F424967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 369 | 195 | 369 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100355154|Ga0070707_1003551542 |
| Length | 218 |
| Sequence | MSSPSISDRVRNQVDLKDRRCTWVGSDPLMVIYHDTEWGVPVHDDQKLFEFIVLDAMQAGLNFRIILQKRQNFKQALDGFDPVKIAKYGDRRLDRLLRTEGIIRNRQKLAASIANARATLRVQQDFGSLDAYLWQFVDGRPKINAWNKASQIPATTREAEAMSKALMSRGFKFVGPTICYAFMQAAGLVNDHITDCFRYAQLANAGLPRRAGLGKVQI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 145 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 148 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 164 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 165 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 166 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 167 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 183 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 184 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.98 |
| Nodule | 0 |
| Rhizoplane | 0.81 |
| Rhizosphere | 93.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001570 | 3300000546 | Bacteria | 3154 |
| 2 | JGI25156J39149_1004117 | 3300002705 | Bacteria | 4513 |
| 3 | JGI25154J39366_1000398 | 3300002738 | Bacteria | 23734 |
| 4 | Ga0055533_1001811 | 3300003756 | Bacteria | 5371 |
| 5 | Ga0055542_1000628 | 3300003762 | Bacteria | 29630 |
| 6 | Ga0055541_1002375 | 3300003841 | Bacteria | 3780 |
| 7 | Ga0065715_10255302 | 3300005293 | Bacteria | 1154 |
| 8 | Ga0070658_10027727 | 3300005327 | Bacteria | 4545 |
| 9 | Ga0070658_10539972 | 3300005327 | Bacteria | 1009 |
| 10 | Ga0070683_100606536 | 3300005329 | Bacteria | 1048 |
| 11 | Ga0070683_101161411 | 3300005329 | Bacteria | 742 |
| 12 | Ga0070690_100060367 | 3300005330 | Bacteria | 2440 |
| 13 | Ga0070677_10010114 | 3300005333 | Bacteria | 3217 |
| 14 | Ga0070666_10006823 | 3300005335 | Bacteria | 7036 |
| 15 | Ga0070666_10048519 | 3300005335 | Bacteria | 2853 |
| 16 | Ga0070680_100413499 | 3300005336 | Bacteria | 1150 |
| 17 | Ga0068868_100014468 | 3300005338 | Bacteria | 5815 |
| 18 | Ga0068868_100023939 | 3300005338 | Bacteria | 4627 |
| 19 | Ga0068868_100082787 | 3300005338 | Bacteria | 2574 |
| 20 | Ga0070660_100275431 | 3300005339 | Bacteria | 1376 |
| 21 | Ga0070689_100059732 | 3300005340 | Bacteria | 2963 |
| 22 | Ga0070661_100242773 | 3300005344 | Bacteria | 1388 |
| 23 | Ga0070661_100482309 | 3300005344 | Bacteria | 990 |
| 24 | Ga0070661_100519248 | 3300005344 | Bacteria | 955 |
| 25 | Ga0070674_100235412 | 3300005356 | Bacteria | 1431 |
| 26 | Ga0070673_100151093 | 3300005364 | Bacteria | 1967 |
| 27 | Ga0070667_100016213 | 3300005367 | Bacteria | 6165 |
| 28 | Ga0070667_100288471 | 3300005367 | Bacteria | 1475 |
| 29 | Ga0070714_100282744 | 3300005435 | Bacteria | 1542 |
| 30 | Ga0070708_100040336 | 3300005445 | Bacteria | 4088 |
| 31 | Ga0070663_100151469 | 3300005455 | Bacteria | 1779 |
| 32 | Ga0070678_100024629 | 3300005456 | Bacteria | 4034 |
| 33 | Ga0070678_100861522 | 3300005456 | Bacteria | 826 |
| 34 | Ga0070681_10028137 | 3300005458 | Bacteria | 5651 |
| 35 | Ga0070681_10303231 | 3300005458 | Bacteria | 1507 |
| 36 | Ga0070681_10352304 | 3300005458 | Bacteria | 1382 |
| 37 | Ga0068867_100625291 | 3300005459 | Bacteria | 942 |
| 38 | Ga0068867_100796728 | 3300005459 | Bacteria | 842 |
| 39 | Ga0070685_10000338 | 3300005466 | Bacteria | 28781 |
| 40 | Ga0070707_100010022 | 3300005468 | Bacteria | 8816 |
| 41 | Ga0070707_100355154 | 3300005468 | Bacteria | 1423 |
| 42 | Ga0070707_100769202 | 3300005468 | Bacteria | 926 |
| 43 | Ga0070698_100048474 | 3300005471 | Bacteria | 4340 |
| 44 | Ga0070698_100708938 | 3300005471 | Bacteria | 948 |
| 45 | Ga0070699_100304611 | 3300005518 | Bacteria | 1430 |
| 46 | Ga0070679_100105789 | 3300005530 | Bacteria | 2800 |
| 47 | Ga0070679_100480553 | 3300005530 | Bacteria | 1186 |
| 48 | Ga0070684_100335284 | 3300005535 | Bacteria | 1390 |
| 49 | Ga0070697_100000274 | 3300005536 | Bacteria | 41758 |
| 50 | Ga0070697_100393529 | 3300005536 | Bacteria | 1202 |
| 51 | Ga0068853_100027131 | 3300005539 | Bacteria | 4812 |
| 52 | Ga0068853_100247168 | 3300005539 | Bacteria | 1636 |
| 53 | Ga0068853_100494768 | 3300005539 | Bacteria | 1154 |
| 54 | Ga0070696_100099795 | 3300005546 | Bacteria | 2078 |
| 55 | Ga0070665_100119094 | 3300005548 | Bacteria | 2642 |
| 56 | Ga0068855_100084128 | 3300005563 | Bacteria | 3684 |
| 57 | Ga0068855_100132158 | 3300005563 | Unclassified | 2849 |
| 58 | Ga0068855_100371150 | 3300005563 | Bacteria | 1573 |
| 59 | Ga0068855_100391859 | 3300005563 | Bacteria | 1523 |
| 60 | Ga0070664_100039664 | 3300005564 | Bacteria | 3969 |
| 61 | Ga0068857_100015813 | 3300005577 | Bacteria | 6602 |
| 62 | Ga0068857_100087189 | 3300005577 | Bacteria | 2792 |
| 63 | Ga0068856_100037434 | 3300005614 | Bacteria | 4760 |
| 64 | Ga0068856_100204268 | 3300005614 | Bacteria | 1990 |
| 65 | Ga0068856_100642840 | 3300005614 | Bacteria | 1081 |
| 66 | Ga0068856_100869498 | 3300005614 | Bacteria | 921 |
| 67 | Ga0068852_100000682 | 3300005616 | Bacteria | 22285 |
| 68 | Ga0068852_100009471 | 3300005616 | Bacteria | 7236 |
| 69 | Ga0068852_100236724 | 3300005616 | Bacteria | 1743 |
| 70 | Ga0068852_100412422 | 3300005616 | Bacteria | 1331 |
| 71 | Ga0068859_100812756 | 3300005617 | Bacteria | 1022 |
| 72 | Ga0068864_100014593 | 3300005618 | Bacteria | 6525 |
| 73 | Ga0068864_100015352 | 3300005618 | Bacteria | 6368 |
| 74 | Ga0068864_101040450 | 3300005618 | Bacteria | 813 |
| 75 | Ga0068866_10184408 | 3300005718 | Bacteria | 1235 |
| 76 | Ga0068851_10001347 | 3300005834 | Bacteria | 10733 |
| 77 | Ga0068863_100004295 | 3300005841 | Bacteria | 14034 |
| 78 | Ga0068858_100010761 | 3300005842 | Bacteria | 8649 |
| 79 | Ga0068858_100029128 | 3300005842 | Bacteria | 5126 |
| 80 | Ga0068858_100583315 | 3300005842 | Bacteria | 1084 |
| 81 | Ga0068860_100001039 | 3300005843 | Bacteria | 30519 |
| 82 | Ga0068860_100011790 | 3300005843 | Bacteria | 8614 |
| 83 | Ga0081538_10045599 | 3300005981 | Bacteria | 2715 |
| 84 | Ga0097621_100016091 | 3300006237 | Bacteria | 5646 |
| 85 | Ga0097621_100024495 | 3300006237 | Bacteria | 4714 |
| 86 | Ga0097621_100031516 | 3300006237 | Bacteria | 4208 |
| 87 | Ga0097621_100038994 | 3300006237 | Bacteria | 3814 |
| 88 | Ga0097621_100118790 | 3300006237 | Bacteria | 2241 |
| 89 | Ga0097621_100119513 | 3300006237 | Bacteria | 2234 |
| 90 | Ga0097621_100451603 | 3300006237 | Bacteria | 1158 |
