F424974

General Info

Members Datasets Scaffolds Average Seq Length
369 236 368 203

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_101082173|Ga0068860_1010821731
Length 234
Sequence MRTLILNAFSIGTDADAKNRNTEHSNQTNMKVLVVYHTTYGHTLQLARAVEAGVKSVAGVEAVFRRAPEFPHVEKELEAGDGYATKIWKDQKDIQPCTLDDLREADGLLLGSPTRYGNMCAPMKALIDSTASLWLAGAMEGKPAGVFTSTATTHGGQETTCLTMMIPLIHLGMLIVGVPYSTEGMLHTEGRGGSPYGASTTAGPKGELAPTAEDLAICHAQGKRVAELAKKIRG

Samples

Sample ID Description Type Environment
1 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
76 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
134 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
150 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
225 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 4.88
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10207615 3300003323 Bacteria 1360
2 Ga0070658_10161492 3300005327 Bacteria 1880
3 Ga0070676_10072917 3300005328 Bacteria 2065
4 Ga0070676_10121718 3300005328 Bacteria 1639
5 Ga0070676_10298195 3300005328 Bacteria 1092
6 Ga0070690_100056815 3300005330 Bacteria 2510
7 Ga0070670_100113154 3300005331 Bacteria 2339
8 Ga0070670_100282692 3300005331 Bacteria 1449
9 Ga0070670_100361169 3300005331 Bacteria 1277
10 Ga0068869_100147370 3300005334 Bacteria 1823
11 Ga0070680_100088378 3300005336 Bacteria 2563
12 Ga0070680_100357285 3300005336 Bacteria 1242
13 Ga0070680_100809710 3300005336 Unclassified 807
14 Ga0070689_100004872 3300005340 Bacteria 9113
15 Ga0070689_100657728 3300005340 Bacteria 912
16 Ga0070687_100145371 3300005343 Bacteria 1385
17 Ga0070692_10181920 3300005345 Bacteria 1219
18 Ga0070668_100036257 3300005347 Bacteria 3763
19 Ga0070668_100046075 3300005347 Bacteria 3347
20 Ga0070675_100037838 3300005354 Bacteria 3932
21 Ga0070671_100049682 3300005355 Bacteria 3489
22 Ga0070674_100279561 3300005356 Bacteria 1322
23 Ga0070674_100575054 3300005356 Unclassified 949
24 Ga0070673_100050222 3300005364 Bacteria 3260
25 Ga0070688_100057581 3300005365 Bacteria 2444
26 Ga0070688_100186540 3300005365 Bacteria 1442
27 Ga0070688_100347627 3300005365 Unclassified 1085
28 Ga0070667_100016812 3300005367 Bacteria 6052
29 Ga0070714_100483771 3300005435 Unclassified 1179
30 Ga0070710_10190922 3300005437 Bacteria 1288
31 Ga0070701_10003524 3300005438 Bacteria 6208
32 Ga0070701_10006470 3300005438 Bacteria 4932
33 Ga0070701_10017144 3300005438 Bacteria 3381
34 Ga0070701_10133099 3300005438 Bacteria 1415
35 Ga0070705_100052681 3300005440 Bacteria 2379
36 Ga0070700_100009507 3300005441 Bacteria 5342
37 Ga0070700_100021156 3300005441 Bacteria 3778
38 Ga0070700_100044700 3300005441 Bacteria 2730
39 Ga0070694_100012754 3300005444 Bacteria 5234
40 Ga0070694_100165316 3300005444 Bacteria 1626
41 Ga0070708_100838421 3300005445 Unclassified 864
42 Ga0070663_100182062 3300005455 Bacteria 1631
43 Ga0070678_100039222 3300005456 Bacteria 3339
44 Ga0070662_100111736 3300005457 Bacteria 2082
45 Ga0070681_10630063 3300005458 Bacteria 987
46 Ga0068867_100026802 3300005459 Bacteria 4140
47 Ga0070706_100012325 3300005467 Bacteria 7923
48 Ga0070679_100860365 3300005530 Bacteria 850
49 Ga0070684_100773525 3300005535 Bacteria 897
50 Ga0070697_100126883 3300005536 Bacteria 2137
51 Ga0068853_100267822 3300005539 Bacteria 1572
52 Ga0068853_100331165 3300005539 Bacteria 1413
53 Ga0070672_100074559 3300005543 Bacteria 2707
54 Ga0070672_100124967 3300005543 Bacteria 2109
55 Ga0070672_100563250 3300005543 Bacteria 990
56 Ga0070686_100123852 3300005544 Bacteria 1778
57 Ga0070686_100141388 3300005544 Bacteria 1676
58 Ga0070686_100404707 3300005544 Bacteria 1039
59 Ga0070665_100002677 3300005548 Bacteria 19359
60 Ga0070665_100747456 3300005548 Unclassified 991
61 Ga0070665_100810811 3300005548 Unclassified 949
62 Ga0070665_101288104 3300005548 Bacteria 741
63 Ga0070704_100122502 3300005549 Bacteria 2001
64 Ga0070704_100169950 3300005549 Bacteria 1733
65 Ga0068855_100906012 3300005563 Bacteria 931
66 Ga0070664_100062665 3300005564 Bacteria 3170
67 Ga0068856_100108835 3300005614 Bacteria 2767
68 Ga0068859_100045556 3300005617 Bacteria 4406
69 Ga0068859_100098704 3300005617 Bacteria 2975
70 Ga0068859_100674887 3300005617 Bacteria 1125
71 Ga0068859_100940487 3300005617 Bacteria 948
72 Ga0068864_100230227 3300005618 Bacteria 1714
73 Ga0068864_100379511 3300005618 Bacteria 1339
74 Ga0068866_10505043 3300005718 Bacteria 801
75 Ga0068861_100010454 3300005719 Bacteria 6440
76 Ga0068861_100029363 3300005719 Bacteria 4023
77 Ga0068861_100155930 3300005719 Bacteria 1878
78 Ga0068861_100208283 3300005719 Bacteria 1646
79 Ga0068861_100292193 3300005719 Bacteria 1408
80 Ga0068870_10018764 3300005840 Bacteria 3345
81 Ga0068863_100026387 3300005841 Bacteria 5543
82 Ga0068863_100111294 3300005841 Bacteria 2608
83 Ga0068858_100323523 3300005842 Unclassified 1474
84 Ga0068860_101082173 3300005843 Bacteria 821
85 Ga0068860_101141876 3300005843 Bacteria 799
86 Ga0068862_100017279 3300005844 Bacteria 6004
87 Ga0068862_100097582 3300005844 Bacteria 2566
88 Ga0068862_100113779 3300005844 Bacteria 2378
89 Ga0068862_100432084 3300005844 Bacteria 1238
90 Ga0081455_10328186 3300005937 Unclassified 1087
91 Ga0081538_10018996 3300005981 Bacteria 5132
92 Ga0070717_10555253 3300006028 Bacteria 1040
93 Ga0075364_10011192 3300006051 Bacteria 5445
94 Ga0070715_10218746 3300006163 Bacteria 978
