300049570 Bacteria 1049
332 Ga0501034_0006662 3300049571 Bacteria 12386
333 Ga0501037_0026043 3300049573 Bacteria 4322
334 Ga0501037_0688386 3300049573 Bacteria 681
335 Ga0501043_0248359 3300049579 Bacteria 1371
336 Ga0501043_0390989 3300049579 Bacteria 1052
337 Ga0501047_0045116 3300049581 Bacteria 4261
338 Ga0501047_0319476 3300049581 Bacteria 1393
339 Ga0501047_0462030 3300049581 Bacteria 1098
340 Ga0501047_1254425 3300049581 Bacteria 555
341 Ga0501035_0386191 3300049822 Bacteria 1167
342 Ga0501044_0005064 3300049823 Bacteria 14707
343 Ga0501044_0410354 3300049823 Bacteria 1266
344 Ga0500635_0000258 3300053080 Bacteria 21708
345 Ga0500635_0236910 3300053080 Bacteria 714
346 Ga0500578_0207904 3300053086 Bacteria 1195
347 Ga0500647_0180470 3300053091 Bacteria 969
348 Ga0500583_0142419 3300053092 Bacteria 1192
349 Ga0500651_0048840 3300053093 Bacteria 2658
350 Ga0500566_0349228 3300053094 Bacteria 678
351 Ga0500641_0070629 3300053096 Bacteria 1469
352 Ga0500554_141814 3300053102 Bacteria 812
353 Ga0500562_001290 3300053108 Bacteria 6179
354 Ga0500569_007278 3300053109 Bacteria 2474
355 Ga0500595_003484 3300053119 Bacteria 7324
356 Ga0500608_353734 3300053122 Bacteria 519
357 Ga0500614_028051 3300053123 Bacteria 1357
358 Ga0500559_0011093 3300053136 Bacteria 3858
359 Ga0500590_007299 3300053148 Bacteria 5447
360 Ga0500619_125029 3300053154 Bacteria 876
361 Ga0500638_066874 3300053162 Bacteria 1722
362 Ga0500639_248173 3300053163 Bacteria 716
363 Ga0500636_0246218 3300053177 Bacteria 914
364 Ga0500637_0282195 3300053178 Bacteria 913
365 Ga0500637_0326059 3300053178 Bacteria 827
366 Ga0500576_064078 3300053725 Bacteria 1599
367 Ga0500625_002361 3300053729 Bacteria 7048
368 Ga0500645_034668 3300053730 Bacteria 1507
369 2643998714 2643221598 Bacteria 4578346
370 Ga0105240_10045997
371 Ga0070658_10250829
372 Ga0070658_10509915
373 Ga0070658_11318320
374 Ga0070670_100000022
375 Ga0070670_100008284
376 Ga0070670_100064289
377 Ga0070666_10061848
378 Ga0070666_10069608
379 Ga0070680_100028839
380 Ga0070680_100454091
381 Ga0070682_101962339
382 Ga0070660_100019021
383 Ga0070660_100116316
384 Ga0070668_100001210
385 Ga0070668_100001473
386 Ga0070668_100002730
387 Ga0070668_100005567
388 Ga0070668_100008709
389 Ga0070669_100365769
390 Ga0070669_101335898
391 Ga0070671_100002674
392 Ga0070659_100000401
393 Ga0070659_100004146
394 Ga0070659_101016370
395 Ga0070667_100000369
396 Ga0070667_100003026
397 Ga0070667_100003519
398 Ga0070667_100006181
399 Ga0070663_100665922
400 Ga0070663_100893579
401 Ga0070681_10024318
402 Ga0070707_102052967
403 Ga0070679_100637585
404 Ga0070684_100414613
405 Ga0070684_101586239
406 Ga0068853_100353822
407 Ga0068853_100455551
408 Ga0068853_101478529
409 Ga0070665_100000744
410 Ga0070665_100001116
411 Ga0070665_100003682
412 Ga0070665_100069548
413 Ga0068855_100005132
414 Ga0068855_100664062
415 Ga0068856_100487553
416 Ga0068856_100712835
417 Ga0068856_101065371
418 Ga0068852_100766509
419 Ga0068852_101263947
420 Ga0068852_101693451
421 Ga0068859_100000658
422 Ga0068859_100002371
423 Ga0068859_100031461
424 Ga0068859_100252251
425 Ga0068864_100000839
426 Ga0068864_100034804
427 Ga0068864_100062080
428 Ga0068864_100206550
429 Ga0068864_100274540
430 Ga0068861_100009086
431 Ga0068861_100377255
432 Ga0068851_10753081
433 Ga0068863_100000066
434 Ga0068863_100000119
435 Ga0068863_100038762
436 Ga0068863_100060862
437 Ga0068858_100000136
438 Ga0068858_100021034
439 Ga0068858_100033113
440 Ga0068858_100124584
441 Ga0068860_100000507
442 Ga0068860_100004156
443 Ga0068860_100030325
444 Ga0068860_100365218
445 Ga0068860_100859794
446 Ga0068862_100000551
447 Ga0068862_100009027
448 Ga0068862_100051355
449 Ga0068862_100128830
450 Ga0068862_100332362
451 Ga0068862_100601767
452 Ga0068862_101139085
453 Ga0068862_101997535
454 Ga0068871_100936490
455 Ga0068865_100006425
456 Ga0097620_100000658
457 Ga0097620_100002370
458 Ga0097620_100031461
459 Ga0097620_100252252
460 Ga0105250_10160827
461 Ga0105250_10464539
462 Ga0105240_10001530
463 Ga0105240_10046105
464 Ga0105240_11050806
465 Ga0105240_12652391
466 Ga0105245_10502665
467 Ga0105247_10072342
468 Ga0105247_10159895
469 Ga0105242_10234684
470 Ga0105248_10015425
471 Ga0105248_10059658
472 Ga0105248_10085556
473 Ga0105248_10733043
474 Ga0105248_11030793
475 Ga0105237_10396084
476 Ga0105237_10723863
477 Ga0105237_11430168
478 Ga0105238_10040122
479 Ga0105238_10074414
480 Ga0105238_10695259
481 Ga0105249_10000729
482 Ga0105249_10702952
483 Ga0105249_10749035
484 Ga0105249_10883060
485 Ga0105239_10095925
486 Ga0105239_12318384
487 Ga0105246_11984339
488 Ga0157370_10669649
489 Ga0157369_10500153
490 Ga0157369_12491339
491 Ga0157374_11334266
492 Ga0163162_10045864
493 Ga0163162_10083085
494 Ga0163162_10308761
495 Ga0157372_11921943
496 Ga0157375_10226254
497 Ga0157375_11541527
498 Ga0163163_10153373
499 Ga0163163_10275781
500 Ga0157379_10014780
501 Ga0157379_10160102
502 Ga0157379_10451462
503 Ga0157376_10906854
504 Ga0163161_10387805
505 Ga0213876_10051493
506 Ga0213876_10074615
507 Ga0209148_1045450
508 Ga0209148_1051810
509 Ga0207696_1087832
510 Ga0207710_10052110
511 Ga0207710_10169953
512 Ga0207680_10043398
513 Ga0207680_10083183
514 Ga0207680_10456866
515 Ga0207680_10564106
516 Ga0207705_10002440
517 Ga0207705_10123106
518 Ga0207705_10357722
519 Ga0207707_10015023
520 Ga0207695_10001848
521 Ga0207695_10101108
522 Ga0207695_10628676
523 Ga0207695_10676260
524 Ga0207660_10001844
525 Ga0207660_10958758
526 Ga0207657_10002603
527 Ga0207657_10142211
528 Ga0207652_10002518
529 Ga0207681_10026115
530 Ga0207681_10045136
531 Ga0207681_10961215
532 Ga0207694_10032459
533 Ga0207694_10180623
534 Ga0207694_10383312
535 Ga0207650_10000016
536 Ga0207650_10302331
537 Ga0207650_10383625
538 Ga0207650_10463000
539 Ga0207687_11221693
540 Ga0207644_10001773
541 Ga0207690_10000315
542 Ga0207690_10783554
543 Ga0207686_10433937
544 Ga0207704_10005030
545 Ga0207711_10007306
546 Ga0207711_10016569
547 Ga0207711_10208493
548 Ga0207711_10957526
549 Ga0207711_11181764
550 Ga0207667_10001958
551 Ga0207667_10640291
552 Ga0207667_10693544
553 Ga0207712_10000917
554 Ga0207712_10584724
555 Ga0207712_10760319
556 Ga0207668_10000019
557 Ga0207668_10001237
558 Ga0207668_10003918
559 Ga0207668_10004384
560 Ga0207668_10079734
561 Ga0207640_10897776
562 Ga0207658_10000384
563 Ga0207658_10004069
564 Ga0207658_10046728
565 Ga0207658_10644373
566 Ga0207677_11755374
567 Ga0207703_10000065
568 Ga0207703_10033973
569 Ga0207703_10036267
570 Ga0207703_10128946
571 Ga0207639_10586678
572 Ga0207639_10976554
573 Ga0207678_10257813
574 Ga0207678_10390270
575 Ga0207702_10325124
576 Ga0207641_10000011
577 Ga0207641_10002114
578 Ga0207641_10011447
579 Ga0207641_10040921
580 Ga0207641_10348647
581 Ga0207641_10402128
582 Ga0207641_12188896
583 Ga0207676_10000148
584 Ga0207676_10000408
585 Ga0207676_10126935
586 Ga0207676_11436020
587 Ga0207674_11110550
588 Ga0207675_100017063
589 Ga0207683_11643050
590 Ga0207698_11220718
591 Ga0209981_1017874
592 Ga0210000_1003770
593 Ga0209983_1064761
594 Ga0268266_10000003
595 Ga0268266_10000611
596 Ga0268266_10008520
597 Ga0268266_10034780
598 Ga0268266_10451982
599 Ga0268266_10569653
600 Ga0268265_10000798
601 Ga0268265_10009309
602 Ga0268265_10137992
603 Ga0268265_10261259
604 Ga0268264_10000207
605 Ga0268264_10024208
606 Ga0268264_10037659
607 Ga0268264_10499210
608 Ga0268264_10848318
609 Ga0265337_1011927
610 Ga0265327_10021239
611 Ga0265327_10110564
612 Ga0307513_10000873
613 Ga0307513_10175153
614 Ga0307408_100932004
615 Ga0307408_101076496
616 Ga0307405_10381202
617 Ga0307405_12008483
618 Ga0307413_11582498
619 Ga0307406_10324665
620 Ga0307412_10170016
621 Ga0307409_100100639
622 Ga0307414_10297825
623 Ga0307414_10404461
624 Ga0307411_10042936
625 Ga0307510_10074057
626 Ga0373933_0138558
627 Ga0395899_0002650
628 Ga0395899_0042380
629 Ga0395899_0156351
630 Ga0395899_0648261
631 Ga0395900_0000844
632 Ga0395900_0012276
633 Ga0395900_0019033
634 Ga0395900_0431643
635 Ga0395898_0041217
636 Ga0395898_0183232
637 Ga0395898_0250634
638 Ga0395905_0016609
639 Ga0395905_0152651
640 Ga0395905_0198069
641 Ga0395905_1230024
642 Ga0436364_1412295
643 Ga0395901_0000052
644 Ga0395901_0048016
645 Ga0395901_0110710
646 Ga0395901_0377047
647 Ga0395901_0510964
648 Ga0436365_0397229
649 Ga0436365_0582657
650 Ga0436365_0817187
651 Ga0436365_0864244
652 Ga0451793_0136051
653 Ga0439448_0241254
654 Ga0466961_0149769
655 Ga0466963_0860092
656 Ga0495592_0838507
657 Ga0495590_0212708
658 Ga0495629_0013215
659 Ga0495651_0245144
660 Ga0495594_0260908
661 Ga0495583_0033560
662 Ga0495583_0361863
663 Ga0495606_0049101
664 Ga0495610_0046980
665 Ga0495620_0007333
666 Ga0495628_0215909
667 Ga0495628_0466646
668 Ga0495643_0015593
669 Ga0495648_0182158
670 Ga0495654_0328219
671 Ga0495609_0067790
672 Ga0495597_0012073
673 Ga0495645_0010210
674 Ga0495622_0000495
675 Ga0495668_0032030
676 Ga0495625_0262410
677 Ga0495669_0095544
678 Ga0495613_0098420
679 Ga0495672_0061633
680 Ga0495687_026064
681 Ga0495593_0093012
682 Ga0496101_0697075
683 Ga0496102_0204290
684 Ga0496102_0325710
685 Ga0496106_0236647
686 Ga0496106_0886252
687 Ga0496107_0239888
688 Ga0496110_0776154
689 Ga0496112_0097345
690 Ga0496113_0353621
691 Ga0496115_0096042
692 Ga0496116_0138666
693 Ga0496117_0008205
694 Ga0496118_0006590
695 Ga0496119_0045915
696 Ga0496121_0000035
697 Ga0501299_009322
698 Ga0501033_0007881
699 Ga0501033_0154849
700 Ga0501033_0342015
701 Ga0501034_0006662
702 Ga0501037_0026043
703 Ga0501037_0688386
704 Ga0501043_0248359
705 Ga0501043_0390989
706 Ga0501047_0045116
707 Ga0501047_0319476
708 Ga0501047_0462030
709 Ga0501047_1254425
710 Ga0501035_0386191
711 Ga0501044_0005064
712 Ga0501044_0410354
713 Ga0500635_0000258
714 Ga0500635_0236910
715 Ga0500578_0207904
716 Ga0500647_0180470
717 Ga0500583_0142419
718 Ga0500651_0048840
719 Ga0500566_0349228
720 Ga0500641_0070629
721 Ga0500554_141814
722 Ga0500562_001290
723 Ga0500569_007278
724 Ga0500595_003484
725 Ga0500608_353734
726 Ga0500614_028051
727 Ga0500559_0011093
728 Ga0500590_007299
729 Ga0500619_125029
730 Ga0500638_066874
731 Ga0500639_248173
732 Ga0500636_0246218
733 Ga0500637_0282195
734 Ga0500637_0326059
735 Ga0500576_064078
736 Ga0500625_002361
737 Ga0500645_034668
738 2643998714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

2

121

0.86

PF05328

CybS

CybS, succinate dehydrogenase cytochrome B small subunit

12

126

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.8976 18 121
6lum-assembly1.cif.gz_N structure of mycobacterium smegmatis succinate dehydrogenase 2 0.888 23 121
3abv-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide 0.8813 23 121
4yxd-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with flutolanil 0.8606 16 120
4ytp-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide 0.8537 16 121
ID Description Score Start End Superfamily
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9035 19 121 1.20.1300.10
3ae3D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8869 23 120 1.20.1300.10
3aedD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8837 23 121 1.20.1300.10
3abvD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8813 23 121 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8799 19 121 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A537NCS2-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9805 20 126 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-X6EMJ3-F1-model_v4 Succinate dehydrogenase 0.9788 26 124 GO:0006099
GO:0016020
GO:0020037
AF-A0A251WMT3-F1-model_v4 deleted 0.9771 29 127
AF-A0A6J4L7T2-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9758 30 127 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A258C8M7-F1-model_v4 deleted 0.9744 56 130

Map