| 91 | Ga0068871_100013063 | 3300006358 | Bacteria | 6156 |
| 92 | Ga0068871_100015830 | 3300006358 | Bacteria | 5660 |
| 93 | Ga0068871_100037485 | 3300006358 | Bacteria | 3867 |
| 94 | Ga0068871_100042070 | 3300006358 | Bacteria | 3666 |
| 95 | Ga0068871_100118940 | 3300006358 | Bacteria | 2230 |
| 96 | Ga0075431_100031283 | 3300006847 | Bacteria | 5482 |
| 97 | Ga0075433_10221488 | 3300006852 | Bacteria | 1681 |
| 98 | Ga0068865_100177255 | 3300006881 | Bacteria | 1639 |
| 99 | Ga0097620_100812875 | 3300006931 | Bacteria | 1022 |
| 100 | Ga0105240_10001524 | 3300009093 | Bacteria | 39410 |
| 101 | Ga0105240_10009389 | 3300009093 | Bacteria | 13857 |
| 102 | Ga0105240_10089603 | 3300009093 | Bacteria | 3762 |
| 103 | Ga0105240_10091110 | 3300009093 | Bacteria | 3726 |
| 104 | Ga0105240_10269790 | 3300009093 | Bacteria | 1960 |
| 105 | Ga0111539_10025708 | 3300009094 | Bacteria | 7213 |
| 106 | Ga0111539_10039733 | 3300009094 | Bacteria | 5669 |
| 107 | Ga0105245_10017674 | 3300009098 | Bacteria | 6224 |
| 108 | Ga0105245_10052240 | 3300009098 | Bacteria | 3665 |
| 109 | Ga0105245_10085787 | 3300009098 | Bacteria | 2887 |
| 110 | Ga0105245_10098759 | 3300009098 | Bacteria | 2698 |
| 111 | Ga0105247_10138019 | 3300009101 | Bacteria | 1595 |
| 112 | Ga0114129_10957550 | 3300009147 | Bacteria | 1081 |
| 113 | Ga0105241_10013306 | 3300009174 | Bacteria | 6030 |
| 114 | Ga0105241_10029292 | 3300009174 | Bacteria | 4107 |
| 115 | Ga0105241_10044798 | 3300009174 | Bacteria | 3353 |
| 116 | Ga0105241_10071310 | 3300009174 | Bacteria | 2697 |
| 117 | Ga0105241_10232605 | 3300009174 | Bacteria | 1554 |
| 118 | Ga0105241_10380673 | 3300009174 | Bacteria | 1233 |
| 119 | Ga0105241_10772156 | 3300009174 | Bacteria | 883 |
| 120 | Ga0105242_10019918 | 3300009176 | Bacteria | 5255 |
| 121 | Ga0105242_10020945 | 3300009176 | Bacteria | 5129 |
| 122 | Ga0105242_10034643 | 3300009176 | Bacteria | 4048 |
| 123 | Ga0105242_10108364 | 3300009176 | Bacteria | 2364 |
| 124 | Ga0105242_10774516 | 3300009176 | Bacteria | 947 |
| 125 | Ga0105248_10035168 | 3300009177 | Bacteria | 5605 |
| 126 | Ga0105248_10075417 | 3300009177 | Bacteria | 3791 |
| 127 | Ga0105248_10117907 | 3300009177 | Bacteria | 2994 |
| 128 | Ga0105248_10150473 | 3300009177 | Bacteria | 2626 |
| 129 | Ga0105248_10487701 | 3300009177 | Bacteria | 1389 |
| 130 | Ga0105248_10685788 | 3300009177 | Bacteria | 1156 |
| 131 | Ga0105237_10045698 | 3300009545 | Bacteria | 4406 |
| 132 | Ga0105237_10047678 | 3300009545 | Bacteria | 4306 |
| 133 | Ga0105237_10436671 | 3300009545 | Bacteria | 1315 |
| 134 | Ga0105237_10546943 | 3300009545 | Bacteria | 1164 |
| 135 | Ga0105238_10000774 | 3300009551 | Bacteria | 33230 |
| 136 | Ga0105238_10040183 | 3300009551 | Bacteria | 4740 |
| 137 | Ga0105238_10047539 | 3300009551 | Bacteria | 4325 |
| 138 | Ga0105238_10080589 | 3300009551 | Bacteria | 3245 |
| 139 | Ga0105238_10167768 | 3300009551 | Bacteria | 2171 |
| 140 | Ga0105238_10947762 | 3300009551 | Bacteria | 880 |
| 141 | Ga0105239_10014257 | 3300010375 | Bacteria | 8824 |
| 142 | Ga0105239_10046986 | 3300010375 | Bacteria | 4730 |
| 143 | Ga0105239_10060818 | 3300010375 | Bacteria | 4145 |
| 144 | Ga0105239_10074644 | 3300010375 | Bacteria | 3728 |
| 145 | Ga0105239_10166188 | 3300010375 | Bacteria | 2467 |
| 146 | Ga0105239_11393081 | 3300010375 | Bacteria | 809 |
| 147 | Ga0105239_11393083 | 3300010375 | Bacteria | 809 |
| 148 | Ga0105246_10051748 | 3300011119 | Bacteria | 2821 |
| 149 | Ga0105246_10055316 | 3300011119 | Bacteria | 2738 |
| 150 | Ga0105246_10202515 | 3300011119 | Bacteria | 1544 |
| 151 | Ga0105246_10359743 | 3300011119 | Bacteria | 1195 |
| 152 | Ga0105246_11177481 | 3300011119 | Bacteria | 704 |
| 153 | Ga0157373_10127041 | 3300013100 | Bacteria | 1793 |
| 154 | Ga0157373_10216265 | 3300013100 | Bacteria | 1351 |
| 155 | Ga0157371_10189437 | 3300013102 | Bacteria | 1472 |
| 156 | Ga0157370_10006305 | 3300013104 | Bacteria | 13107 |
| 157 | Ga0157370_10038586 | 3300013104 | Bacteria | 4620 |
| 158 | Ga0157370_10062909 | 3300013104 | Bacteria | 3518 |
| 159 | Ga0157370_10416810 | 3300013104 | Bacteria | 1236 |
| 160 | Ga0157370_10444553 | 3300013104 | Bacteria | 1192 |
| 161 | Ga0157369_10000898 | 3300013105 | Bacteria | 37983 |
| 162 | Ga0157369_10037953 | 3300013105 | Bacteria | 5270 |
| 163 | Ga0157369_10098027 | 3300013105 | Bacteria | 3127 |
| 164 | Ga0157369_10242531 | 3300013105 | Bacteria | 1882 |
| 165 | Ga0157374_10051545 | 3300013296 | Bacteria | 3830 |
| 166 | Ga0157374_10794677 | 3300013296 | Bacteria | 962 |
| 167 | Ga0157374_10897654 | 3300013296 | Bacteria | 904 |
| 168 | Ga0157378_10000005 | 3300013297 | Bacteria | 197893 |
| 169 | Ga0157378_10092009 | 3300013297 | Bacteria | 2759 |
| 170 | Ga0157378_10112099 | 3300013297 | Bacteria | 2502 |
| 171 | Ga0157378_10231704 | 3300013297 | Bacteria | 1760 |
| 172 | Ga0157378_10333969 | 3300013297 | Bacteria | 1476 |
| 173 | Ga0157378_10504197 | 3300013297 | Bacteria | 1209 |
| 174 | Ga0163162_10056541 | 3300013306 | Bacteria | 3951 |
| 175 | Ga0163162_10100823 | 3300013306 | Bacteria | 2979 |
| 176 | Ga0157372_10000971 | 3300013307 | Bacteria | 31279 |
| 177 | Ga0157372_10092772 | 3300013307 | Bacteria | 3435 |
| 178 | Ga0157372_10167306 | 3300013307 | Bacteria | 2543 |
| 179 | Ga0157375_10065430 | 3300013308 | Bacteria | 3624 |
| 180 | Ga0163163_10010035 | 3300014325 | Bacteria | 8495 |
| 181 | Ga0163163_10048395 | 3300014325 | Bacteria | 4181 |
| 182 | Ga0163163_10073484 | 3300014325 | Bacteria | 3411 |
| 183 | Ga0163163_12012905 | 3300014325 | Bacteria | 637 |
| 184 | Ga0157379_10001050 | 3300014968 | Bacteria | 22453 |
| 185 | Ga0157379_10087281 | 3300014968 | Bacteria | 2797 |
| 186 | Ga0157376_10080623 | 3300014969 | Bacteria | 2792 |
| 187 | Ga0157376_10277091 | 3300014969 | Bacteria | 1578 |
| 188 | Ga0157376_10470031 | 3300014969 | Bacteria | 1230 |
| 189 | Ga0157376_10840658 | 3300014969 | Bacteria | 933 |
| 190 | Ga0209784_100508 | 3300025224 | Bacteria | 15150 |
| 191 | Ga0209566_100277 | 3300025225 | Bacteria | 47887 |
| 192 | Ga0209674_100081 | 3300025226 | Bacteria | 201146 |
| 193 | Ga0209674_100089 | 3300025226 | Bacteria | 178751 |
| 194 | Ga0209674_100289 | 3300025226 | Bacteria | 36645 |
| 195 | Ga0209646_1000065 | 3300025246 | Bacteria | 245452 |
| 196 | Ga0209026_1003846 | 3300025250 | Bacteria | 4736 |
| 197 | Ga0209677_105100 | 3300025253 | Bacteria | 3539 |