95 Ga0070715_10228636 3300006163 Bacteria 961
96 Ga0070712_100062442 3300006175 Bacteria 2634
97 Ga0097621_100046693 3300006237 Bacteria 3505
98 Ga0068871_100064869 3300006358 Bacteria 2990
99 Ga0068871_100148755 3300006358 Bacteria 1996
100 Ga0068871_100269936 3300006358 Unclassified 1486
101 Ga0068871_100907370 3300006358 Unclassified 817
102 Ga0075428_100002640 3300006844 Bacteria 19508
103 Ga0075430_100864720 3300006846 Bacteria 745
104 Ga0075431_100148965 3300006847 Unclassified 2410
105 Ga0075429_100009010 3300006880 Bacteria 8670
106 Ga0068865_100087787 3300006881 Bacteria 2248
107 Ga0097620_100045556 3300006931 Bacteria 4406
108 Ga0097620_100098699 3300006931 Bacteria 2975
109 Ga0097620_100674814 3300006931 Bacteria 1125
110 Ga0097620_100940603 3300006931 Bacteria 948
111 Ga0075435_100136380 3300007076 Bacteria 2056
112 Ga0105250_10228279 3300009092 Unclassified 791
113 Ga0105240_10091129 3300009093 Bacteria 3725
114 Ga0111539_10002857 3300009094 Bacteria 22942
115 Ga0111539_10168676 3300009094 Bacteria 2558
116 Ga0111539_10195423 3300009094 Bacteria 2360
117 Ga0111539_10418313 3300009094 Bacteria 1561
118 Ga0111539_11248369 3300009094 Bacteria 863
119 Ga0105242_10061386 3300009176 Bacteria 3091
120 Ga0105242_10888324 3300009176 Unclassified 890
121 Ga0105248_10012251 3300009177 Bacteria 9456
122 Ga0105248_10990548 3300009177 Unclassified 949
123 Ga0105237_10091663 3300009545 Bacteria 3029
124 Ga0105237_11091520 3300009545 Unclassified 805
125 Ga0105249_10393896 3300009553 Bacteria 1414
126 Ga0105249_11254568 3300009553 Bacteria 812
127 Ga0105239_10393244 3300010375 Unclassified 1568
128 Ga0105239_11139021 3300010375 Unclassified 898
129 Ga0157316_1000983 3300012510 Bacteria 1668
130 Ga0157327_1010426 3300012512 Bacteria 877
131 Ga0157371_10342383 3300013102 Bacteria 1088
132 Ga0157374_10217071 3300013296 Bacteria 1876
133 Ga0163162_10307604 3300013306 Bacteria 1717
134 Ga0157375_10947957 3300013308 Bacteria 1002
135 Ga0163163_10129614 3300014325 Bacteria 2562
136 Ga0157380_10006663 3300014326 Bacteria 8151
137 Ga0157380_10621107 3300014326 Bacteria 1073
138 Ga0157380_11566220 3300014326 Unclassified 714
139 Ga0157380_11666390 3300014326 Bacteria 695
140 Ga0157377_10082492 3300014745 Bacteria 1882
141 Ga0157377_10429835 3300014745 Bacteria 907
142 Ga0157376_10267009 3300014969 Bacteria 1606
143 Ga0163161_10032985 3300017792 Bacteria 3700
144 Ga0163161_10408625 3300017792 Bacteria 1090
145 Ga0163161_10435826 3300017792 Bacteria 1057
146 Ga0213873_10138652 3300021358 Unclassified 725
147 Ga0213872_10042459 3300021361 Bacteria 2073
148 Ga0213876_10229400 3300021384 Bacteria 987
149 Ga0207697_10159779 3300025315 Unclassified 983
150 Ga0207692_10090811 3300025898 Bacteria 1656
151 Ga0207692_10327397 3300025898 Bacteria 939
152 Ga0207685_10229872 3300025905 Unclassified 887
153 Ga0207699_10148572 3300025906 Unclassified 1548
154 Ga0207645_10077110 3300025907 Bacteria 2135
155 Ga0207645_10305968 3300025907 Bacteria 1059
156 Ga0207643_10008749 3300025908 Bacteria 5432
157 Ga0207671_10131459 3300025914 Bacteria 1921
158 Ga0207660_10064074 3300025917 Bacteria 2652
159 Ga0207660_10267845 3300025917 Bacteria 1353
160 Ga0207662_10086035 3300025918 Bacteria 1926
161 Ga0207662_10520601 3300025918 Bacteria 821
162 Ga0207650_10278371 3300025925 Bacteria 1362
163 Ga0207650_11094398 3300025925 Bacteria 678
164 Ga0207659_10031444 3300025926 Bacteria 3634
165 Ga0207659_11026773 3300025926 Bacteria 709
166 Ga0207664_10375834 3300025929 Unclassified 1261
167 Ga0207644_10055421 3300025931 Bacteria 2857
168 Ga0207690_10133187 3300025932 Bacteria 1822
169 Ga0207706_10107702 3300025933 Bacteria 2452
170 Ga0207706_10243807 3300025933 Bacteria 1571
171 Ga0207686_10194347 3300025934 Bacteria 1449
172 Ga0207709_10087768 3300025935 Bacteria 2023
173 Ga0207670_10028458 3300025936 Bacteria 3549
174 Ga0207669_10274972 3300025937 Bacteria 1267
175 Ga0207669_10946733 3300025937 Bacteria 721
176 Ga0207704_10363868 3300025938 Bacteria 1130
177 Ga0207665_10096919 3300025939 Bacteria 2052
178 Ga0207691_10006160 3300025940 Bacteria 11600
179 Ga0207691_10277543 3300025940 Unclassified 1442
180 Ga0207711_10854012 3300025941 Unclassified 847
181 Ga0207689_10209230 3300025942 Bacteria 1611
182 Ga0207689_10454303 3300025942 Bacteria 1071
183 Ga0207651_10008100 3300025960 Bacteria 5649
184 Ga0207651_10470433 3300025960 Unclassified 1082
185 Ga0207668_10144285 3300025972 Bacteria 1835
186 Ga0207668_10330289 3300025972 Bacteria 1268
187 Ga0207658_10188680 3300025986 Bacteria 1712
188 Ga0207677_10053482 3300026023 Bacteria 2749
189 Ga0207677_10128841 3300026023 Bacteria 1917
190 Ga0207677_10631252 3300026023 Bacteria 943
191 Ga0207639_11265503 3300026041 Unclassified 692
192 Ga0207678_10142155 3300026067 Bacteria 2048
193 Ga0207708_10007538 3300026075 Bacteria 8047
194 Ga0207708_10057015 3300026075 Bacteria 2980
195 Ga0207641_10038962 3300026088 Bacteria 3974
196 Ga0207641_10047242 3300026088 Bacteria 3629
197 Ga0207641_11227015 3300026088 Unclassified 750
198 Ga0207648_10148434 3300026089 Bacteria 2069
199 Ga0207676_10214227 3300026095 Bacteria 1711
200 Ga0207676_10384033 3300026095 Bacteria 1308
201 Ga0207674_10110091 3300026116 Bacteria 2730
202 Ga0207675_100004918 3300026118 Bacteria 12873
203 Ga0207675_100008703 3300026118 Bacteria 9539