| 198 | Ga0209148_1000113 | 3300025254 | Bacteria | 195646 |
| 199 | Ga0209759_1003567 | 3300025256 | Bacteria | 6156 |
| 200 | Ga0207656_10000295 | 3300025321 | Bacteria | 17228 |
| 201 | Ga0207682_10019363 | 3300025893 | Bacteria | 2664 |
| 202 | Ga0207705_10052722 | 3300025909 | Bacteria | 2929 |
| 203 | Ga0207654_10000208 | 3300025911 | Bacteria | 36063 |
| 204 | Ga0207654_10037572 | 3300025911 | Bacteria | 2712 |
| 205 | Ga0207654_10040352 | 3300025911 | Bacteria | 2630 |
| 206 | Ga0207654_10159116 | 3300025911 | Bacteria | 1457 |
| 207 | Ga0207707_10008404 | 3300025912 | Bacteria | 8955 |
| 208 | Ga0207695_10000271 | 3300025913 | Bacteria | 129900 |
| 209 | Ga0207695_10000651 | 3300025913 | Bacteria | 68979 |
| 210 | Ga0207695_10017171 | 3300025913 | Bacteria | 8434 |
| 211 | Ga0207695_10025548 | 3300025913 | Bacteria | 6609 |
| 212 | Ga0207695_10048495 | 3300025913 | Bacteria | 4485 |
| 213 | Ga0207695_10242574 | 3300025913 | Bacteria | 1703 |
| 214 | Ga0207695_10829616 | 3300025913 | Bacteria | 805 |
| 215 | Ga0207671_10125619 | 3300025914 | Bacteria | 1965 |
| 216 | Ga0207671_10200798 | 3300025914 | Bacteria | 1557 |
| 217 | Ga0207671_10236019 | 3300025914 | Bacteria | 1436 |
| 218 | Ga0207660_10304055 | 3300025917 | Bacteria | 1270 |
| 219 | Ga0207657_10003290 | 3300025919 | Bacteria | 17270 |
| 220 | Ga0207649_10309173 | 3300025920 | Bacteria | 1158 |
| 221 | Ga0207649_10464397 | 3300025920 | Bacteria | 957 |
| 222 | Ga0207652_10032974 | 3300025921 | Bacteria | 4360 |
| 223 | Ga0207646_10129742 | 3300025922 | Bacteria | 2268 |
| 224 | Ga0207646_10137007 | 3300025922 | Bacteria | 2204 |
| 225 | Ga0207681_10197893 | 3300025923 | Bacteria | 1541 |
| 226 | Ga0207694_10003217 | 3300025924 | Bacteria | 13018 |
| 227 | Ga0207694_10025346 | 3300025924 | Bacteria | 4507 |
| 228 | Ga0207694_10027915 | 3300025924 | Bacteria | 4302 |
| 229 | Ga0207694_10029767 | 3300025924 | Bacteria | 4167 |
| 230 | Ga0207694_10141953 | 3300025924 | Bacteria | 1932 |
| 231 | Ga0207694_10202524 | 3300025924 | Bacteria | 1615 |
| 232 | Ga0207659_10089881 | 3300025926 | Bacteria | 2291 |
| 233 | Ga0207687_10036991 | 3300025927 | Bacteria | 3328 |
| 234 | Ga0207687_10067812 | 3300025927 | Bacteria | 2539 |
| 235 | Ga0207687_10076878 | 3300025927 | Bacteria | 2399 |
| 236 | Ga0207664_10648277 | 3300025929 | Bacteria | 949 |
| 237 | Ga0207644_10050051 | 3300025931 | Bacteria | 2994 |
| 238 | Ga0207644_10157087 | 3300025931 | Bacteria | 1765 |
| 239 | Ga0207686_10010873 | 3300025934 | Bacteria | 4965 |
| 240 | Ga0207686_10025568 | 3300025934 | Bacteria | 3436 |
| 241 | Ga0207686_10529648 | 3300025934 | Bacteria | 918 |
| 242 | Ga0207686_10996831 | 3300025934 | Bacteria | 680 |
| 243 | Ga0207670_10199962 | 3300025936 | Bacteria | 1518 |
| 244 | Ga0207711_10031795 | 3300025941 | Bacteria | 4458 |
| 245 | Ga0207711_10045617 | 3300025941 | Bacteria | 3746 |
| 246 | Ga0207711_10062255 | 3300025941 | Bacteria | 3218 |
| 247 | Ga0207711_11282303 | 3300025941 | Bacteria | 675 |
| 248 | Ga0207661_10254301 | 3300025944 | Bacteria | 1563 |
| 249 | Ga0207667_10011715 | 3300025949 | Bacteria | 10172 |
| 250 | Ga0207667_10024942 | 3300025949 | Bacteria | 6555 |
| 251 | Ga0207667_10063966 | 3300025949 | Bacteria | 3843 |
| 252 | Ga0207667_10655246 | 3300025949 | Bacteria | 1055 |
| 253 | Ga0207651_10526126 | 3300025960 | Bacteria | 1025 |
| 254 | Ga0207712_10232182 | 3300025961 | Bacteria | 1481 |
| 255 | Ga0207658_10238495 | 3300025986 | Bacteria | 1539 |
| 256 | Ga0207658_10381140 | 3300025986 | Bacteria | 1235 |
| 257 | Ga0207677_10010557 | 3300026023 | Bacteria | 5233 |
| 258 | Ga0207677_10016516 | 3300026023 | Bacteria | 4375 |
| 259 | Ga0207703_10134153 | 3300026035 | Bacteria | 2141 |
| 260 | Ga0207703_10548894 | 3300026035 | Bacteria | 1089 |
| 261 | Ga0207703_11150639 | 3300026035 | Bacteria | 746 |
| 262 | Ga0207639_10007931 | 3300026041 | Bacteria | 7254 |
| 263 | Ga0207639_10121646 | 3300026041 | Bacteria | 2146 |
| 264 | Ga0207639_10705479 | 3300026041 | Unclassified | 936 |
| 265 | Ga0207678_10433046 | 3300026067 | Bacteria | 1141 |
| 266 | Ga0207702_10205640 | 3300026078 | Bacteria | 1828 |
| 267 | Ga0207641_10019939 | 3300026088 | Bacteria | 5504 |
| 268 | Ga0207641_10031446 | 3300026088 | Bacteria | 4402 |
| 269 | Ga0207641_10276013 | 3300026088 | Bacteria | 1579 |
| 270 | Ga0207641_10637071 | 3300026088 | Bacteria | 1046 |
| 271 | Ga0207648_10047589 | 3300026089 | Bacteria | 3759 |
| 272 | Ga0207676_10003182 | 3300026095 | Bacteria | 11695 |
| 273 | Ga0207674_10011745 | 3300026116 | Bacteria | 9826 |
| 274 | Ga0207674_10016802 | 3300026116 | Bacteria | 7998 |
| 275 | Ga0207683_10035673 | 3300026121 | Bacteria | 4326 |
| 276 | Ga0207698_10009947 | 3300026142 | Bacteria | 6084 |
| 277 | Ga0207698_10074912 | 3300026142 | Bacteria | 2702 |
| 278 | Ga0207698_10091853 | 3300026142 | Bacteria | 2486 |
| 279 | Ga0207698_10312214 | 3300026142 | Bacteria | 1469 |
| 280 | Ga0207698_10493800 | 3300026142 | Bacteria | 1190 |
| 281 | Ga0209983_1062895 | 3300027665 | Bacteria | 822 |
| 282 | Ga0207428_10015569 | 3300027907 | Bacteria | 6573 |
| 283 | Ga0268266_10004206 | 3300028379 | Bacteria | 13853 |
| 284 | Ga0268266_10096957 | 3300028379 | Bacteria | 2593 |
| 285 | Ga0268264_10020378 | 3300028381 | Bacteria | 5420 |
| 286 | Ga0268264_10028728 | 3300028381 | Bacteria | 4551 |
| 287 | Ga0265765_1003897 | 3300030879 | Bacteria | 1513 |
| 288 | Ga0265760_10000634 | 3300031090 | Bacteria | 9966 |
| 289 | Ga0265760_10010217 | 3300031090 | Bacteria | 2677 |
| 290 | Ga0265339_10075455 | 3300031249 | Bacteria | 1790 |
| 291 | Ga0265331_10150477 | 3300031250 | Bacteria | 1057 |
| 292 | Ga0307408_100044366 | 3300031548 | Bacteria | 3168 |
| 293 | Ga0307408_100198132 | 3300031548 | Bacteria | 1623 |
| 294 | Ga0265314_10016062 | 3300031711 | Bacteria | 5927 |
| 295 | Ga0265342_10040539 | 3300031712 | Bacteria | 2824 |
| 296 | Ga0307410_10078846 | 3300031852 | Bacteria | 2306 |
| 297 | Ga0307406_10039952 | 3300031901 | Bacteria | 2914 |
| 298 | Ga0307416_100560184 | 3300032002 | Bacteria | 1217 |
| 299 | Ga0307411_10221140 | 3300032005 | Bacteria | 1469 |
| 300 | Ga0395900_0252168 | 3300037418 | Bacteria | 1766 |
| 301 | Ga0395901_0078373 | 3300038443 | Bacteria | 3450 |
| 302 | Ga0400489_39790 | 3300039093 | Bacteria | 3179 |
| 303 | Ga0436365_0950736 | 3300039437 | Bacteria | 1259 |
| 304 | Ga0436362_0390077 | 3300039453 | Bacteria | 6344 |
| 305 | Ga0439460_0021885 | 3300042461 | Bacteria | 1751 |
| 306 | Ga0466969_0027862 | 3300044656 | Bacteria | 2891 |
| 307 | Ga0466982_0000022 | 3300044672 | Bacteria | 95114 |
| 308 | Ga0453683_0126802 | 3300044673 | Bacteria | 1607 |
| 309 | Ga0466966_0004032 | 3300044684 | Bacteria | 9698 |
| 310 | Ga0466961_0081684 | 3300044693 | Bacteria | 2045 |
| 311 | Ga0466964_0001094 | 3300044706 | Bacteria | 9079 |
| 312 | Ga0466971_0003556 | 3300044719 | Bacteria | 6658 |
| 313 | Ga0466968_0011050 | 3300044735 | Bacteria | 3512 |
| 314 | Ga0466970_0020125 | 3300044765 | Bacteria | 3463 |
| 315 | Ga0466957_0259208 | 3300044842 | Bacteria | 1158 |
| 316 | Ga0466959_0056651 | 3300045049 | Bacteria | 2860 |
| 317 | Ga0466959_0127173 | 3300045049 | Bacteria | 1808 |
| 318 | Ga0466958_0018643 | 3300045836 | Bacteria | 4031 |
| 319 | Ga0466967_1131608 | 3300045976 | Bacteria | 780 |
| 320 | Ga0495665_0038510 | 3300046531 | Bacteria | 2549 |
| 321 | Ga0496104_0142847 | 3300048907 | Bacteria | 2299 |
| 322 | Ga0496110_0058000 | 3300048913 | Bacteria | 3410 |
| 323 | Ga0496112_0081831 | 3300048915 | Bacteria | 3194 |
| 324 | Ga0496118_0019744 | 3300048921 | Bacteria | 6009 |
| 325 | Ga0496126_0051596 | 3300048929 | Bacteria | 3744 |
| 326 | Ga0501292_034072 | 3300049515 | Bacteria | 864 |
| 327 | Ga0501298_044914 | 3300049521 | Bacteria | 903 |
| 328 | Ga0501299_007778 | 3300049522 | Bacteria | 1722 |
| 329 | Ga0501034_0000995 | 3300049571 | Bacteria | 40612 |
| 330 | Ga0501034_0056197 | 3300049571 | Bacteria | 3961 |
| 331 | Ga0501036_0018130 | 3300049572 | Bacteria | 5894 |
| 332 | Ga0501043_0040290 | 3300049579 | Bacteria | 3672 |
| 333 | Ga0501043_0040857 | 3300049579 | Bacteria | 3645 |
| 334 | Ga0501046_0013397 | 3300049580 | Bacteria | 6943 |
| 335 | Ga0501047_0001883 | 3300049581 | Bacteria | 20174 |
| 336 | Ga0501047_0002999 | 3300049581 | Bacteria | 16023 |
| 337 | Ga0501067_0000828 | 3300049583 | Bacteria | 16717 |
| 338 | Ga0501068_0003899 | 3300049584 | Bacteria | 8107 |
| 339 | Ga0501069_0001039 | 3300049585 | Bacteria | 13262 |
| 340 | Ga0501069_0052143 | 3300049585 | Bacteria | 2278 |
| 341 | Ga0501069_0091296 | 3300049585 | Bacteria | 1723 |
| 342 | Ga0501070_0000792 | 3300049586 | Bacteria | 28709 |
| 343 | Ga0501070_0015308 | 3300049586 | Bacteria | 6453 |
| 344 | Ga0501070_0831551 | 3300049586 | Bacteria | 723 |
| 345 | Ga0501071_0207848 | 3300049587 | Bacteria | 1472 |
| 346 | Ga0501072_0001039 | 3300049588 | Bacteria | 20541 |
| 347 | Ga0501073_0000970 | 3300049589 | Bacteria | 20676 |
| 348 | Ga0501073_0136323 | 3300049589 | Bacteria | 1701 |
| 349 | Ga0501074_0005351 | 3300049590 | Bacteria | 9227 |
| 350 | Ga0501074_0067247 | 3300049590 | Bacteria | 2577 |
| 351 | Ga0501076_0570559 | 3300049592 | Bacteria | 933 |
| 352 | Ga0501198_064453 | 3300049649 | Bacteria | 679 |
| 353 | Ga0501249_007749 | 3300049679 | Bacteria | 2225 |
| 354 | Ga0501080_0000488 | 3300049742 | Bacteria | 30918 |
| 355 | Ga0501080_0000782 | 3300049742 | Bacteria | 25883 |
| 356 | Ga0501080_0005831 | 3300049742 | Bacteria | 11021 |
| 357 | Ga0501083_0005678 | 3300049744 | Bacteria | 8835 |
| 358 | Ga0501035_0175294 | 3300049822 | Bacteria | 1850 |
| 359 | Ga0501044_0008495 | 3300049823 | Bacteria | 11253 |
| 360 | nmdc:mga09592_429839_c1 | 3300050508 | Bacteria | 1140 |
| 361 | nmdc:mga06r32_148616_c1 | 3300050510 | Unclassified | 2321 |
| 362 | nmdc:mga06r32_59958_c1 | 3300050510 | Bacteria | 2938 |
| 363 | nmdc:mga08y16_64839_c1 | 3300050511 | Bacteria | 3814 |
| 364 | nmdc:mga0a205_175781_c1 | 3300050515 | Bacteria | 2036 |
| 365 | Ga0495619_0197522 | 3300053085 | Bacteria | 1393 |
| 366 | Ga0500616_0214101 | 3300053153 | Bacteria | 845 |
| 367 | Ga0501084_0145674 | 3300054114 | Bacteria | 1995 |
| 368 | Ga0501084_0511929 | 3300054114 | Bacteria | 1014 |
| 369 | Ga0466962_0023215 | 3300061719 | Bacteria | 2981 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100040336 | Ga0070708_1000403362 | 179 |
| 2 | 3300049592 | Ga0501076_0570559 | Ga0501076_0570559_107_688 | 179 |
| 3 | 3300025929 | Ga0207664_10648277 | Ga0207664_106482772 | 182 |
| 4 | 3300031852 | Ga0307410_10078846 | Ga0307410_100788464 | 182 |
| 5 | 3300002705 | JGI25156J39149_1004117 | JGI25156J39149_10041175 | 183 |
| 6 | 3300002738 | JGI25154J39366_1000398 | JGI25154J39366_100039827 | 183 |
| 7 | 3300003756 | Ga0055533_1001811 | Ga0055533_10018114 | 183 |
| 8 | 3300003762 | Ga0055542_1000628 | Ga0055542_10006289 | 183 |
| 9 | 3300003841 | Ga0055541_1002375 | Ga0055541_10023755 | 183 |
| 10 | 3300025224 | Ga0209784_100508 | Ga0209784_1005087 | 183 |
| 11 | 3300025225 | Ga0209566_100277 | Ga0209566_10027718 | 183 |
| 12 | 3300025226 | Ga0209674_100081 | Ga0209674_10008180 | 183 |
| 13 | 3300025226 | Ga0209674_100089 | Ga0209674_10008926 | 183 |
| 14 | 3300025226 | Ga0209674_100289 | Ga0209674_10028926 | 183 |
| 15 | 3300025246 | Ga0209646_1000065 | Ga0209646_1000065118 | 183 |
| 16 | 3300025250 | Ga0209026_1003846 | Ga0209026_10038465 | 183 |
| 17 | 3300025253 | Ga0209677_105100 | Ga0209677_1051004 | 183 |
| 18 | 3300025254 | Ga0209148_1000113 | Ga0209148_1000113107 | 183 |
| 19 | 3300025256 | Ga0209759_1003567 | Ga0209759_10035675 | 183 |
| 20 | 3300005435 | Ga0070714_100282744 | Ga0070714_1002827441 | 184 |
| 21 | 3300005471 | Ga0070698_100048474 | Ga0070698_1000484743 | 184 |
| 22 | 3300005518 | Ga0070699_100304611 | Ga0070699_1003046113 | 184 |
| 23 | 3300027665 | Ga0209983_1062895 | Ga0209983_10628951 | 184 |
| 24 | 3300039093 | Ga0400489_39790 | Ga0400489_39790_2460_3029 | 184 |
| 25 | 3300044656 | Ga0466969_0027862 | Ga0466969_0027862_1652_2215 | 184 |
| 26 | 3300044672 | Ga0466982_0000022 | Ga0466982_0000022_80845_81408 | 184 |
| 27 | 3300044684 | Ga0466966_0004032 | Ga0466966_0004032_3008_3571 | 184 |
| 28 | 3300044693 | Ga0466961_0081684 | Ga0466961_0081684_523_1086 | 184 |
| 29 | 3300044706 | Ga0466964_0001094 | Ga0466964_0001094_4151_4714 | 184 |
| 30 | 3300044719 | Ga0466971_0003556 | Ga0466971_0003556_4775_5338 | 184 |
| 31 | 3300044735 | Ga0466968_0011050 | Ga0466968_0011050_876_1439 | 184 |
| 32 | 3300044765 | Ga0466970_0020125 | Ga0466970_0020125_2524_3087 | 184 |
| 33 | 3300044842 | Ga0466957_0259208 | Ga0466957_0259208_119_685 | 184 |
| 34 | 3300045049 | Ga0466959_0056651 | Ga0466959_0056651_2159_2722 | 184 |
| 35 | 3300045836 | Ga0466958_0018643 | Ga0466958_0018643_849_1412 | 184 |