204 Ga0207675_100023875 3300026118 Bacteria 5687
205 Ga0207675_100112753 3300026118 Bacteria 2567
206 Ga0207675_100269218 3300026118 Bacteria 1653
207 Ga0209966_1005328 3300027695 Bacteria 2206
208 Ga0207428_10069617 3300027907 Bacteria 2767
209 Ga0207428_10427078 3300027907 Bacteria 968
210 Ga0268266_10032613 3300028379 Bacteria 4425
211 Ga0268266_10668936 3300028379 Unclassified 1000
212 Ga0268266_11217307 3300028379 Bacteria 728
213 Ga0268265_10045349 3300028380 Bacteria 3280
214 Ga0265334_10000674 3300028573 Bacteria 17142
215 Ga0265338_10210542 3300028800 Bacteria 1459
216 Ga0307513_10041416 3300031456 Bacteria 5083
217 Ga0307408_100155395 3300031548 Bacteria 1811
218 Ga0307408_100305622 3300031548 Bacteria 1334
219 Ga0316575_10001563 3300031665 Bacteria 7433
220 Ga0316575_10035333 3300031665 Bacteria 1964
221 Ga0316579_10002096 3300031691 Bacteria 7469
222 Ga0316579_10002249 3300031691 Bacteria 7284
223 Ga0316579_10017125 3300031691 Bacteria 3176
224 Ga0316576_10022206 3300031727 Bacteria 4404
225 Ga0316578_10006046 3300031728 Bacteria 5932
226 Ga0316578_10006655 3300031728 Bacteria 5722
227 Ga0307405_10046406 3300031731 Bacteria 2669
228 Ga0307405_10109476 3300031731 Bacteria 1869
229 Ga0316577_10000063 3300031733 Bacteria 26076
230 Ga0316577_10004639 3300031733 Bacteria 7124
231 Ga0307413_10177814 3300031824 Bacteria 1513
232 Ga0307410_10275527 3300031852 Bacteria 1318
233 Ga0307406_10877738 3300031901 Bacteria 762
234 Ga0307407_10007981 3300031903 Bacteria 4828
235 Ga0307407_10713381 3300031903 Bacteria 756
236 Ga0307412_10108949 3300031911 Bacteria 1974
237 Ga0307409_100008604 3300031995 Bacteria 6208
238 Ga0307409_100125547 3300031995 Bacteria 2182
239 Ga0307409_100423726 3300031995 Bacteria 1277
240 Ga0307416_100180011 3300032002 Bacteria 1980
241 Ga0307416_100255964 3300032002 Bacteria 1707
242 Ga0307416_100377338 3300032002 Bacteria 1447
243 Ga0307414_10701643 3300032004 Bacteria 916
244 Ga0307411_10000994 3300032005 Bacteria 10923
245 Ga0307411_10140166 3300032005 Bacteria 1782
246 Ga0307411_10146256 3300032005 Bacteria 1750
247 Ga0307411_10680726 3300032005 Bacteria 894
248 Ga0307415_100073087 3300032126 Bacteria 2418
249 Ga0307415_100109682 3300032126 Bacteria 2045
250 Ga0307415_100710403 3300032126 Bacteria 908
251 Ga0316585_10000126 3300032137 Bacteria 14545
252 Ga0316585_10082623 3300032137 Bacteria 1047
253 Ga0316580_10013142 3300032139 Bacteria 2523
254 Ga0373946_0111674 3300035171 Bacteria 1238
255 Ga0316574_0008253 3300035398 Bacteria 5773
256 Ga0373931_0356223 3300035691 Bacteria 917
257 Ga0316582_0000031 3300036647 Bacteria 32888
258 Ga0316582_0014964 3300036647 Unclassified 4421
259 Ga0316584_0000691 3300036712 Bacteria 18615
260 Ga0395900_0220504 3300037418 Bacteria 1912
261 Ga0395900_0378915 3300037418 Bacteria 1383
262 Ga0395905_0024007 3300037471 Bacteria 5756
263 Ga0316581_0013730 3300037588 Bacteria 2300
264 Ga0316581_0064721 3300037588 Bacteria 1123
265 Ga0436364_0338218 3300037853 Bacteria 1769
266 Ga0436364_1341153 3300037853 Bacteria 1645
267 Ga0395901_0368819 3300038443 Bacteria 1479
268 Ga0436365_0488577 3300039437 Bacteria 1388
269 Ga0436365_1556496 3300039437 Bacteria 2180
270 Ga0436360_0265019 3300039438 Bacteria 3975
271 Ga0436361_0034353 3300039447 Bacteria 17185
272 Ga0436361_0732503 3300039447 Bacteria 2525
273 Ga0436363_0725312 3300039450 Bacteria 697
274 Ga0436363_1089669 3300039450 Bacteria 1073
275 Ga0436362_0283082 3300039453 Bacteria 2402
276 Ga0436362_0298087 3300039453 Unclassified 2250
277 Ga0436362_1041703 3300039453 Bacteria 5051
278 Ga0451791_0689834 3300041451 Bacteria 1837
279 Ga0451807_0532397 3300041486 Unclassified 2790
280 Ga0451837_0035691 3300041494 Bacteria 3072
281 Ga0451837_1498760 3300041494 Bacteria 3833
282 Ga0451853_1601092 3300041512 Bacteria 1357
283 Ga0450918_035344 3300042531 Bacteria 888
284 Ga0451577_0233718 3300042876 Bacteria 1663
285 Ga0453684_0002522 3300044712 Bacteria 44120
286 Ga0453684_0004933 3300044712 Bacteria 27211
287 Ga0453684_0009951 3300044712 Bacteria 16401
288 Ga0451576_0357647 3300045051 Bacteria 1529
289 Ga0495592_0257640 3300046454 Bacteria 1150
290 Ga0495603_0062918 3300046455 Bacteria 2190
291 Ga0495641_0135313 3300046461 Unclassified 1100
292 Ga0495651_0007067 3300046462 Bacteria 8583
293 Ga0495580_0200241 3300046472 Archaea 1376
294 Ga0495618_0258056 3300046514 Unclassified 1092
295 Ga0495630_0087739 3300046517 Bacteria 2350
296 Ga0495652_0163072 3300046529 Unclassified 1728
297 Ga0495640_0121109 3300046533 Bacteria 1701
298 Ga0495586_0147349 3300046535 Unclassified 1323
299 Ga0495598_0239611 3300046537 Unclassified 668
300 Ga0495645_0081264 3300046543 Bacteria 2325
301 Ga0495633_0241040 3300046558 Bacteria 826
302 Ga0495599_0253380 3300046678 Unclassified 1071
303 Ga0495599_0302221 3300046678 Unclassified 966
304 Ga0495649_0054040 3300046694 Bacteria 2173
305 Ga0495600_0215955 3300046809 Unclassified 1228
306 Ga0495600_0452682 3300046809 Unclassified 794
307 Ga0495604_0235078 3300047317 Unclassified 1256
308 Ga0495636_0037732 3300047318 Bacteria 1996
309 Ga0495636_0319234 3300047318 Bacteria 729
310 Ga0495674_0660098 3300047319 Bacteria 824
311 Ga0495675_0102099 3300047444 Bacteria 1794
312 Ga0495686_0154141 3300047472 Bacteria 1347
313 Ga0496101_0441482 3300048904 Unclassified 1027