| 36 | 3300061719 | Ga0466962_0023215 | Ga0466962_0023215_317_880 | 184 |
| 37 | 3300005330 | Ga0070690_100060367 | Ga0070690_1000603673 | 185 |
| 38 | 3300005335 | Ga0070666_10006823 | Ga0070666_100068231 | 185 |
| 39 | 3300005339 | Ga0070660_100275431 | Ga0070660_1002754313 | 185 |
| 40 | 3300005458 | Ga0070681_10303231 | Ga0070681_103032313 | 185 |
| 41 | 3300005530 | Ga0070679_100105789 | Ga0070679_1001057894 | 185 |
| 42 | 3300005563 | Ga0068855_100371150 | Ga0068855_1003711501 | 185 |
| 43 | 3300005564 | Ga0070664_100039664 | Ga0070664_1000396642 | 185 |
| 44 | 3300005614 | Ga0068856_100204268 | Ga0068856_1002042682 | 185 |
| 45 | 3300005614 | Ga0068856_100869498 | Ga0068856_1008694981 | 185 |
| 46 | 3300005617 | Ga0068859_100812756 | Ga0068859_1008127562 | 185 |
| 47 | 3300005618 | Ga0068864_101040450 | Ga0068864_1010404502 | 185 |
| 48 | 3300005718 | Ga0068866_10184408 | Ga0068866_101844082 | 185 |
| 49 | 3300005842 | Ga0068858_100029128 | Ga0068858_1000291285 | 185 |
| 50 | 3300005843 | Ga0068860_100011790 | Ga0068860_1000117907 | 185 |
| 51 | 3300006237 | Ga0097621_100016091 | Ga0097621_1000160914 | 185 |
| 52 | 3300006237 | Ga0097621_100118790 | Ga0097621_1001187902 | 185 |
| 53 | 3300006358 | Ga0068871_100015830 | Ga0068871_1000158304 | 185 |
| 54 | 3300006358 | Ga0068871_100042070 | Ga0068871_1000420706 | 185 |
| 55 | 3300006852 | Ga0075433_10221488 | Ga0075433_102214882 | 185 |
| 56 | 3300006931 | Ga0097620_100812875 | Ga0097620_1008128752 | 185 |
| 57 | 3300009094 | Ga0111539_10025708 | Ga0111539_100257085 | 185 |
| 58 | 3300009098 | Ga0105245_10052240 | Ga0105245_100522402 | 185 |
| 59 | 3300009098 | Ga0105245_10085787 | Ga0105245_100857873 | 185 |
| 60 | 3300009147 | Ga0114129_10957550 | Ga0114129_109575502 | 185 |
| 61 | 3300009174 | Ga0105241_10071310 | Ga0105241_100713104 | 185 |
| 62 | 3300009176 | Ga0105242_10020945 | Ga0105242_100209453 | 185 |
| 63 | 3300009176 | Ga0105242_10034643 | Ga0105242_100346433 | 185 |
| 64 | 3300009177 | Ga0105248_10075417 | Ga0105248_100754172 | 185 |
| 65 | 3300009545 | Ga0105237_10045698 | Ga0105237_100456983 | 185 |
| 66 | 3300011119 | Ga0105246_10202515 | Ga0105246_102025154 | 185 |
| 67 | 3300011119 | Ga0105246_11177481 | Ga0105246_111774811 | 185 |
| 68 | 3300013100 | Ga0157373_10127041 | Ga0157373_101270412 | 185 |
| 69 | 3300013104 | Ga0157370_10416810 | Ga0157370_104168102 | 185 |
| 70 | 3300013105 | Ga0157369_10242531 | Ga0157369_102425312 | 185 |
| 71 | 3300013296 | Ga0157374_10051545 | Ga0157374_100515454 | 185 |
| 72 | 3300013297 | Ga0157378_10333969 | Ga0157378_103339694 | 185 |
| 73 | 3300013306 | Ga0163162_10100823 | Ga0163162_101008235 | 185 |
| 74 | 3300014968 | Ga0157379_10087281 | Ga0157379_100872816 | 185 |
| 75 | 3300014969 | Ga0157376_10080623 | Ga0157376_100806233 | 185 |
| 76 | 3300014969 | Ga0157376_10277091 | Ga0157376_102770913 | 185 |
| 77 | 3300025911 | Ga0207654_10040352 | Ga0207654_100403522 | 185 |
| 78 | 3300025914 | Ga0207671_10200798 | Ga0207671_102007983 | 185 |
| 79 | 3300025921 | Ga0207652_10032974 | Ga0207652_100329746 | 185 |
| 80 | 3300025924 | Ga0207694_10003217 | Ga0207694_1000321716 | 185 |
| 81 | 3300025927 | Ga0207687_10067812 | Ga0207687_100678122 | 185 |
| 82 | 3300025927 | Ga0207687_10076878 | Ga0207687_100768782 | 185 |
| 83 | 3300025931 | Ga0207644_10157087 | Ga0207644_101570872 | 185 |
| 84 | 3300025934 | Ga0207686_10010873 | Ga0207686_100108734 | 185 |
| 85 | 3300025934 | Ga0207686_10025568 | Ga0207686_100255682 | 185 |
| 86 | 3300025941 | Ga0207711_10045617 | Ga0207711_100456176 | 185 |
| 87 | 3300025949 | Ga0207667_10063966 | Ga0207667_100639662 | 185 |
| 88 | 3300026035 | Ga0207703_10134153 | Ga0207703_101341534 | 185 |
| 89 | 3300026078 | Ga0207702_10205640 | Ga0207702_102056402 | 185 |
| 90 | 3300026088 | Ga0207641_10019939 | Ga0207641_100199392 | 185 |
| 91 | 3300026089 | Ga0207648_10047589 | Ga0207648_100475894 | 185 |
| 92 | 3300028381 | Ga0268264_10020378 | Ga0268264_100203784 | 185 |
| 93 | 3300031250 | Ga0265331_10150477 | Ga0265331_101504771 | 185 |
| 94 | 3300031711 | Ga0265314_10016062 | Ga0265314_100160623 | 185 |
| 95 | 3300037418 | Ga0395900_0252168 | Ga0395900_0252168_316_891 | 185 |
| 96 | 3300038443 | Ga0395901_0078373 | Ga0395901_0078373_615_1190 | 185 |
| 97 | 3300044673 | Ga0453683_0126802 | Ga0453683_0126802_346_921 | 185 |
| 98 | 3300049587 | Ga0501071_0207848 | Ga0501071_0207848_732_1298 | 185 |
| 99 | 3300050515 | nmdc:mga0a205_175781_c1 | nmdc:mga0a205_175781_c1_727_1293 | 185 |
| 100 | 3300053153 | Ga0500616_0214101 | Ga0500616_0214101_86_673 | 185 |
| 101 | 3300005327 | Ga0070658_10027727 | Ga0070658_100277272 | 186 |
| 102 | 3300005335 | Ga0070666_10048519 | Ga0070666_100485191 | 186 |
| 103 | 3300005336 | Ga0070680_100413499 | Ga0070680_1004134992 | 186 |
| 104 | 3300005338 | Ga0068868_100082787 | Ga0068868_1000827872 | 186 |
| 105 | 3300005344 | Ga0070661_100242773 | Ga0070661_1002427732 | 186 |
| 106 | 3300005344 | Ga0070661_100519248 | Ga0070661_1005192481 | 186 |
| 107 | 3300005367 | Ga0070667_100016213 | Ga0070667_1000162135 | 186 |
| 108 | 3300005367 | Ga0070667_100288471 | Ga0070667_1002884712 | 186 |
| 109 | 3300005455 | Ga0070663_100151469 | Ga0070663_1001514692 | 186 |
| 110 | 3300005458 | Ga0070681_10028137 | Ga0070681_100281374 | 186 |
| 111 | 3300005458 | Ga0070681_10352304 | Ga0070681_103523042 | 186 |
| 112 | 3300005459 | Ga0068867_100625291 | Ga0068867_1006252912 | 186 |
| 113 | 3300005466 | Ga0070685_10000338 | Ga0070685_1000033816 | 186 |
| 114 | 3300005468 | Ga0070707_100010022 | Ga0070707_1000100227 | 186 |
| 115 | 3300005530 | Ga0070679_100480553 | Ga0070679_1004805532 | 186 |
| 116 | 3300005535 | Ga0070684_100335284 | Ga0070684_1003352843 | 186 |
| 117 | 3300005539 | Ga0068853_100027131 | Ga0068853_1000271315 | 186 |
| 118 | 3300005539 | Ga0068853_100494768 | Ga0068853_1004947683 | 186 |
| 119 | 3300005548 | Ga0070665_100119094 | Ga0070665_1001190942 | 186 |
| 120 | 3300005563 | Ga0068855_100084128 | Ga0068855_1000841284 | 186 |
| 121 | 3300005577 | Ga0068857_100015813 | Ga0068857_1000158134 | 186 |
| 122 | 3300005614 | Ga0068856_100037434 | Ga0068856_1000374348 | 186 |
| 123 | 3300005614 | Ga0068856_100642840 | Ga0068856_1006428402 | 186 |
| 124 | 3300005616 | Ga0068852_100009471 | Ga0068852_10000947110 | 186 |
| 125 | 3300005618 | Ga0068864_100014593 | Ga0068864_1000145935 | 186 |
| 126 | 3300005842 | Ga0068858_100010761 | Ga0068858_1000107618 | 186 |
| 127 | 3300006237 | Ga0097621_100031516 | Ga0097621_1000315163 | 186 |
| 128 | 3300006237 | Ga0097621_100038994 | Ga0097621_1000389944 | 186 |
| 129 | 3300006237 | Ga0097621_100451603 | Ga0097621_1004516031 | 186 |
| 130 | 3300006358 | Ga0068871_100013063 | Ga0068871_1000130636 | 186 |
| 131 | 3300006358 | Ga0068871_100118940 | Ga0068871_1001189402 | 186 |
| 132 | 3300006881 | Ga0068865_100177255 | Ga0068865_1001772552 | 186 |
| 133 | 3300009093 | Ga0105240_10001524 | Ga0105240_100015247 | 186 |
| 134 | 3300009093 | Ga0105240_10089603 | Ga0105240_100896033 | 186 |
| 135 | 3300009093 | Ga0105240_10269790 | Ga0105240_102697901 | 186 |
| 136 | 3300009098 | Ga0105245_10017674 | Ga0105245_100176745 | 186 |
| 137 | 3300009101 | Ga0105247_10138019 | Ga0105247_101380192 | 186 |
| 138 | 3300009174 | Ga0105241_10013306 | Ga0105241_100133064 | 186 |
| 139 | 3300009174 | Ga0105241_10029292 | Ga0105241_100292923 | 186 |
| 140 | 3300009174 | Ga0105241_10772156 | Ga0105241_107721561 | 186 |
| 141 | 3300009176 | Ga0105242_10108364 | Ga0105242_101083643 | 186 |
| 142 | 3300009176 | Ga0105242_10774516 | Ga0105242_107745161 | 186 |
| 143 | 3300009177 | Ga0105248_10035168 | Ga0105248_100351682 | 186 |
| 144 | 3300009177 | Ga0105248_10150473 | Ga0105248_101504732 | 186 |
| 145 | 3300009545 | Ga0105237_10047678 | Ga0105237_100476784 | 186 |
| 146 | 3300009545 | Ga0105237_10436671 | Ga0105237_104366711 | 186 |
| 147 | 3300009545 | Ga0105237_10546943 | Ga0105237_105469432 | 186 |
| 148 | 3300009551 | Ga0105238_10000774 | Ga0105238_1000077422 | 186 |
| 149 | 3300009551 | Ga0105238_10047539 | Ga0105238_100475398 | 186 |
| 150 | 3300009551 | Ga0105238_10167768 | Ga0105238_101677683 | 186 |
| 151 | 3300009551 | Ga0105238_10947762 | Ga0105238_109477622 | 186 |
| 152 | 3300010375 | Ga0105239_10014257 | Ga0105239_100142575 | 186 |
| 153 | 3300010375 | Ga0105239_10060818 | Ga0105239_100608186 | 186 |
| 154 | 3300010375 | Ga0105239_10074644 | Ga0105239_100746443 | 186 |
| 155 | 3300010375 | Ga0105239_10166188 | Ga0105239_101661883 | 186 |
| 156 | 3300010375 | Ga0105239_11393081 | Ga0105239_113930812 | 186 |
| 157 | 3300010375 | Ga0105239_11393083 | Ga0105239_113930832 | 186 |
| 158 | 3300013100 | Ga0157373_10216265 | Ga0157373_102162652 | 186 |
| 159 | 3300013104 | Ga0157370_10038586 | Ga0157370_100385864 | 186 |
| 160 | 3300013104 | Ga0157370_10062909 | Ga0157370_100629092 | 186 |
| 161 | 3300013104 | Ga0157370_10444553 | Ga0157370_104445533 | 186 |
| 162 | 3300013105 | Ga0157369_10000898 | Ga0157369_1000089833 | 186 |
| 163 | 3300013105 | Ga0157369_10037953 | Ga0157369_100379537 | 186 |
| 164 | 3300013296 | Ga0157374_10897654 | Ga0157374_108976542 | 186 |
| 165 | 3300013297 | Ga0157378_10000005 | Ga0157378_10000005132 | 186 |
| 166 | 3300013297 | Ga0157378_10092009 | Ga0157378_100920093 | 186 |
| 167 | 3300013297 | Ga0157378_10112099 | Ga0157378_101120992 | 186 |
| 168 | 3300013297 | Ga0157378_10504197 | Ga0157378_105041972 | 186 |
| 169 | 3300013306 | Ga0163162_10056541 | Ga0163162_100565412 | 186 |
| 170 | 3300013307 | Ga0157372_10000971 | Ga0157372_1000097118 | 186 |
| 171 | 3300013307 | Ga0157372_10167306 | Ga0157372_101673062 | 186 |
| 172 | 3300013308 | Ga0157375_10065430 | Ga0157375_100654305 | 186 |
| 173 | 3300014325 | Ga0163163_10048395 | Ga0163163_100483953 | 186 |
| 174 | 3300014325 | Ga0163163_10073484 | Ga0163163_100734843 | 186 |
| 175 | 3300014325 | Ga0163163_12012905 | Ga0163163_120129051 | 186 |
| 176 | 3300014969 | Ga0157376_10470031 | Ga0157376_104700311 | 186 |
| 177 | 3300014969 | Ga0157376_10840658 | Ga0157376_108406581 | 186 |
| 178 | 3300025909 | Ga0207705_10052722 | Ga0207705_100527222 | 186 |
| 179 | 3300025911 | Ga0207654_10000208 | Ga0207654_1000020818 | 186 |
| 180 | 3300025911 | Ga0207654_10037572 | Ga0207654_100375724 | 186 |
| 181 | 3300025912 | Ga0207707_10008404 | Ga0207707_100084045 | 186 |
| 182 | 3300025913 | Ga0207695_10000271 | Ga0207695_1000027129 | 186 |
| 183 | 3300025913 | Ga0207695_10000651 | Ga0207695_100006516 | 186 |
| 184 | 3300025913 | Ga0207695_10017171 | Ga0207695_100171712 | 186 |
| 185 | 3300025913 | Ga0207695_10025548 | Ga0207695_100255487 | 186 |
| 186 | 3300025914 | Ga0207671_10125619 | Ga0207671_101256193 | 186 |
| 187 | 3300025914 | Ga0207671_10236019 | Ga0207671_102360192 | 186 |
| 188 | 3300025917 | Ga0207660_10304055 | Ga0207660_103040551 | 186 |
| 189 | 3300025919 | Ga0207657_10003290 | Ga0207657_1000329019 | 186 |
| 190 | 3300025920 | Ga0207649_10464397 | Ga0207649_104643972 | 186 |
| 191 | 3300025922 | Ga0207646_10129742 | Ga0207646_101297422 | 186 |
| 192 | 3300025924 | Ga0207694_10025346 | Ga0207694_100253466 | 186 |
| 193 | 3300025924 | Ga0207694_10027915 | Ga0207694_100279156 | 186 |
| 194 | 3300025924 | Ga0207694_10202524 | Ga0207694_102025242 | 186 |
| 195 | 3300025927 | Ga0207687_10036991 | Ga0207687_100369913 | 186 |
| 196 | 3300025931 | Ga0207644_10050051 | Ga0207644_100500513 | 186 |
| 197 | 3300025934 | Ga0207686_10529648 | Ga0207686_105296482 | 186 |
| 198 | 3300025934 | Ga0207686_10996831 | Ga0207686_109968311 | 186 |
| 199 | 3300025941 | Ga0207711_10031795 | Ga0207711_100317953 | 186 |
| 200 | 3300025941 | Ga0207711_10062255 | Ga0207711_100622553 | 186 |
| 201 | 3300025941 | Ga0207711_11282303 | Ga0207711_112823031 | 186 |
| 202 | 3300025949 | Ga0207667_10024942 | Ga0207667_100249428 | 186 |
| 203 | 3300025961 | Ga0207712_10232182 | Ga0207712_102321822 | 186 |
| 204 | 3300025986 | Ga0207658_10238495 | Ga0207658_102384952 | 186 |
| 205 | 3300026035 | Ga0207703_11150639 | Ga0207703_111506392 | 186 |
| 206 | 3300026041 | Ga0207639_10007931 | Ga0207639_100079316 | 186 |
| 207 | 3300026041 | Ga0207639_10705479 | Ga0207639_107054792 | 186 |
| 208 | 3300026067 | Ga0207678_10433046 | Ga0207678_104330462 | 186 |
| 209 | 3300026088 | Ga0207641_10276013 | Ga0207641_102760132 | 186 |
| 210 | 3300026095 | Ga0207676_10003182 | Ga0207676_100031823 | 186 |
| 211 | 3300026116 | Ga0207674_10011745 | Ga0207674_100117459 | 186 |
| 212 | 3300026142 | Ga0207698_10074912 | Ga0207698_100749127 | 186 |
| 213 | 3300026142 | Ga0207698_10091853 | Ga0207698_100918531 | 186 |
| 214 | 3300026142 | Ga0207698_10493800 | Ga0207698_104938002 | 186 |
| 215 | 3300028379 | Ga0268266_10096957 | Ga0268266_100969572 | 186 |
| 216 | 3300031249 | Ga0265339_10075455 | Ga0265339_100754552 | 186 |