314 Ga0496103_0412026 3300048906 Unclassified 868
315 Ga0496103_0514814 3300048906 Bacteria 765
316 Ga0496104_0694760 3300048907 Bacteria 925
317 Ga0496106_0796413 3300048909 Bacteria 750
318 Ga0496107_0153174 3300048910 Bacteria 1706
319 Ga0496107_0616511 3300048910 Bacteria 801
320 Ga0496108_0330375 3300048911 Bacteria 1329
321 Ga0496109_0121601 3300048912 Bacteria 2432
322 Ga0496110_0140927 3300048913 Bacteria 2179
323 Ga0496111_0303472 3300048914 Bacteria 1183
324 Ga0496112_0652843 3300048915 Unclassified 982
325 Ga0496113_1176172 3300048916 Bacteria 599
326 Ga0496114_0039768 3300048917 Bacteria 3892
327 Ga0496114_0194864 3300048917 Bacteria 1773
328 Ga0496115_0684483 3300048918 Bacteria 808
329 Ga0501300_001147 3300049523 Bacteria 4017
330 Ga0501031_0032847 3300049568 Bacteria 3384
331 Ga0501031_0082856 3300049568 Bacteria 2090
332 Ga0501033_0003114 3300049570 Bacteria 13771
333 Ga0501034_0102660 3300049571 Bacteria 2853
334 Ga0501034_0428686 3300049571 Bacteria 1242
335 Ga0501036_0046222 3300049572 Bacteria 3686
336 Ga0501040_0076078 3300049576 Bacteria 2321
337 Ga0501048_0568128 3300049582 Bacteria 814
338 Ga0501067_0008206 3300049583 Bacteria 5799
339 Ga0501068_0006652 3300049584 Bacteria 6381
340 Ga0501071_0002346 3300049587 Bacteria 11444
341 Ga0501071_0028784 3300049587 Bacteria 3917
342 Ga0501072_0170076 3300049588 Bacteria 1739
343 Ga0501072_0207720 3300049588 Bacteria 1561
344 Ga0501073_0011563 3300049589 Bacteria 6454
345 Ga0501073_0043091 3300049589 Bacteria 3183
346 Ga0501074_0003932 3300049590 Bacteria 10589
347 Ga0501076_0008594 3300049592 Bacteria 7491
348 Ga0501080_0001778 3300049742 Bacteria 18468
349 Ga0501080_1112510 3300049742 Bacteria 682
350 Ga0501083_0011188 3300049744 Bacteria 6296
351 Ga0501265_002603 3300049762 Bacteria 2045
352 Ga0501275_000420 3300049772 Bacteria 4849
353 Ga0501035_0163805 3300049822 Bacteria 1924
354 nmdc:mga03683_140010_c1 3300050489 Bacteria 1087
355 nmdc:mga03683_269145_c1 3300050489 Unclassified 794
356 nmdc:mga00v17_39406_c1 3300050491 Bacteria 2830
357 nmdc:mga06r32_105763_c1 3300050510 Bacteria 2765
358 nmdc:mga08y16_122438_c1 3300050511 Bacteria 2706
359 nmdc:mga08y16_20157_c1 3300050511 Bacteria 7037
360 nmdc:mga08y16_558150_c1 3300050511 Bacteria 1158
361 nmdc:mga08y16_663890_c1 3300050511 Unclassified 1045
362 nmdc:mga0n895_869252_c1 3300050512 Bacteria 888
363 nmdc:mga0rr50_124530_c1 3300050513 Bacteria 2056
364 nmdc:mga0a205_352736_c1 3300050515 Bacteria 1338
365 Ga0495601_0085341 3300053077 Bacteria 2028
366 Ga0495601_0110509 3300053077 Bacteria 1780
367 Ga0500641_0012044 3300053096 Bacteria 3151
368 Ga0501082_0028286 3300060353 Bacteria 4831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0076078 Ga0501040_0076078_97_696 170
2 3300049587 Ga0501071_0028784 Ga0501071_0028784_2166_2765 170
3 3300049588 Ga0501072_0207720 Ga0501072_0207720_490_1089 170
4 3300048916 Ga0496113_1176172 Ga0496113_1176172_62_577 171
5 3300039450 Ga0436363_0725312 Ga0436363_0725312_158_682 174
6 3300050489 nmdc:mga03683_269145_c1 nmdc:mga03683_269145_c1_204_779 182
7 3300014326 Ga0157380_10006663 Ga0157380_100066638 187
8 3300037418 Ga0395900_0378915 Ga0395900_0378915_58_651 187
9 3300038443 Ga0395901_0368819 Ga0395901_0368819_399_992 187
10 3300046678 Ga0495599_0302221 Ga0495599_0302221_205_792 187
11 3300028573 Ga0265334_10000674 Ga0265334_100006744 191
12 3300028800 Ga0265338_10210542 Ga0265338_102105422 191
13 3300005336 Ga0070680_100357285 Ga0070680_1003572852 194
14 3300025917 Ga0207660_10267845 Ga0207660_102678452 194
15 iso_pu_bacteria 2747842501 2748018894 194
16 3300053096 Ga0500641_0012044 Ga0500641_0012044_2491_3084 195
17 3300005328 Ga0070676_10298195 Ga0070676_102981952 196
18 3300005336 Ga0070680_100809710 Ga0070680_1008097101 196
19 3300005355 Ga0070671_100049682 Ga0070671_1000496824 196
20 3300005356 Ga0070674_100575054 Ga0070674_1005750541 196
21 3300005365 Ga0070688_100347627 Ga0070688_1003476271 196
22 3300005435 Ga0070714_100483771 Ga0070714_1004837711 196
23 3300005445 Ga0070708_100838421 Ga0070708_1008384211 196
24 3300005457 Ga0070662_100111736 Ga0070662_1001117362 196
25 3300005467 Ga0070706_100012325 Ga0070706_1000123255 196
26 3300005536 Ga0070697_100126883 Ga0070697_1001268831 196
27 3300005539 Ga0068853_100267822 Ga0068853_1002678221 196
28 3300005543 Ga0070672_100563250 Ga0070672_1005632502 196
29 3300005548 Ga0070665_100747456 Ga0070665_1007474562 196
30 3300005548 Ga0070665_100810811 Ga0070665_1008108112 196
31 3300005842 Ga0068858_100323523 Ga0068858_1003235233 196
32 3300005843 Ga0068860_101082173 Ga0068860_1010821731 196
33 3300005844 Ga0068862_100113779 Ga0068862_1001137792 196
34 3300005937 Ga0081455_10328186 Ga0081455_103281862 196
35 3300005981 Ga0081538_10018996 Ga0081538_100189967 196
36 3300006028 Ga0070717_10555253 Ga0070717_105552531 196
37 3300006163 Ga0070715_10228636 Ga0070715_102286362 196
38 3300006175 Ga0070712_100062442 Ga0070712_1000624421 196
39 3300006358 Ga0068871_100269936 Ga0068871_1002699362 196
40 3300006358 Ga0068871_100907370 Ga0068871_1009073702 196
41 3300006846 Ga0075430_100864720 Ga0075430_1008647202 196
42 3300006847 Ga0075431_100148965 Ga0075431_1001489652 196
43 3300009092 Ga0105250_10228279 Ga0105250_102282791 196
44 3300009093 Ga0105240_10091129 Ga0105240_100911292 196
45 3300009094 Ga0111539_10195423 Ga0111539_101954232 196
46 3300009176 Ga0105242_10888324 Ga0105242_108883242 196
47 3300009177 Ga0105248_10990548 Ga0105248_109905481 196
48 3300009545 Ga0105237_10091663 Ga0105237_100916633 196
49 3300009545 Ga0105237_11091520 Ga0105237_110915201 196
50 3300009553 Ga0105249_11254568 Ga0105249_112545681 196
51 3300010375 Ga0105239_10393244 Ga0105239_103932442 196
52 3300010375 Ga0105239_11139021 Ga0105239_111390211 196
53 3300012510 Ga0157316_1000983 Ga0157316_10009832 196
54 3300012512 Ga0157327_1010426 Ga0157327_10104262 196
55 3300013102 Ga0157371_10342383 Ga0157371_103423831 196
56 3300013296 Ga0157374_10217071 Ga0157374_102170712 196
57 3300013308 Ga0157375_10947957 Ga0157375_109479572 196
58 3300014326 Ga0157380_11566220 Ga0157380_115662201 196
59 3300017792 Ga0163161_10408625 Ga0163161_104086252 196
60 3300017792 Ga0163161_10435826 Ga0163161_104358262 196
61 3300021358 Ga0213873_10138652 Ga0213873_101386521 196
62 3300025315 Ga0207697_10159779 Ga0207697_101597791 196
63 3300025898 Ga0207692_10090811 Ga0207692_100908111 196
64 3300025905 Ga0207685_10229872 Ga0207685_102298722 196
65 3300025906 Ga0207699_10148572 Ga0207699_101485722 196
66 3300025907 Ga0207645_10305968 Ga0207645_103059681 196
67 3300025914 Ga0207671_10131459 Ga0207671_101314594 196
68 3300025926 Ga0207659_11026773 Ga0207659_110267731 196
69 3300025929 Ga0207664_10375834 Ga0207664_103758341 196
70 3300025931 Ga0207644_10055421 Ga0207644_100554214 196
71 3300025933 Ga0207706_10107702 Ga0207706_101077022 196
72 3300025940 Ga0207691_10277543 Ga0207691_102775432 196
73 3300025941 Ga0207711_10854012 Ga0207711_108540121 196
74 3300025960 Ga0207651_10470433 Ga0207651_104704331 196
75 3300025972 Ga0207668_10144285 Ga0207668_101442852 196
76 3300025986 Ga0207658_10188680 Ga0207658_101886803 196
77 3300026023 Ga0207677_10631252 Ga0207677_106312522 196
78 3300026041 Ga0207639_11265503 Ga0207639_112655031 196
79 3300026088 Ga0207641_11227015 Ga0207641_112270151 196
80 3300026095 Ga0207676_10384033 Ga0207676_103840332 196
81 3300028379 Ga0268266_10668936 Ga0268266_106689362 196
82 3300031665 Ga0316575_10035333 Ga0316575_100353331 196
83 3300031691 Ga0316579_10002249 Ga0316579_100022496 196
84 3300031691 Ga0316579_10017125 Ga0316579_100171251 196
85 3300031727 Ga0316576_10022206 Ga0316576_100222065 196
86 3300031728 Ga0316578_10006655 Ga0316578_100066551 196
87 3300031733 Ga0316577_10004639 Ga0316577_100046391 196
88 3300032137 Ga0316585_10082623 Ga0316585_100826232 196
89 3300035171 Ga0373946_0111674 Ga0373946_0111674_121_738 196
90 3300035398 Ga0316574_0008253 Ga0316574_0008253_2717_3334 196
91 3300035691 Ga0373931_0356223 Ga0373931_0356223_185_802 196
92 3300036647 Ga0316582_0014964 Ga0316582_0014964_2313_2930 196
93 3300037588 Ga0316581_0064721 Ga0316581_0064721_258_875 196
94 3300039447 Ga0436361_0732503 Ga0436361_0732503_31_645 196
95 3300039453 Ga0436362_0298087 Ga0436362_0298087_1286_1900 196
96 3300041494 Ga0451837_0035691 Ga0451837_0035691_1014_1604 196
97 3300041494 Ga0451837_1498760 Ga0451837_1498760_1508_2098 196
98 3300044712 Ga0453684_0002522 Ga0453684_0002522_39808_40422 196
99 3300044712 Ga0453684_0004933 Ga0453684_0004933_23712_24326 196
100 3300045051 Ga0451576_0357647 Ga0451576_0357647_467_1084 196
101 3300046454 Ga0495592_0257640 Ga0495592_0257640_52_669 196
102 3300046462 Ga0495651_0007067 Ga0495651_0007067_557_1174 196
103 3300046514 Ga0495618_0258056 Ga0495618_0258056_72_689 196
104 3300046529 Ga0495652_0163072 Ga0495652_0163072_557_1174 196
105 3300046533 Ga0495640_0121109 Ga0495640_0121109_137_754 196
106 3300046537 Ga0495598_0239611 Ga0495598_0239611_34_651 196
107 3300046543 Ga0495645_0081264 Ga0495645_0081264_235_852 196
108 3300046678 Ga0495599_0253380 Ga0495599_0253380_371_988 196
109 3300046809 Ga0495600_0215955 Ga0495600_0215955_481_1098 196
110 3300046809 Ga0495600_0452682 Ga0495600_0452682_77_694 196
111 3300047317 Ga0495604_0235078 Ga0495604_0235078_97_714 196
112 3300047318 Ga0495636_0037732 Ga0495636_0037732_118_708 196
113 3300047444 Ga0495675_0102099 Ga0495675_0102099_834_1451 196
114 3300048904 Ga0496101_0441482 Ga0496101_0441482_74_691 196
115 3300048906 Ga0496103_0412026 Ga0496103_0412026_223_840 196
116 3300048906 Ga0496103_0514814 Ga0496103_0514814_55_645 196
117 3300048909 Ga0496106_0796413 Ga0496106_0796413_15_632 196
118 3300048910 Ga0496107_0153174 Ga0496107_0153174_1098_1688 196
119 3300048910 Ga0496107_0616511 Ga0496107_0616511_122_739 196
120 3300048911 Ga0496108_0330375 Ga0496108_0330375_498_1088 196
121 3300048912 Ga0496109_0121601 Ga0496109_0121601_1147_1737 196
122 3300048913 Ga0496110_0140927 Ga0496110_0140927_743_1333 196
123 3300048914 Ga0496111_0303472 Ga0496111_0303472_78_668 196
124 3300048915 Ga0496112_0652843 Ga0496112_0652843_187_804 196
125 3300048917 Ga0496114_0194864 Ga0496114_0194864_210_800 196
126 3300048918 Ga0496115_0684483 Ga0496115_0684483_120_737 196
127 3300049523 Ga0501300_001147 Ga0501300_001147_1365_1955 196
128 3300049762 Ga0501265_002603 Ga0501265_002603_157_747 196
129 3300049772 Ga0501275_000420 Ga0501275_000420_2419_3009 196
130 3300050510 nmdc:mga06r32_105763_c1 nmdc:mga06r32_105763_c1_1014_1631 196
131 3300050511 nmdc:mga08y16_558150_c1 nmdc:mga08y16_558150_c1_230_847 196
132 3300050511 nmdc:mga08y16_663890_c1 nmdc:mga08y16_663890_c1_158_775 196
133 3300050515 nmdc:mga0a205_352736_c1 nmdc:mga0a205_352736_c1_157_774 196
134 3300053077 Ga0495601_0110509 Ga0495601_0110509_464_1081 196
135 3300005327 Ga0070658_10161492 Ga0070658_101614922 197
136 3300005336 Ga0070680_100088378 Ga0070680_1000883782 197
137 3300005345 Ga0070692_10181920 Ga0070692_101819202 197
138 3300005347 Ga0070668_100036257 Ga0070668_1000362574 197
139 3300005438 Ga0070701_10003524 Ga0070701_100035246 197
140 3300005441 Ga0070700_100009507 Ga0070700_1000095076 197
141 3300005444 Ga0070694_100012754 Ga0070694_1000127542 197
142 3300005444 Ga0070694_100165316 Ga0070694_1001653162 197
143 3300005458 Ga0070681_10630063 Ga0070681_106300632 197
144 3300005530 Ga0070679_100860365 Ga0070679_1008603651 197
145 3300005549 Ga0070704_100169950 Ga0070704_1001699502 197
146 3300005563 Ga0068855_100906012 Ga0068855_1009060122 197
147 3300005617 Ga0068859_100045556 Ga0068859_1000455567 197
148 3300005719 Ga0068861_100029363 Ga0068861_1000293635 197
149 3300005843 Ga0068860_101141876 Ga0068860_1011418762 197
150 3300005844 Ga0068862_100017279 Ga0068862_1000172796 197
151 3300006051 Ga0075364_10011192 Ga0075364_100111923 197
152 3300006844 Ga0075428_100002640 Ga0075428_10000264020 197
153 3300006880 Ga0075429_100009010 Ga0075429_10000901010 197
154 3300006931 Ga0097620_100045556 Ga0097620_1000455562 197
155 3300007076 Ga0075435_100136380 Ga0075435_1001363802 197
156 3300009094 Ga0111539_10002857 Ga0111539_1000285719 197
157 3300009094 Ga0111539_10168676 Ga0111539_101686763 197
158 3300009094 Ga0111539_10418313 Ga0111539_104183132 197
159 3300014745 Ga0157377_10082492 Ga0157377_100824922 197
160 3300025917 Ga0207660_10064074 Ga0207660_100640744 197
161 3300025918 Ga0207662_10520601 Ga0207662_105206012 197
162 3300025933 Ga0207706_10243807 Ga0207706_102438072 197
163 3300025935 Ga0207709_10087768 Ga0207709_100877684 197
164 3300025939 Ga0207665_10096919 Ga0207665_100969192 197
165 3300025942 Ga0207689_10454303 Ga0207689_104543032 197
166 3300026075 Ga0207708_10007538 Ga0207708_100075389 197
167 3300026118 Ga0207675_100004918 Ga0207675_10000491812 197
168 3300027695 Ga0209966_1005328 Ga0209966_10053283 197
169 3300027907 Ga0207428_10069617 Ga0207428_100696173 197
170 3300027907 Ga0207428_10427078 Ga0207428_104270782 197
171 3300031548 Ga0307408_100155395 Ga0307408_1001553953 197
172 3300031731 Ga0307405_10109476 Ga0307405_101094763 197
173 3300031824 Ga0307413_10177814 Ga0307413_101778143 197
174 3300031852 Ga0307410_10275527 Ga0307410_102755273 197
175 3300031903 Ga0307407_10713381 Ga0307407_107133811 197
176 3300031995 Ga0307409_100125547 Ga0307409_1001255473 197
177 3300032002 Ga0307416_100377338 Ga0307416_1003773382 197
178 3300032004 Ga0307414_10701643 Ga0307414_107016432 197
179 3300032005 Ga0307411_10140166 Ga0307411_101401664 197
180 3300032005 Ga0307411_10680726 Ga0307411_106807261 197
181 3300037418 Ga0395900_0220504 Ga0395900_0220504_843_1460 197
182 3300037471 Ga0395905_0024007 Ga0395905_0024007_4614_5231 197
183 3300042531 Ga0450918_035344 Ga0450918_035344_95_688 197
184 3300042876 Ga0451577_0233718 Ga0451577_0233718_440_1057 197
185 3300044712 Ga0453684_0009951 Ga0453684_0009951_5116_5733 197
186 3300046455 Ga0495603_0062918 Ga0495603_0062918_87_683 197
187 3300046461 Ga0495641_0135313 Ga0495641_0135313_367_1056 197
188 3300046472 Ga0495580_0200241 Ga0495580_0200241_545_1141 197
189 3300046517 Ga0495630_0087739 Ga0495630_0087739_326_922 197
190 3300046535 Ga0495586_0147349 Ga0495586_0147349_201_890 197
191 3300047318 Ga0495636_0319234 Ga0495636_0319234_82_681 197
192 3300047319 Ga0495674_0660098 Ga0495674_0660098_81_677 197
193 3300049568 Ga0501031_0032847 Ga0501031_0032847_666_1259 197
194 3300049568 Ga0501031_0082856 Ga0501031_0082856_1433_2065 197
195 3300049570 Ga0501033_0003114 Ga0501033_0003114_10245_10838 197
196 3300049571 Ga0501034_0102660 Ga0501034_0102660_364_1086 197
197 3300049571 Ga0501034_0428686 Ga0501034_0428686_26_658 197
198 3300049572 Ga0501036_0046222 Ga0501036_0046222_3029_3661 197
199 3300049582 Ga0501048_0568128 Ga0501048_0568128_55_654 197
200 3300049589 Ga0501073_0043091 Ga0501073_0043091_44_676 197
201 3300049742 Ga0501080_1112510 Ga0501080_1112510_60_659 197
202 3300050489 nmdc:mga03683_140010_c1 nmdc:mga03683_140010_c1_375_968 197
203 3300050491 nmdc:mga00v17_39406_c1 nmdc:mga00v17_39406_c1_1698_2357 197
204 3300050511 nmdc:mga08y16_122438_c1 nmdc:mga08y16_122438_c1_1170_1769 197
205 3300050511 nmdc:mga08y16_20157_c1 nmdc:mga08y16_20157_c1_1638_2237 197
206 3300050512 nmdc:mga0n895_869252_c1 nmdc:mga0n895_869252_c1_104_769 197
207 3300050513 nmdc:mga0rr50_124530_c1 nmdc:mga0rr50_124530_c1_1167_1766 197
208 3300053077 Ga0495601_0085341 Ga0495601_0085341_409_1005 197
209 3300006358 Ga0068871_100148755 Ga0068871_1001487553 198
210 3300047472 Ga0495686_0154141 Ga0495686_0154141_176_772 198
211 3300005331 Ga0070670_100282692 Ga0070670_1002826922 199
212 3300005367 Ga0070667_100016812 Ga0070667_1000168125 199
213 3300005614 Ga0068856_100108835 Ga0068856_1001088352 199
214 3300009177 Ga0105248_10012251 Ga0105248_100122512 199
215 3300021384 Ga0213876_10229400 Ga0213876_102294002 199
216 3300026023 Ga0207677_10053482 Ga0207677_100534824 199
217 3300039437 Ga0436365_1556496 Ga0436365_1556496_934_1533 199
218 3300039450 Ga0436363_1089669 Ga0436363_1089669_182_781 199
219 3300039453 Ga0436362_0283082 Ga0436362_0283082_879_1478 199
220 3300005437 Ga0070710_10190922 Ga0070710_101909223 202
221 3300021361 Ga0213872_10042459 Ga0213872_100424592 202
222 3300025898 Ga0207692_10327397 Ga0207692_103273972 202
223 3300037853 Ga0436364_0338218 Ga0436364_0338218_180_827 202
224 3300037853 Ga0436364_1341153 Ga0436364_1341153_241_876 202
225 3300039437 Ga0436365_0488577 Ga0436365_0488577_312_947 202
226 3300039438 Ga0436360_0265019 Ga0436360_0265019_2196_2831 202
227 3300039447 Ga0436361_0034353 Ga0436361_0034353_10863_11510 202
228 3300039453 Ga0436362_1041703 Ga0436362_1041703_2820_3467 202
229 3300048907 Ga0496104_0694760 Ga0496104_0694760_53_661 202
230 3300048917 Ga0496114_0039768 Ga0496114_0039768_1752_2360 202
231 3300031665 Ga0316575_10001563 Ga0316575_1000156310 203
232 3300031691 Ga0316579_10002096 Ga0316579_100020967 203
233 3300031728 Ga0316578_10006046 Ga0316578_100060463 203
234 3300031731 Ga0307405_10046406 Ga0307405_100464062 203
235 3300031733 Ga0316577_10000063 Ga0316577_100000637 203
236 3300031903 Ga0307407_10007981 Ga0307407_100079816 203
237 3300031995 Ga0307409_100008604 Ga0307409_1000086048 203
238 3300032002 Ga0307416_100255964 Ga0307416_1002559642 203
239 3300032005 Ga0307411_10000994 Ga0307411_100009947 203
240 3300032126 Ga0307415_100073087 Ga0307415_1000730872 203
241 3300032137 Ga0316585_10000126 Ga0316585_1000012615 203
242 3300032139 Ga0316580_10013142 Ga0316580_100131423 203
243 3300036647 Ga0316582_0000031 Ga0316582_0000031_7481_8098 203
244 3300036712 Ga0316584_0000691 Ga0316584_0000691_10222_10839 203
245 3300037588 Ga0316581_0013730 Ga0316581_0013730_1268_1885 203
246 3300041451 Ga0451791_0689834 Ga0451791_0689834_835_1446 203
247 3300041486 Ga0451807_0532397 Ga0451807_0532397_477_1088 203
248 3300041512 Ga0451853_1601092 Ga0451853_1601092_176_787 203
249 3300003323 rootH1_10207615 rootH1_102076153 204
250 3300005328 Ga0070676_10072917 Ga0070676_100729171 204
251 3300005328 Ga0070676_10121718 Ga0070676_101217183 204
252 3300005330 Ga0070690_100056815 Ga0070690_1000568152 204
253 3300005331 Ga0070670_100113154 Ga0070670_1001131542 204
254 3300005331 Ga0070670_100361169 Ga0070670_1003611692 204
255 3300005334 Ga0068869_100147370 Ga0068869_1001473704 204
256 3300005340 Ga0070689_100004872 Ga0070689_1000048726 204
257 3300005340 Ga0070689_100657728 Ga0070689_1006577281 204
258 3300005343 Ga0070687_100145371 Ga0070687_1001453711 204
259 3300005347 Ga0070668_100046075 Ga0070668_1000460754 204
260 3300005354 Ga0070675_100037838 Ga0070675_1000378383 204
261 3300005356 Ga0070674_100279561 Ga0070674_1002795612 204
262 3300005364 Ga0070673_100050222 Ga0070673_1000502224 204
263 3300005365 Ga0070688_100057581 Ga0070688_1000575813 204
264 3300005365 Ga0070688_100186540 Ga0070688_1001865402 204
265 3300005438 Ga0070701_10006470 Ga0070701_100064705 204
266 3300005438 Ga0070701_10017144 Ga0070701_100171443 204
267 3300005438 Ga0070701_10133099 Ga0070701_101330991 204
268 3300005440 Ga0070705_100052681 Ga0070705_1000526811 204
269 3300005441 Ga0070700_100021156 Ga0070700_1000211565 204
270 3300005441 Ga0070700_100044700 Ga0070700_1000447002 204
271 3300005455 Ga0070663_100182062 Ga0070663_1001820622 204
272 3300005456 Ga0070678_100039222 Ga0070678_1000392222 204
273 3300005459 Ga0068867_100026802 Ga0068867_1000268022 204
274 3300005535 Ga0070684_100773525 Ga0070684_1007735251 204
275 3300005539 Ga0068853_100331165 Ga0068853_1003311653 204
276 3300005543 Ga0070672_100074559 Ga0070672_1000745592 204
277 3300005543 Ga0070672_100124967 Ga0070672_1001249672 204
278 3300005544 Ga0070686_100123852 Ga0070686_1001238523 204
279 3300005544 Ga0070686_100141388 Ga0070686_1001413883 204
280 3300005544 Ga0070686_100404707 Ga0070686_1004047072 204
281 3300005548 Ga0070665_100002677 Ga0070665_10000267714 204
282 3300005548 Ga0070665_101288104 Ga0070665_1012881041 204
283 3300005549 Ga0070704_100122502 Ga0070704_1001225023 204
284 3300005564 Ga0070664_100062665 Ga0070664_1000626652 204
285 3300005617 Ga0068859_100098704 Ga0068859_1000987044 204
286 3300005617 Ga0068859_100674887 Ga0068859_1006748872 204
287 3300005617 Ga0068859_100940487 Ga0068859_1009404871 204
288 3300005618 Ga0068864_100230227 Ga0068864_1002302272 204
289 3300005618 Ga0068864_100379511 Ga0068864_1003795112 204
290 3300005718 Ga0068866_10505043 Ga0068866_105050431 204
291 3300005719 Ga0068861_100010454 Ga0068861_1000104544 204
292 3300005719 Ga0068861_100155930 Ga0068861_1001559303 204
293 3300005719 Ga0068861_100208283 Ga0068861_1002082832 204
294 3300005719 Ga0068861_100292193 Ga0068861_1002921932 204
295 3300005840 Ga0068870_10018764 Ga0068870_100187643 204
296 3300005841 Ga0068863_100026387 Ga0068863_1000263874 204
297 3300005841 Ga0068863_100111294 Ga0068863_1001112943 204
298 3300005844 Ga0068862_100097582 Ga0068862_1000975823 204
299 3300005844 Ga0068862_100432084 Ga0068862_1004320842 204
300 3300006163 Ga0070715_10218746 Ga0070715_102187462 204
301 3300006237 Ga0097621_100046693 Ga0097621_1000466934 204
302 3300006358 Ga0068871_100064869 Ga0068871_1000648694 204
303 3300006881 Ga0068865_100087787 Ga0068865_1000877873 204
304 3300006931 Ga0097620_100098699 Ga0097620_1000986994 204
305 3300006931 Ga0097620_100674814 Ga0097620_1006748143 204
306 3300006931 Ga0097620_100940603 Ga0097620_1009406032 204
307 3300009094 Ga0111539_11248369 Ga0111539_112483692 204
308 3300009176 Ga0105242_10061386 Ga0105242_100613864 204
309 3300009553 Ga0105249_10393896 Ga0105249_103938961 204
310 3300013306 Ga0163162_10307604 Ga0163162_103076042 204
311 3300014325 Ga0163163_10129614 Ga0163163_101296144 204
312 3300014326 Ga0157380_10621107 Ga0157380_106211072 204
313 3300014326 Ga0157380_11666390 Ga0157380_116663901 204
314 3300014745 Ga0157377_10429835 Ga0157377_104298352 204
315 3300014969 Ga0157376_10267009 Ga0157376_102670093 204
316 3300017792 Ga0163161_10032985 Ga0163161_100329854 204
317 3300025907 Ga0207645_10077110 Ga0207645_100771102 204
318 3300025908 Ga0207643_10008749 Ga0207643_100087493 204
319 3300025918 Ga0207662_10086035 Ga0207662_100860354 204
320 3300025925 Ga0207650_10278371 Ga0207650_102783712 204
321 3300025925 Ga0207650_11094398 Ga0207650_110943981 204
322 3300025926 Ga0207659_10031444 Ga0207659_100314444 204
323 3300025932 Ga0207690_10133187 Ga0207690_101331873 204
324 3300025934 Ga0207686_10194347 Ga0207686_101943472 204
325 3300025936 Ga0207670_10028458 Ga0207670_100284584 204
326 3300025937 Ga0207669_10274972 Ga0207669_102749722 204
327 3300025937 Ga0207669_10946733 Ga0207669_109467332 204
328 3300025938 Ga0207704_10363868 Ga0207704_103638682 204
329 3300025940 Ga0207691_10006160 Ga0207691_100061604 204
330 3300025942 Ga0207689_10209230 Ga0207689_102092303 204
331 3300025960 Ga0207651_10008100 Ga0207651_100081006 204
332 3300025972 Ga0207668_10330289 Ga0207668_103302893 204
333 3300026023 Ga0207677_10128841 Ga0207677_101288412 204
334 3300026067 Ga0207678_10142155 Ga0207678_101421553 204
335 3300026075 Ga0207708_10057015 Ga0207708_100570154 204
336 3300026088 Ga0207641_10038962 Ga0207641_100389623 204
337 3300026088 Ga0207641_10047242 Ga0207641_100472425 204
338 3300026089 Ga0207648_10148434 Ga0207648_101484342 204
339 3300026095 Ga0207676_10214227 Ga0207676_102142273 204
340 3300026116 Ga0207674_10110091 Ga0207674_101100912 204
341 3300026118 Ga0207675_100008703 Ga0207675_1000087033 204
342 3300026118 Ga0207675_100023875 Ga0207675_1000238754 204
343 3300026118 Ga0207675_100112753 Ga0207675_1001127533 204
344 3300026118 Ga0207675_100269218 Ga0207675_1002692182 204
345 3300028379 Ga0268266_10032613 Ga0268266_100326136 204
346 3300028379 Ga0268266_11217307 Ga0268266_112173071 204
347 3300028380 Ga0268265_10045349 Ga0268265_100453494 204
348 3300031456 Ga0307513_10041416 Ga0307513_100414163 204
349 3300031548 Ga0307408_100305622 Ga0307408_1003056222 204
350 3300031901 Ga0307406_10877738 Ga0307406_108777382 204
351 3300031911 Ga0307412_10108949 Ga0307412_101089492 204
352 3300031995 Ga0307409_100423726 Ga0307409_1004237262 204
353 3300032002 Ga0307416_100180011 Ga0307416_1001800112 204
354 3300032005 Ga0307411_10146256 Ga0307411_101462562 204
355 3300032126 Ga0307415_100109682 Ga0307415_1001096823 204
356 3300032126 Ga0307415_100710403 Ga0307415_1007104032 204
357 3300046558 Ga0495633_0241040 Ga0495633_0241040_12_632 204
358 3300046694 Ga0495649_0054040 Ga0495649_0054040_651_1271 204
359 3300049583 Ga0501067_0008206 Ga0501067_0008206_3748_4362 204
360 3300049584 Ga0501068_0006652 Ga0501068_0006652_930_1544 204
361 3300049587 Ga0501071_0002346 Ga0501071_0002346_4257_4871 204
362 3300049588 Ga0501072_0170076 Ga0501072_0170076_1078_1692 204
363 3300049589 Ga0501073_0011563 Ga0501073_0011563_5531_6145 204
364 3300049590 Ga0501074_0003932 Ga0501074_0003932_5032_5646 204
365 3300049592 Ga0501076_0008594 Ga0501076_0008594_2157_2771 204
366 3300049742 Ga0501080_0001778 Ga0501080_0001778_6252_6866 204
367 3300049744 Ga0501083_0011188 Ga0501083_0011188_427_1041 204
368 3300049822 Ga0501035_0163805 Ga0501035_0163805_1007_1621 204
369 3300060353 Ga0501082_0028286 Ga0501082_0028286_3511_4125 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

30

186

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zwk-assembly1.cif.gz_A structure of wrba from pseudomonas aeruginosa 0.969 3 195
1zwl-assembly1.cif.gz_A structure of wrba from pseudomonas aeruginosa in complex with fmn 0.964 3 196
2a5l-assembly1.cif.gz_B the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.9621 1 196
2a5l-assembly1.cif.gz_A the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.9534 1 196
1zwk-assembly1.cif.gz_A structure of wrba from pseudomonas aeruginosa 0.9522 3 195
ID Description Score Start End Superfamily
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9478 1 196 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9312 1 196 3.40.50.360
2zkiG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9234 2 195 3.40.50.360
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9123 1 197 3.40.50.360
2zkiG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8903 2 195 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A1Y5DFF9-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9841 61 199 GO:0003955
GO:0016020
AF-T1CAL8-F1-model_v4 Flavoprotein WrbA 0.9839 75 196 GO:0003955
GO:0016020
AF-A0A7Y3U4K4-F1-model_v4 NAD(P)H:quinone oxidoreductase (EC 1.6.5.2) 0.9836 58 196 GO:0003955
GO:0016020
AF-A0A1E9K184-F1-model_v4 deleted 0.9796 3 196
AF-A0A7T3BL85-F1-model_v4 Flavoprotein WrbA 0.9765 3 196 GO:0003955
GO:0009055
GO:0010181
GO:0016020

Feature Viewer

pLDDT pTM Quality
89.66 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map