| 217 | 3300031712 | Ga0265342_10040539 | Ga0265342_100405392 | 186 |
| 218 | 3300045976 | Ga0466967_1131608 | Ga0466967_1131608_38_610 | 186 |
| 219 | 3300048915 | Ga0496112_0081831 | Ga0496112_0081831_2565_3137 | 186 |
| 220 | 3300048921 | Ga0496118_0019744 | Ga0496118_0019744_528_1115 | 186 |
| 221 | 3300048929 | Ga0496126_0051596 | Ga0496126_0051596_310_897 | 186 |
| 222 | 3300049571 | Ga0501034_0000995 | Ga0501034_0000995_33026_33598 | 186 |
| 223 | 3300049571 | Ga0501034_0056197 | Ga0501034_0056197_1986_2558 | 186 |
| 224 | 3300049572 | Ga0501036_0018130 | Ga0501036_0018130_3450_4022 | 186 |
| 225 | 3300049579 | Ga0501043_0040290 | Ga0501043_0040290_2803_3375 | 186 |
| 226 | 3300049579 | Ga0501043_0040857 | Ga0501043_0040857_298_870 | 186 |
| 227 | 3300049580 | Ga0501046_0013397 | Ga0501046_0013397_1552_2124 | 186 |
| 228 | 3300049581 | Ga0501047_0001883 | Ga0501047_0001883_10376_10948 | 186 |
| 229 | 3300049581 | Ga0501047_0002999 | Ga0501047_0002999_15326_15898 | 186 |
| 230 | 3300049583 | Ga0501067_0000828 | Ga0501067_0000828_9003_9575 | 186 |
| 231 | 3300049584 | Ga0501068_0003899 | Ga0501068_0003899_3670_4242 | 186 |
| 232 | 3300049585 | Ga0501069_0001039 | Ga0501069_0001039_1750_2322 | 186 |
| 233 | 3300049585 | Ga0501069_0091296 | Ga0501069_0091296_361_933 | 186 |
| 234 | 3300049586 | Ga0501070_0000792 | Ga0501070_0000792_16719_17291 | 186 |
| 235 | 3300049586 | Ga0501070_0015308 | Ga0501070_0015308_5708_6280 | 186 |
| 236 | 3300049586 | Ga0501070_0831551 | Ga0501070_0831551_118_690 | 186 |
| 237 | 3300049588 | Ga0501072_0001039 | Ga0501072_0001039_944_1516 | 186 |
| 238 | 3300049589 | Ga0501073_0000970 | Ga0501073_0000970_12962_13534 | 186 |
| 239 | 3300049589 | Ga0501073_0136323 | Ga0501073_0136323_930_1502 | 186 |
| 240 | 3300049590 | Ga0501074_0005351 | Ga0501074_0005351_8364_8936 | 186 |
| 241 | 3300049590 | Ga0501074_0067247 | Ga0501074_0067247_1227_1799 | 186 |
| 242 | 3300049742 | Ga0501080_0000488 | Ga0501080_0000488_16423_16995 | 186 |
| 243 | 3300049742 | Ga0501080_0000782 | Ga0501080_0000782_24377_24949 | 186 |
| 244 | 3300049742 | Ga0501080_0005831 | Ga0501080_0005831_8773_9345 | 186 |
| 245 | 3300049744 | Ga0501083_0005678 | Ga0501083_0005678_6435_7007 | 186 |
| 246 | 3300049822 | Ga0501035_0175294 | Ga0501035_0175294_126_698 | 186 |
| 247 | 3300049823 | Ga0501044_0008495 | Ga0501044_0008495_7142_7714 | 186 |
| 248 | 3300050508 | nmdc:mga09592_429839_c1 | nmdc:mga09592_429839_c1_321_896 | 186 |
| 249 | 3300050510 | nmdc:mga06r32_59958_c1 | nmdc:mga06r32_59958_c1_1504_2079 | 186 |
| 250 | 3300054114 | Ga0501084_0145674 | Ga0501084_0145674_1303_1875 | 186 |
| 251 | 3300054114 | Ga0501084_0511929 | Ga0501084_0511929_340_912 | 186 |
| 252 | 3300005546 | Ga0070696_100099795 | Ga0070696_1000997952 | 187 |
| 253 | 3300006237 | Ga0097621_100119513 | Ga0097621_1001195133 | 187 |
| 254 | 3300006847 | Ga0075431_100031283 | Ga0075431_1000312834 | 187 |
| 255 | 3300025924 | Ga0207694_10029767 | Ga0207694_100297673 | 187 |
| 256 | 3300025986 | Ga0207658_10381140 | Ga0207658_103811402 | 187 |
| 257 | 3300028379 | Ga0268266_10004206 | Ga0268266_100042061 | 187 |
| 258 | 3300031548 | Ga0307408_100044366 | Ga0307408_1000443663 | 187 |
| 259 | 3300031548 | Ga0307408_100198132 | Ga0307408_1001981323 | 187 |
| 260 | 3300031901 | Ga0307406_10039952 | Ga0307406_100399525 | 187 |
| 261 | 3300032002 | Ga0307416_100560184 | Ga0307416_1005601842 | 187 |
| 262 | 3300032005 | Ga0307411_10221140 | Ga0307411_102211401 | 187 |
| 263 | 3300049515 | Ga0501292_034072 | Ga0501292_034072_69_668 | 187 |
| 264 | 3300049521 | Ga0501298_044914 | Ga0501298_044914_264_863 | 187 |
| 265 | 3300049522 | Ga0501299_007778 | Ga0501299_007778_1101_1700 | 187 |
| 266 | 3300049649 | Ga0501198_064453 | Ga0501198_064453_65_664 | 187 |
| 267 | 3300049679 | Ga0501249_007749 | Ga0501249_007749_1180_1779 | 187 |
| 268 | 3300050510 | nmdc:mga06r32_148616_c1 | nmdc:mga06r32_148616_c1_708_1283 | 187 |
| 269 | 3300005344 | Ga0070661_100482309 | Ga0070661_1004823091 | 188 |
| 270 | 3300025920 | Ga0207649_10309173 | Ga0207649_103091732 | 188 |
| 271 | 3300039437 | Ga0436365_0950736 | Ga0436365_0950736_146_742 | 188 |
| 272 | 3300039453 | Ga0436362_0390077 | Ga0436362_0390077_4660_5256 | 188 |
| 273 | 3300005329 | Ga0070683_100606536 | Ga0070683_1006065361 | 189 |
| 274 | 3300005329 | Ga0070683_101161411 | Ga0070683_1011614111 | 189 |
| 275 | 3300005563 | Ga0068855_100132158 | Ga0068855_1001321583 | 189 |
| 276 | 3300005563 | Ga0068855_100391859 | Ga0068855_1003918592 | 189 |
| 277 | 3300009093 | Ga0105240_10009389 | Ga0105240_1000938912 | 189 |
| 278 | 3300013104 | Ga0157370_10006305 | Ga0157370_100063052 | 189 |
| 279 | 3300025913 | Ga0207695_10048495 | Ga0207695_100484956 | 189 |
| 280 | 3300025913 | Ga0207695_10829616 | Ga0207695_108296162 | 189 |
| 281 | 3300025949 | Ga0207667_10011715 | Ga0207667_100117155 | 189 |
| 282 | 3300025949 | Ga0207667_10655246 | Ga0207667_106552462 | 189 |
| 283 | 3300005293 | Ga0065715_10255302 | Ga0065715_102553023 | 190 |
| 284 | 3300005333 | Ga0070677_10010114 | Ga0070677_100101141 | 190 |
| 285 | 3300005340 | Ga0070689_100059732 | Ga0070689_1000597324 | 190 |
| 286 | 3300005356 | Ga0070674_100235412 | Ga0070674_1002354122 | 190 |
| 287 | 3300005364 | Ga0070673_100151093 | Ga0070673_1001510931 | 190 |
| 288 | 3300005456 | Ga0070678_100024629 | Ga0070678_1000246293 | 190 |
| 289 | 3300005456 | Ga0070678_100861522 | Ga0070678_1008615221 | 190 |
| 290 | 3300005459 | Ga0068867_100796728 | Ga0068867_1007967281 | 190 |
| 291 | 3300005536 | Ga0070697_100393529 | Ga0070697_1003935291 | 190 |
| 292 | 3300005981 | Ga0081538_10045599 | Ga0081538_100455992 | 190 |
| 293 | 3300009177 | Ga0105248_10685788 | Ga0105248_106857882 | 190 |
| 294 | 3300013297 | Ga0157378_10231704 | Ga0157378_102317042 | 190 |
| 295 | 3300025893 | Ga0207682_10019363 | Ga0207682_100193634 | 190 |
| 296 | 3300025923 | Ga0207681_10197893 | Ga0207681_101978931 | 190 |
| 297 | 3300025926 | Ga0207659_10089881 | Ga0207659_100898812 | 190 |
| 298 | 3300025936 | Ga0207670_10199962 | Ga0207670_101999622 | 190 |
| 299 | 3300025960 | Ga0207651_10526126 | Ga0207651_105261261 | 190 |
| 300 | 3300026121 | Ga0207683_10035673 | Ga0207683_100356732 | 190 |
| 301 | 3300049585 | Ga0501069_0052143 | Ga0501069_0052143_1669_2268 | 190 |
| 302 | 3300005616 | Ga0068852_100000682 | Ga0068852_1000006826 | 191 |
| 303 | 3300005834 | Ga0068851_10001347 | Ga0068851_100013476 | 191 |
| 304 | 3300006237 | Ga0097621_100024495 | Ga0097621_1000244956 | 191 |
| 305 | 3300009093 | Ga0105240_10091110 | Ga0105240_100911103 | 191 |
| 306 | 3300009174 | Ga0105241_10232605 | Ga0105241_102326052 | 191 |
| 307 | 3300009177 | Ga0105248_10117907 | Ga0105248_101179072 | 191 |
| 308 | 3300025321 | Ga0207656_10000295 | Ga0207656_1000029513 | 191 |
| 309 | 3300025911 | Ga0207654_10159116 | Ga0207654_101591162 | 191 |
| 310 | 3300025913 | Ga0207695_10242574 | Ga0207695_102425742 | 191 |
| 311 | 3300026023 | Ga0207677_10010557 | Ga0207677_100105575 | 191 |
| 312 | 3300026142 | Ga0207698_10009947 | Ga0207698_100099477 | 191 |
| 313 | 3300046531 | Ga0495665_0038510 | Ga0495665_0038510_686_1378 | 191 |
| 314 | 3300048907 | Ga0496104_0142847 | Ga0496104_0142847_119_730 | 191 |
| 315 | 3300048913 | Ga0496110_0058000 | Ga0496110_0058000_2662_3273 | 191 |
| 316 | 3300005338 | Ga0068868_100014468 | Ga0068868_1000144686 | 192 |
| 317 | 3300005338 | Ga0068868_100023939 | Ga0068868_1000239392 | 192 |
| 318 | 3300005539 | Ga0068853_100247168 | Ga0068853_1002471682 | 192 |
| 319 | 3300005577 | Ga0068857_100087189 | Ga0068857_1000871892 | 192 |
| 320 | 3300005616 | Ga0068852_100236724 | Ga0068852_1002367242 | 192 |
| 321 | 3300005616 | Ga0068852_100412422 | Ga0068852_1004124222 | 192 |
| 322 | 3300005618 | Ga0068864_100015352 | Ga0068864_1000153524 | 192 |
| 323 | 3300005841 | Ga0068863_100004295 | Ga0068863_1000042952 | 192 |
| 324 | 3300005842 | Ga0068858_100583315 | Ga0068858_1005833151 | 192 |
| 325 | 3300005843 | Ga0068860_100001039 | Ga0068860_1000010399 | 192 |
| 326 | 3300006358 | Ga0068871_100037485 | Ga0068871_1000374853 | 192 |
| 327 | 3300009094 | Ga0111539_10039733 | Ga0111539_100397333 | 192 |
| 328 | 3300009098 | Ga0105245_10098759 | Ga0105245_100987593 | 192 |
| 329 | 3300009174 | Ga0105241_10044798 | Ga0105241_100447984 | 192 |
| 330 | 3300009174 | Ga0105241_10380673 | Ga0105241_103806732 | 192 |
| 331 | 3300009176 | Ga0105242_10019918 | Ga0105242_100199186 | 192 |
| 332 | 3300009177 | Ga0105248_10487701 | Ga0105248_104877012 | 192 |
| 333 | 3300009551 | Ga0105238_10040183 | Ga0105238_100401833 | 192 |
| 334 | 3300009551 | Ga0105238_10080589 | Ga0105238_100805892 | 192 |
| 335 | 3300010375 | Ga0105239_10046986 | Ga0105239_100469864 | 192 |
| 336 | 3300011119 | Ga0105246_10051748 | Ga0105246_100517482 | 192 |
| 337 | 3300011119 | Ga0105246_10055316 | Ga0105246_100553162 | 192 |
| 338 | 3300011119 | Ga0105246_10359743 | Ga0105246_103597432 | 192 |
| 339 | 3300013102 | Ga0157371_10189437 | Ga0157371_101894372 | 192 |
| 340 | 3300013105 | Ga0157369_10098027 | Ga0157369_100980272 | 192 |
| 341 | 3300013296 | Ga0157374_10794677 | Ga0157374_107946772 | 192 |
| 342 | 3300013307 | Ga0157372_10092772 | Ga0157372_100927724 | 192 |
| 343 | 3300014325 | Ga0163163_10010035 | Ga0163163_100100353 | 192 |
| 344 | 3300014968 | Ga0157379_10001050 | Ga0157379_100010509 | 192 |
| 345 | 3300025924 | Ga0207694_10141953 | Ga0207694_101419532 | 192 |
| 346 | 3300025944 | Ga0207661_10254301 | Ga0207661_102543012 | 192 |
| 347 | 3300026023 | Ga0207677_10016516 | Ga0207677_100165165 | 192 |
| 348 | 3300026035 | Ga0207703_10548894 | Ga0207703_105488941 | 192 |
| 349 | 3300026041 | Ga0207639_10121646 | Ga0207639_101216463 | 192 |
| 350 | 3300026088 | Ga0207641_10031446 | Ga0207641_100314465 | 192 |
| 351 | 3300026088 | Ga0207641_10637071 | Ga0207641_106370712 | 192 |
| 352 | 3300026116 | Ga0207674_10016802 | Ga0207674_100168027 | 192 |
| 353 | 3300026142 | Ga0207698_10312214 | Ga0207698_103122143 | 192 |
| 354 | 3300028381 | Ga0268264_10028728 | Ga0268264_100287283 | 192 |
| 355 | 3300042461 | Ga0439460_0021885 | Ga0439460_0021885_96_686 | 192 |
| 356 | 3300050511 | nmdc:mga08y16_64839_c1 | nmdc:mga08y16_64839_c1_1219_1833 | 192 |
| 357 | 3300053085 | Ga0495619_0197522 | Ga0495619_0197522_132_761 | 192 |
| 358 | 3300030879 | Ga0265765_1003897 | Ga0265765_10038973 | 193 |
| 359 | 3300045049 | Ga0466959_0127173 | Ga0466959_0127173_1091_1708 | 194 |
| 360 | 3300027907 | Ga0207428_10015569 | Ga0207428_100155693 | 195 |
| 361 | 3300031090 | Ga0265760_10010217 | Ga0265760_100102173 | 196 |
| 362 | 3300031090 | Ga0265760_10000634 | Ga0265760_100006347 | 198 |
| 363 | 3300005327 | Ga0070658_10539972 | Ga0070658_105399722 | 201 |
| 364 | 3300005468 | Ga0070707_100355154 | Ga0070707_1003551542 | 201 |
| 365 | 3300005468 | Ga0070707_100769202 | Ga0070707_1007692022 | 201 |
| 366 | 3300005471 | Ga0070698_100708938 | Ga0070698_1007089382 | 201 |
| 367 | 3300005536 | Ga0070697_100000274 | Ga0070697_10000027435 | 201 |
| 368 | 3300025922 | Ga0207646_10137007 | Ga0207646_101370072 | 201 |
| 369 | 3300000546 | LJNas_1001570 | LJNas_10015701 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.9769 | 12 | 189 |
| 4ai5-assembly3.cif.gz_C | crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine | 0.9688 | 13 | 193 |
| 4aia-assembly4.cif.gz_D | the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus | 0.9677 | 13 | 193 |
| 4ai4-assembly1.cif.gz_A | crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus | 0.9518 | 13 | 193 |
| 2ofk-assembly1.cif.gz_A | crystal structure of 3-methyladenine dna glycosylase i (tag) | 0.9507 | 12 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXR7_1_186_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9744 | 18 | 193 | 1.10.340.30 |
| af_C6TKE8_117_301_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9742 | 12 | 191 | 1.10.340.30 |
| af_P05100_1_187_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9467 | 12 | 198 | 1.10.340.30 |
| af_C6TKE8_117_301_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9434 | 12 | 191 | 1.10.340.30 |
| af_A0A1D6I4F4_25_202_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.939 | 17 | 190 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T9GAR2-F1-model_v4 | deleted | 0.9999 | 12 | 191 |
|
| AF-U5CS78-F1-model_v4 | DNA-3-methyladenine glycosylase | 0.9997 | 11 | 191 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A357VPW6-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9995 | 37 | 191 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A496UUB5-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9994 | 28 | 191 |
GO:0006284
GO:0008725 GO:0046872 |
| AF-A0A4R2KPL8-F1-model_v4 | DNA-3-methyladenine glycosylase I | 0.9993 | 12 | 191 |
GO:0006284
GO:0008725 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar