F424967

General Info

Members Datasets Scaffolds Average Seq Length
369 195 369 195

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100355154|Ga0070707_1003551542
Length 218
Sequence MSSPSISDRVRNQVDLKDRRCTWVGSDPLMVIYHDTEWGVPVHDDQKLFEFIVLDAMQAGLNFRIILQKRQNFKQALDGFDPVKIAKYGDRRLDRLLRTEGIIRNRQKLAASIANARATLRVQQDFGSLDAYLWQFVDGRPKINAWNKASQIPATTREAEAMSKALMSRGFKFVGPTICYAFMQAAGLVNDHITDCFRYAQLANAGLPRRAGLGKVQI

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
166 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
167 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0
Rhizoplane 0.81
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001570 3300000546 Bacteria 3154
2 JGI25156J39149_1004117 3300002705 Bacteria 4513
3 JGI25154J39366_1000398 3300002738 Bacteria 23734
4 Ga0055533_1001811 3300003756 Bacteria 5371
5 Ga0055542_1000628 3300003762 Bacteria 29630
6 Ga0055541_1002375 3300003841 Bacteria 3780
7 Ga0065715_10255302 3300005293 Bacteria 1154
8 Ga0070658_10027727 3300005327 Bacteria 4545
9 Ga0070658_10539972 3300005327 Bacteria 1009
10 Ga0070683_100606536 3300005329 Bacteria 1048
11 Ga0070683_101161411 3300005329 Bacteria 742
12 Ga0070690_100060367 3300005330 Bacteria 2440
13 Ga0070677_10010114 3300005333 Bacteria 3217
14 Ga0070666_10006823 3300005335 Bacteria 7036
15 Ga0070666_10048519 3300005335 Bacteria 2853
16 Ga0070680_100413499 3300005336 Bacteria 1150
17 Ga0068868_100014468 3300005338 Bacteria 5815
18 Ga0068868_100023939 3300005338 Bacteria 4627
19 Ga0068868_100082787 3300005338 Bacteria 2574
20 Ga0070660_100275431 3300005339 Bacteria 1376
21 Ga0070689_100059732 3300005340 Bacteria 2963
22 Ga0070661_100242773 3300005344 Bacteria 1388
23 Ga0070661_100482309 3300005344 Bacteria 990
24 Ga0070661_100519248 3300005344 Bacteria 955
25 Ga0070674_100235412 3300005356 Bacteria 1431
26 Ga0070673_100151093 3300005364 Bacteria 1967
27 Ga0070667_100016213 3300005367 Bacteria 6165
28 Ga0070667_100288471 3300005367 Bacteria 1475
29 Ga0070714_100282744 3300005435 Bacteria 1542
30 Ga0070708_100040336 3300005445 Bacteria 4088
31 Ga0070663_100151469 3300005455 Bacteria 1779
32 Ga0070678_100024629 3300005456 Bacteria 4034
33 Ga0070678_100861522 3300005456 Bacteria 826
34 Ga0070681_10028137 3300005458 Bacteria 5651
35 Ga0070681_10303231 3300005458 Bacteria 1507
36 Ga0070681_10352304 3300005458 Bacteria 1382
37 Ga0068867_100625291 3300005459 Bacteria 942
38 Ga0068867_100796728 3300005459 Bacteria 842
39 Ga0070685_10000338 3300005466 Bacteria 28781
40 Ga0070707_100010022 3300005468 Bacteria 8816
41 Ga0070707_100355154 3300005468 Bacteria 1423
42 Ga0070707_100769202 3300005468 Bacteria 926
43 Ga0070698_100048474 3300005471 Bacteria 4340
44 Ga0070698_100708938 3300005471 Bacteria 948
45 Ga0070699_100304611 3300005518 Bacteria 1430
46 Ga0070679_100105789 3300005530 Bacteria 2800
47 Ga0070679_100480553 3300005530 Bacteria 1186
48 Ga0070684_100335284 3300005535 Bacteria 1390
49 Ga0070697_100000274 3300005536 Bacteria 41758
50 Ga0070697_100393529 3300005536 Bacteria 1202
51 Ga0068853_100027131 3300005539 Bacteria 4812
52 Ga0068853_100247168 3300005539 Bacteria 1636
53 Ga0068853_100494768 3300005539 Bacteria 1154
54 Ga0070696_100099795 3300005546 Bacteria 2078
55 Ga0070665_100119094 3300005548 Bacteria 2642
56 Ga0068855_100084128 3300005563 Bacteria 3684
57 Ga0068855_100132158 3300005563 Unclassified 2849
58 Ga0068855_100371150 3300005563 Bacteria 1573
59 Ga0068855_100391859 3300005563 Bacteria 1523
60 Ga0070664_100039664 3300005564 Bacteria 3969
61 Ga0068857_100015813 3300005577 Bacteria 6602
62 Ga0068857_100087189 3300005577 Bacteria 2792
63 Ga0068856_100037434 3300005614 Bacteria 4760
64 Ga0068856_100204268 3300005614 Bacteria 1990
65 Ga0068856_100642840 3300005614 Bacteria 1081
66 Ga0068856_100869498 3300005614 Bacteria 921
67 Ga0068852_100000682 3300005616 Bacteria 22285
68 Ga0068852_100009471 3300005616 Bacteria 7236
69 Ga0068852_100236724 3300005616 Bacteria 1743
70 Ga0068852_100412422 3300005616 Bacteria 1331
71 Ga0068859_100812756 3300005617 Bacteria 1022
72 Ga0068864_100014593 3300005618 Bacteria 6525
73 Ga0068864_100015352 3300005618 Bacteria 6368
74 Ga0068864_101040450 3300005618 Bacteria 813
75 Ga0068866_10184408 3300005718 Bacteria 1235
76 Ga0068851_10001347 3300005834 Bacteria 10733
77 Ga0068863_100004295 3300005841 Bacteria 14034
78 Ga0068858_100010761 3300005842 Bacteria 8649
79 Ga0068858_100029128 3300005842 Bacteria 5126
80 Ga0068858_100583315 3300005842 Bacteria 1084
81 Ga0068860_100001039 3300005843 Bacteria 30519
82 Ga0068860_100011790 3300005843 Bacteria 8614
83 Ga0081538_10045599 3300005981 Bacteria 2715
84 Ga0097621_100016091 3300006237 Bacteria 5646
85 Ga0097621_100024495 3300006237 Bacteria 4714
86 Ga0097621_100031516 3300006237 Bacteria 4208
87 Ga0097621_100038994 3300006237 Bacteria 3814
88 Ga0097621_100118790 3300006237 Bacteria 2241
89 Ga0097621_100119513 3300006237 Bacteria 2234
90 Ga0097621_100451603 3300006237 Bacteria 1158
91 Ga0068871_100013063 3300006358 Bacteria 6156
92 Ga0068871_100015830 3300006358 Bacteria 5660
93 Ga0068871_100037485 3300006358 Bacteria 3867
94 Ga0068871_100042070 3300006358 Bacteria 3666
95 Ga0068871_100118940 3300006358 Bacteria 2230
96 Ga0075431_100031283 3300006847 Bacteria 5482
97 Ga0075433_10221488 3300006852 Bacteria 1681
98 Ga0068865_100177255 3300006881 Bacteria 1639
99 Ga0097620_100812875 3300006931 Bacteria 1022
100 Ga0105240_10001524 3300009093 Bacteria 39410
101 Ga0105240_10009389 3300009093 Bacteria 13857
102 Ga0105240_10089603 3300009093 Bacteria 3762
103 Ga0105240_10091110 3300009093 Bacteria 3726
104 Ga0105240_10269790 3300009093 Bacteria 1960
105 Ga0111539_10025708 3300009094 Bacteria 7213
106 Ga0111539_10039733 3300009094 Bacteria 5669
107 Ga0105245_10017674 3300009098 Bacteria 6224
108 Ga0105245_10052240 3300009098 Bacteria 3665
109 Ga0105245_10085787 3300009098 Bacteria 2887
110 Ga0105245_10098759 3300009098 Bacteria 2698
111 Ga0105247_10138019 3300009101 Bacteria 1595
112 Ga0114129_10957550 3300009147 Bacteria 1081
113 Ga0105241_10013306 3300009174 Bacteria 6030
114 Ga0105241_10029292 3300009174 Bacteria 4107
115 Ga0105241_10044798 3300009174 Bacteria 3353
116 Ga0105241_10071310 3300009174 Bacteria 2697
117 Ga0105241_10232605 3300009174 Bacteria 1554
118 Ga0105241_10380673 3300009174 Bacteria 1233
119 Ga0105241_10772156 3300009174 Bacteria 883
120 Ga0105242_10019918 3300009176 Bacteria 5255
121 Ga0105242_10020945 3300009176 Bacteria 5129
122 Ga0105242_10034643 3300009176 Bacteria 4048
123 Ga0105242_10108364 3300009176 Bacteria 2364
124 Ga0105242_10774516 3300009176 Bacteria 947
125 Ga0105248_10035168 3300009177 Bacteria 5605
126 Ga0105248_10075417 3300009177 Bacteria 3791
127 Ga0105248_10117907 3300009177 Bacteria 2994
128 Ga0105248_10150473 3300009177 Bacteria 2626
129 Ga0105248_10487701 3300009177 Bacteria 1389
130 Ga0105248_10685788 3300009177 Bacteria 1156
131 Ga0105237_10045698 3300009545 Bacteria 4406
132 Ga0105237_10047678 3300009545 Bacteria 4306
133 Ga0105237_10436671 3300009545 Bacteria 1315
134 Ga0105237_10546943 3300009545 Bacteria 1164
135 Ga0105238_10000774 3300009551 Bacteria 33230
136 Ga0105238_10040183 3300009551 Bacteria 4740
137 Ga0105238_10047539 3300009551 Bacteria 4325
138 Ga0105238_10080589 3300009551 Bacteria 3245
139 Ga0105238_10167768 3300009551 Bacteria 2171
140 Ga0105238_10947762 3300009551 Bacteria 880
141 Ga0105239_10014257 3300010375 Bacteria 8824
142 Ga0105239_10046986 3300010375 Bacteria 4730
143 Ga0105239_10060818 3300010375 Bacteria 4145
144 Ga0105239_10074644 3300010375 Bacteria 3728
145 Ga0105239_10166188 3300010375 Bacteria 2467
146 Ga0105239_11393081 3300010375 Bacteria 809
147 Ga0105239_11393083 3300010375 Bacteria 809
148 Ga0105246_10051748 3300011119 Bacteria 2821
149 Ga0105246_10055316 3300011119 Bacteria 2738
150 Ga0105246_10202515 3300011119 Bacteria 1544
151 Ga0105246_10359743 3300011119 Bacteria 1195
152 Ga0105246_11177481 3300011119 Bacteria 704
153 Ga0157373_10127041 3300013100 Bacteria 1793
154 Ga0157373_10216265 3300013100 Bacteria 1351
155 Ga0157371_10189437 3300013102 Bacteria 1472
156 Ga0157370_10006305 3300013104 Bacteria 13107
157 Ga0157370_10038586 3300013104 Bacteria 4620
158 Ga0157370_10062909 3300013104 Bacteria 3518
159 Ga0157370_10416810 3300013104 Bacteria 1236
160 Ga0157370_10444553 3300013104 Bacteria 1192
161 Ga0157369_10000898 3300013105 Bacteria 37983
162 Ga0157369_10037953 3300013105 Bacteria 5270
163 Ga0157369_10098027 3300013105 Bacteria 3127
164 Ga0157369_10242531 3300013105 Bacteria 1882
165 Ga0157374_10051545 3300013296 Bacteria 3830
166 Ga0157374_10794677 3300013296 Bacteria 962
167 Ga0157374_10897654 3300013296 Bacteria 904
168 Ga0157378_10000005 3300013297 Bacteria 197893
169 Ga0157378_10092009 3300013297 Bacteria 2759
170 Ga0157378_10112099 3300013297 Bacteria 2502
171 Ga0157378_10231704 3300013297 Bacteria 1760
172 Ga0157378_10333969 3300013297 Bacteria 1476
173 Ga0157378_10504197 3300013297 Bacteria 1209
174 Ga0163162_10056541 3300013306 Bacteria 3951
175 Ga0163162_10100823 3300013306 Bacteria 2979
176 Ga0157372_10000971 3300013307 Bacteria 31279
177 Ga0157372_10092772 3300013307 Bacteria 3435
178 Ga0157372_10167306 3300013307 Bacteria 2543
179 Ga0157375_10065430 3300013308 Bacteria 3624
180 Ga0163163_10010035 3300014325 Bacteria 8495
181 Ga0163163_10048395 3300014325 Bacteria 4181
182 Ga0163163_10073484 3300014325 Bacteria 3411
183 Ga0163163_12012905 3300014325 Bacteria 637
184 Ga0157379_10001050 3300014968 Bacteria 22453
185 Ga0157379_10087281 3300014968 Bacteria 2797
186 Ga0157376_10080623 3300014969 Bacteria 2792
187 Ga0157376_10277091 3300014969 Bacteria 1578
188 Ga0157376_10470031 3300014969 Bacteria 1230
189 Ga0157376_10840658 3300014969 Bacteria 933
190 Ga0209784_100508 3300025224 Bacteria 15150
191 Ga0209566_100277 3300025225 Bacteria 47887
192 Ga0209674_100081 3300025226 Bacteria 201146
193 Ga0209674_100089 3300025226 Bacteria 178751
194 Ga0209674_100289 3300025226 Bacteria 36645
195 Ga0209646_1000065 3300025246 Bacteria 245452
196 Ga0209026_1003846 3300025250 Bacteria 4736
197 Ga0209677_105100 3300025253 Bacteria 3539
198 Ga0209148_1000113 3300025254 Bacteria 195646
199 Ga0209759_1003567 3300025256 Bacteria 6156
200 Ga0207656_10000295 3300025321 Bacteria 17228
201 Ga0207682_10019363 3300025893 Bacteria 2664
202 Ga0207705_10052722 3300025909 Bacteria 2929
203 Ga0207654_10000208 3300025911 Bacteria 36063
204 Ga0207654_10037572 3300025911 Bacteria 2712
205 Ga0207654_10040352 3300025911 Bacteria 2630
206 Ga0207654_10159116 3300025911 Bacteria 1457
207 Ga0207707_10008404 3300025912 Bacteria 8955
208 Ga0207695_10000271 3300025913 Bacteria 129900
209 Ga0207695_10000651 3300025913 Bacteria 68979
210 Ga0207695_10017171 3300025913 Bacteria 8434
211 Ga0207695_10025548 3300025913 Bacteria 6609
212 Ga0207695_10048495 3300025913 Bacteria 4485
213 Ga0207695_10242574 3300025913 Bacteria 1703
214 Ga0207695_10829616 3300025913 Bacteria 805
215 Ga0207671_10125619 3300025914 Bacteria 1965
216 Ga0207671_10200798 3300025914 Bacteria 1557
217 Ga0207671_10236019 3300025914 Bacteria 1436
218 Ga0207660_10304055 3300025917 Bacteria 1270
219 Ga0207657_10003290 3300025919 Bacteria 17270
220 Ga0207649_10309173 3300025920 Bacteria 1158
221 Ga0207649_10464397 3300025920 Bacteria 957
222 Ga0207652_10032974 3300025921 Bacteria 4360
223 Ga0207646_10129742 3300025922 Bacteria 2268
224 Ga0207646_10137007 3300025922 Bacteria 2204
225 Ga0207681_10197893 3300025923 Bacteria 1541
226 Ga0207694_10003217 3300025924 Bacteria 13018
227 Ga0207694_10025346 3300025924 Bacteria 4507
228 Ga0207694_10027915 3300025924 Bacteria 4302
229 Ga0207694_10029767 3300025924 Bacteria 4167
230 Ga0207694_10141953 3300025924 Bacteria 1932
231 Ga0207694_10202524 3300025924 Bacteria 1615
232 Ga0207659_10089881 3300025926 Bacteria 2291
233 Ga0207687_10036991 3300025927 Bacteria 3328
234 Ga0207687_10067812 3300025927 Bacteria 2539
235 Ga0207687_10076878 3300025927 Bacteria 2399
236 Ga0207664_10648277 3300025929 Bacteria 949
237 Ga0207644_10050051 3300025931 Bacteria 2994
238 Ga0207644_10157087 3300025931 Bacteria 1765
239 Ga0207686_10010873 3300025934 Bacteria 4965
240 Ga0207686_10025568 3300025934 Bacteria 3436
241 Ga0207686_10529648 3300025934 Bacteria 918
242 Ga0207686_10996831 3300025934 Bacteria 680
243 Ga0207670_10199962 3300025936 Bacteria 1518
244 Ga0207711_10031795 3300025941 Bacteria 4458
245 Ga0207711_10045617 3300025941 Bacteria 3746
246 Ga0207711_10062255 3300025941 Bacteria 3218
247 Ga0207711_11282303 3300025941 Bacteria 675
248 Ga0207661_10254301 3300025944 Bacteria 1563
249 Ga0207667_10011715 3300025949 Bacteria 10172
250 Ga0207667_10024942 3300025949 Bacteria 6555
251 Ga0207667_10063966 3300025949 Bacteria 3843
252 Ga0207667_10655246 3300025949 Bacteria 1055
253 Ga0207651_10526126 3300025960 Bacteria 1025
254 Ga0207712_10232182 3300025961 Bacteria 1481
255 Ga0207658_10238495 3300025986 Bacteria 1539
256 Ga0207658_10381140 3300025986 Bacteria 1235
257 Ga0207677_10010557 3300026023 Bacteria 5233
258 Ga0207677_10016516 3300026023 Bacteria 4375
259 Ga0207703_10134153 3300026035 Bacteria 2141
260 Ga0207703_10548894 3300026035 Bacteria 1089
261 Ga0207703_11150639 3300026035 Bacteria 746
262 Ga0207639_10007931 3300026041 Bacteria 7254
263 Ga0207639_10121646 3300026041 Bacteria 2146
264 Ga0207639_10705479 3300026041 Unclassified 936
265 Ga0207678_10433046 3300026067 Bacteria 1141
266 Ga0207702_10205640 3300026078 Bacteria 1828
267 Ga0207641_10019939 3300026088 Bacteria 5504
268 Ga0207641_10031446 3300026088 Bacteria 4402
269 Ga0207641_10276013 3300026088 Bacteria 1579
270 Ga0207641_10637071 3300026088 Bacteria 1046
271 Ga0207648_10047589 3300026089 Bacteria 3759
272 Ga0207676_10003182 3300026095 Bacteria 11695
273 Ga0207674_10011745 3300026116 Bacteria 9826
274 Ga0207674_10016802 3300026116 Bacteria 7998
275 Ga0207683_10035673 3300026121 Bacteria 4326
276 Ga0207698_10009947 3300026142 Bacteria 6084
277 Ga0207698_10074912 3300026142 Bacteria 2702
278 Ga0207698_10091853 3300026142 Bacteria 2486
279 Ga0207698_10312214 3300026142 Bacteria 1469
280 Ga0207698_10493800 3300026142 Bacteria 1190
281 Ga0209983_1062895 3300027665 Bacteria 822
282 Ga0207428_10015569 3300027907 Bacteria 6573
283 Ga0268266_10004206 3300028379 Bacteria 13853
284 Ga0268266_10096957 3300028379 Bacteria 2593
285 Ga0268264_10020378 3300028381 Bacteria 5420
286 Ga0268264_10028728 3300028381 Bacteria 4551
287 Ga0265765_1003897 3300030879 Bacteria 1513
288 Ga0265760_10000634 3300031090 Bacteria 9966
289 Ga0265760_10010217 3300031090 Bacteria 2677
290 Ga0265339_10075455 3300031249 Bacteria 1790
291 Ga0265331_10150477 3300031250 Bacteria 1057
292 Ga0307408_100044366 3300031548 Bacteria 3168
293 Ga0307408_100198132 3300031548 Bacteria 1623
294 Ga0265314_10016062 3300031711 Bacteria 5927
295 Ga0265342_10040539 3300031712 Bacteria 2824
296 Ga0307410_10078846 3300031852 Bacteria 2306
297 Ga0307406_10039952 3300031901 Bacteria 2914
298 Ga0307416_100560184 3300032002 Bacteria 1217
299 Ga0307411_10221140 3300032005 Bacteria 1469
300 Ga0395900_0252168 3300037418 Bacteria 1766
301 Ga0395901_0078373 3300038443 Bacteria 3450
302 Ga0400489_39790 3300039093 Bacteria 3179
303 Ga0436365_0950736 3300039437 Bacteria 1259
304 Ga0436362_0390077 3300039453 Bacteria 6344
305 Ga0439460_0021885 3300042461 Bacteria 1751
306 Ga0466969_0027862 3300044656 Bacteria 2891
307 Ga0466982_0000022 3300044672 Bacteria 95114
308 Ga0453683_0126802 3300044673 Bacteria 1607
309 Ga0466966_0004032 3300044684 Bacteria 9698
310 Ga0466961_0081684 3300044693 Bacteria 2045
311 Ga0466964_0001094 3300044706 Bacteria 9079
312 Ga0466971_0003556 3300044719 Bacteria 6658
313 Ga0466968_0011050 3300044735 Bacteria 3512
314 Ga0466970_0020125 3300044765 Bacteria 3463
315 Ga0466957_0259208 3300044842 Bacteria 1158
316 Ga0466959_0056651 3300045049 Bacteria 2860
317 Ga0466959_0127173 3300045049 Bacteria 1808
318 Ga0466958_0018643 3300045836 Bacteria 4031
319 Ga0466967_1131608 3300045976 Bacteria 780
320 Ga0495665_0038510 3300046531 Bacteria 2549
321 Ga0496104_0142847 3300048907 Bacteria 2299
322 Ga0496110_0058000 3300048913 Bacteria 3410
323 Ga0496112_0081831 3300048915 Bacteria 3194
324 Ga0496118_0019744 3300048921 Bacteria 6009
325 Ga0496126_0051596 3300048929 Bacteria 3744
326 Ga0501292_034072 3300049515 Bacteria 864
327 Ga0501298_044914 3300049521 Bacteria 903
328 Ga0501299_007778 3300049522 Bacteria 1722
329 Ga0501034_0000995 3300049571 Bacteria 40612
330 Ga0501034_0056197 3300049571 Bacteria 3961
331 Ga0501036_0018130 3300049572 Bacteria 5894
332 Ga0501043_0040290 3300049579 Bacteria 3672
333 Ga0501043_0040857 3300049579 Bacteria 3645
334 Ga0501046_0013397 3300049580 Bacteria 6943
335 Ga0501047_0001883 3300049581 Bacteria 20174
336 Ga0501047_0002999 3300049581 Bacteria 16023
337 Ga0501067_0000828 3300049583 Bacteria 16717
338 Ga0501068_0003899 3300049584 Bacteria 8107
339 Ga0501069_0001039 3300049585 Bacteria 13262
340 Ga0501069_0052143 3300049585 Bacteria 2278
341 Ga0501069_0091296 3300049585 Bacteria 1723
342 Ga0501070_0000792 3300049586 Bacteria 28709
343 Ga0501070_0015308 3300049586 Bacteria 6453
344 Ga0501070_0831551 3300049586 Bacteria 723
345 Ga0501071_0207848 3300049587 Bacteria 1472
346 Ga0501072_0001039 3300049588 Bacteria 20541
347 Ga0501073_0000970 3300049589 Bacteria 20676
348 Ga0501073_0136323 3300049589 Bacteria 1701
349 Ga0501074_0005351 3300049590 Bacteria 9227
350 Ga0501074_0067247 3300049590 Bacteria 2577
351 Ga0501076_0570559 3300049592 Bacteria 933
352 Ga0501198_064453 3300049649 Bacteria 679
353 Ga0501249_007749 3300049679 Bacteria 2225
354 Ga0501080_0000488 3300049742 Bacteria 30918
355 Ga0501080_0000782 3300049742 Bacteria 25883
356 Ga0501080_0005831 3300049742 Bacteria 11021
357 Ga0501083_0005678 3300049744 Bacteria 8835
358 Ga0501035_0175294 3300049822 Bacteria 1850
359 Ga0501044_0008495 3300049823 Bacteria 11253
360 nmdc:mga09592_429839_c1 3300050508 Bacteria 1140
361 nmdc:mga06r32_148616_c1 3300050510 Unclassified 2321
362 nmdc:mga06r32_59958_c1 3300050510 Bacteria 2938
363 nmdc:mga08y16_64839_c1 3300050511 Bacteria 3814
364 nmdc:mga0a205_175781_c1 3300050515 Bacteria 2036
365 Ga0495619_0197522 3300053085 Bacteria 1393
366 Ga0500616_0214101 3300053153 Bacteria 845
367 Ga0501084_0145674 3300054114 Bacteria 1995
368 Ga0501084_0511929 3300054114 Bacteria 1014
369 Ga0466962_0023215 3300061719 Bacteria 2981

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100040336 Ga0070708_1000403362 179
2 3300049592 Ga0501076_0570559 Ga0501076_0570559_107_688 179
3 3300025929 Ga0207664_10648277 Ga0207664_106482772 182
4 3300031852 Ga0307410_10078846 Ga0307410_100788464 182
5 3300002705 JGI25156J39149_1004117 JGI25156J39149_10041175 183
6 3300002738 JGI25154J39366_1000398 JGI25154J39366_100039827 183
7 3300003756 Ga0055533_1001811 Ga0055533_10018114 183
8 3300003762 Ga0055542_1000628 Ga0055542_10006289 183
9 3300003841 Ga0055541_1002375 Ga0055541_10023755 183
10 3300025224 Ga0209784_100508 Ga0209784_1005087 183
11 3300025225 Ga0209566_100277 Ga0209566_10027718 183
12 3300025226 Ga0209674_100081 Ga0209674_10008180 183
13 3300025226 Ga0209674_100089 Ga0209674_10008926 183
14 3300025226 Ga0209674_100289 Ga0209674_10028926 183
15 3300025246 Ga0209646_1000065 Ga0209646_1000065118 183
16 3300025250 Ga0209026_1003846 Ga0209026_10038465 183
17 3300025253 Ga0209677_105100 Ga0209677_1051004 183
18 3300025254 Ga0209148_1000113 Ga0209148_1000113107 183
19 3300025256 Ga0209759_1003567 Ga0209759_10035675 183
20 3300005435 Ga0070714_100282744 Ga0070714_1002827441 184
21 3300005471 Ga0070698_100048474 Ga0070698_1000484743 184
22 3300005518 Ga0070699_100304611 Ga0070699_1003046113 184
23 3300027665 Ga0209983_1062895 Ga0209983_10628951 184
24 3300039093 Ga0400489_39790 Ga0400489_39790_2460_3029 184
25 3300044656 Ga0466969_0027862 Ga0466969_0027862_1652_2215 184
26 3300044672 Ga0466982_0000022 Ga0466982_0000022_80845_81408 184
27 3300044684 Ga0466966_0004032 Ga0466966_0004032_3008_3571 184
28 3300044693 Ga0466961_0081684 Ga0466961_0081684_523_1086 184
29 3300044706 Ga0466964_0001094 Ga0466964_0001094_4151_4714 184
30 3300044719 Ga0466971_0003556 Ga0466971_0003556_4775_5338 184
31 3300044735 Ga0466968_0011050 Ga0466968_0011050_876_1439 184
32 3300044765 Ga0466970_0020125 Ga0466970_0020125_2524_3087 184
33 3300044842 Ga0466957_0259208 Ga0466957_0259208_119_685 184
34 3300045049 Ga0466959_0056651 Ga0466959_0056651_2159_2722 184
35 3300045836 Ga0466958_0018643 Ga0466958_0018643_849_1412 184
36 3300061719 Ga0466962_0023215 Ga0466962_0023215_317_880 184
37 3300005330 Ga0070690_100060367 Ga0070690_1000603673 185
38 3300005335 Ga0070666_10006823 Ga0070666_100068231 185
39 3300005339 Ga0070660_100275431 Ga0070660_1002754313 185
40 3300005458 Ga0070681_10303231 Ga0070681_103032313 185
41 3300005530 Ga0070679_100105789 Ga0070679_1001057894 185
42 3300005563 Ga0068855_100371150 Ga0068855_1003711501 185
43 3300005564 Ga0070664_100039664 Ga0070664_1000396642 185
44 3300005614 Ga0068856_100204268 Ga0068856_1002042682 185
45 3300005614 Ga0068856_100869498 Ga0068856_1008694981 185
46 3300005617 Ga0068859_100812756 Ga0068859_1008127562 185
47 3300005618 Ga0068864_101040450 Ga0068864_1010404502 185
48 3300005718 Ga0068866_10184408 Ga0068866_101844082 185
49 3300005842 Ga0068858_100029128 Ga0068858_1000291285 185
50 3300005843 Ga0068860_100011790 Ga0068860_1000117907 185
51 3300006237 Ga0097621_100016091 Ga0097621_1000160914 185
52 3300006237 Ga0097621_100118790 Ga0097621_1001187902 185
53 3300006358 Ga0068871_100015830 Ga0068871_1000158304 185
54 3300006358 Ga0068871_100042070 Ga0068871_1000420706 185
55 3300006852 Ga0075433_10221488 Ga0075433_102214882 185
56 3300006931 Ga0097620_100812875 Ga0097620_1008128752 185
57 3300009094 Ga0111539_10025708 Ga0111539_100257085 185
58 3300009098 Ga0105245_10052240 Ga0105245_100522402 185
59 3300009098 Ga0105245_10085787 Ga0105245_100857873 185
60 3300009147 Ga0114129_10957550 Ga0114129_109575502 185
61 3300009174 Ga0105241_10071310 Ga0105241_100713104 185
62 3300009176 Ga0105242_10020945 Ga0105242_100209453 185
63 3300009176 Ga0105242_10034643 Ga0105242_100346433 185
64 3300009177 Ga0105248_10075417 Ga0105248_100754172 185
65 3300009545 Ga0105237_10045698 Ga0105237_100456983 185
66 3300011119 Ga0105246_10202515 Ga0105246_102025154 185
67 3300011119 Ga0105246_11177481 Ga0105246_111774811 185
68 3300013100 Ga0157373_10127041 Ga0157373_101270412 185
69 3300013104 Ga0157370_10416810 Ga0157370_104168102 185
70 3300013105 Ga0157369_10242531 Ga0157369_102425312 185
71 3300013296 Ga0157374_10051545 Ga0157374_100515454 185
72 3300013297 Ga0157378_10333969 Ga0157378_103339694 185
73 3300013306 Ga0163162_10100823 Ga0163162_101008235 185
74 3300014968 Ga0157379_10087281 Ga0157379_100872816 185
75 3300014969 Ga0157376_10080623 Ga0157376_100806233 185
76 3300014969 Ga0157376_10277091 Ga0157376_102770913 185
77 3300025911 Ga0207654_10040352 Ga0207654_100403522 185
78 3300025914 Ga0207671_10200798 Ga0207671_102007983 185
79 3300025921 Ga0207652_10032974 Ga0207652_100329746 185
80 3300025924 Ga0207694_10003217 Ga0207694_1000321716 185
81 3300025927 Ga0207687_10067812 Ga0207687_100678122 185
82 3300025927 Ga0207687_10076878 Ga0207687_100768782 185
83 3300025931 Ga0207644_10157087 Ga0207644_101570872 185
84 3300025934 Ga0207686_10010873 Ga0207686_100108734 185
85 3300025934 Ga0207686_10025568 Ga0207686_100255682 185
86 3300025941 Ga0207711_10045617 Ga0207711_100456176 185
87 3300025949 Ga0207667_10063966 Ga0207667_100639662 185
88 3300026035 Ga0207703_10134153 Ga0207703_101341534 185
89 3300026078 Ga0207702_10205640 Ga0207702_102056402 185
90 3300026088 Ga0207641_10019939 Ga0207641_100199392 185
91 3300026089 Ga0207648_10047589 Ga0207648_100475894 185
92 3300028381 Ga0268264_10020378 Ga0268264_100203784 185
93 3300031250 Ga0265331_10150477 Ga0265331_101504771 185
94 3300031711 Ga0265314_10016062 Ga0265314_100160623 185
95 3300037418 Ga0395900_0252168 Ga0395900_0252168_316_891 185
96 3300038443 Ga0395901_0078373 Ga0395901_0078373_615_1190 185
97 3300044673 Ga0453683_0126802 Ga0453683_0126802_346_921 185
98 3300049587 Ga0501071_0207848 Ga0501071_0207848_732_1298 185
99 3300050515 nmdc:mga0a205_175781_c1 nmdc:mga0a205_175781_c1_727_1293 185
100 3300053153 Ga0500616_0214101 Ga0500616_0214101_86_673 185
101 3300005327 Ga0070658_10027727 Ga0070658_100277272 186
102 3300005335 Ga0070666_10048519 Ga0070666_100485191 186
103 3300005336 Ga0070680_100413499 Ga0070680_1004134992 186
104 3300005338 Ga0068868_100082787 Ga0068868_1000827872 186
105 3300005344 Ga0070661_100242773 Ga0070661_1002427732 186
106 3300005344 Ga0070661_100519248 Ga0070661_1005192481 186
107 3300005367 Ga0070667_100016213 Ga0070667_1000162135 186
108 3300005367 Ga0070667_100288471 Ga0070667_1002884712 186
109 3300005455 Ga0070663_100151469 Ga0070663_1001514692 186
110 3300005458 Ga0070681_10028137 Ga0070681_100281374 186
111 3300005458 Ga0070681_10352304 Ga0070681_103523042 186
112 3300005459 Ga0068867_100625291 Ga0068867_1006252912 186
113 3300005466 Ga0070685_10000338 Ga0070685_1000033816 186
114 3300005468 Ga0070707_100010022 Ga0070707_1000100227 186
115 3300005530 Ga0070679_100480553 Ga0070679_1004805532 186
116 3300005535 Ga0070684_100335284 Ga0070684_1003352843 186
117 3300005539 Ga0068853_100027131 Ga0068853_1000271315 186
118 3300005539 Ga0068853_100494768 Ga0068853_1004947683 186
119 3300005548 Ga0070665_100119094 Ga0070665_1001190942 186
120 3300005563 Ga0068855_100084128 Ga0068855_1000841284 186
121 3300005577 Ga0068857_100015813 Ga0068857_1000158134 186
122 3300005614 Ga0068856_100037434 Ga0068856_1000374348 186
123 3300005614 Ga0068856_100642840 Ga0068856_1006428402 186
124 3300005616 Ga0068852_100009471 Ga0068852_10000947110 186
125 3300005618 Ga0068864_100014593 Ga0068864_1000145935 186
126 3300005842 Ga0068858_100010761 Ga0068858_1000107618 186
127 3300006237 Ga0097621_100031516 Ga0097621_1000315163 186
128 3300006237 Ga0097621_100038994 Ga0097621_1000389944 186
129 3300006237 Ga0097621_100451603 Ga0097621_1004516031 186
130 3300006358 Ga0068871_100013063 Ga0068871_1000130636 186
131 3300006358 Ga0068871_100118940 Ga0068871_1001189402 186
132 3300006881 Ga0068865_100177255 Ga0068865_1001772552 186
133 3300009093 Ga0105240_10001524 Ga0105240_100015247 186
134 3300009093 Ga0105240_10089603 Ga0105240_100896033 186
135 3300009093 Ga0105240_10269790 Ga0105240_102697901 186
136 3300009098 Ga0105245_10017674 Ga0105245_100176745 186
137 3300009101 Ga0105247_10138019 Ga0105247_101380192 186
138 3300009174 Ga0105241_10013306 Ga0105241_100133064 186
139 3300009174 Ga0105241_10029292 Ga0105241_100292923 186
140 3300009174 Ga0105241_10772156 Ga0105241_107721561 186
141 3300009176 Ga0105242_10108364 Ga0105242_101083643 186
142 3300009176 Ga0105242_10774516 Ga0105242_107745161 186
143 3300009177 Ga0105248_10035168 Ga0105248_100351682 186
144 3300009177 Ga0105248_10150473 Ga0105248_101504732 186
145 3300009545 Ga0105237_10047678 Ga0105237_100476784 186
146 3300009545 Ga0105237_10436671 Ga0105237_104366711 186
147 3300009545 Ga0105237_10546943 Ga0105237_105469432 186
148 3300009551 Ga0105238_10000774 Ga0105238_1000077422 186
149 3300009551 Ga0105238_10047539 Ga0105238_100475398 186
150 3300009551 Ga0105238_10167768 Ga0105238_101677683 186
151 3300009551 Ga0105238_10947762 Ga0105238_109477622 186
152 3300010375 Ga0105239_10014257 Ga0105239_100142575 186
153 3300010375 Ga0105239_10060818 Ga0105239_100608186 186
154 3300010375 Ga0105239_10074644 Ga0105239_100746443 186
155 3300010375 Ga0105239_10166188 Ga0105239_101661883 186
156 3300010375 Ga0105239_11393081 Ga0105239_113930812 186
157 3300010375 Ga0105239_11393083 Ga0105239_113930832 186
158 3300013100 Ga0157373_10216265 Ga0157373_102162652 186
159 3300013104 Ga0157370_10038586 Ga0157370_100385864 186
160 3300013104 Ga0157370_10062909 Ga0157370_100629092 186
161 3300013104 Ga0157370_10444553 Ga0157370_104445533 186
162 3300013105 Ga0157369_10000898 Ga0157369_1000089833 186
163 3300013105 Ga0157369_10037953 Ga0157369_100379537 186
164 3300013296 Ga0157374_10897654 Ga0157374_108976542 186
165 3300013297 Ga0157378_10000005 Ga0157378_10000005132 186
166 3300013297 Ga0157378_10092009 Ga0157378_100920093 186
167 3300013297 Ga0157378_10112099 Ga0157378_101120992 186
168 3300013297 Ga0157378_10504197 Ga0157378_105041972 186
169 3300013306 Ga0163162_10056541 Ga0163162_100565412 186
170 3300013307 Ga0157372_10000971 Ga0157372_1000097118 186
171 3300013307 Ga0157372_10167306 Ga0157372_101673062 186
172 3300013308 Ga0157375_10065430 Ga0157375_100654305 186
173 3300014325 Ga0163163_10048395 Ga0163163_100483953 186
174 3300014325 Ga0163163_10073484 Ga0163163_100734843 186
175 3300014325 Ga0163163_12012905 Ga0163163_120129051 186
176 3300014969 Ga0157376_10470031 Ga0157376_104700311 186
177 3300014969 Ga0157376_10840658 Ga0157376_108406581 186
178 3300025909 Ga0207705_10052722 Ga0207705_100527222 186
179 3300025911 Ga0207654_10000208 Ga0207654_1000020818 186
180 3300025911 Ga0207654_10037572 Ga0207654_100375724 186
181 3300025912 Ga0207707_10008404 Ga0207707_100084045 186
182 3300025913 Ga0207695_10000271 Ga0207695_1000027129 186
183 3300025913 Ga0207695_10000651 Ga0207695_100006516 186
184 3300025913 Ga0207695_10017171 Ga0207695_100171712 186
185 3300025913 Ga0207695_10025548 Ga0207695_100255487 186
186 3300025914 Ga0207671_10125619 Ga0207671_101256193 186
187 3300025914 Ga0207671_10236019 Ga0207671_102360192 186
188 3300025917 Ga0207660_10304055 Ga0207660_103040551 186
189 3300025919 Ga0207657_10003290 Ga0207657_1000329019 186
190 3300025920 Ga0207649_10464397 Ga0207649_104643972 186
191 3300025922 Ga0207646_10129742 Ga0207646_101297422 186
192 3300025924 Ga0207694_10025346 Ga0207694_100253466 186
193 3300025924 Ga0207694_10027915 Ga0207694_100279156 186
194 3300025924 Ga0207694_10202524 Ga0207694_102025242 186
195 3300025927 Ga0207687_10036991 Ga0207687_100369913 186
196 3300025931 Ga0207644_10050051 Ga0207644_100500513 186
197 3300025934 Ga0207686_10529648 Ga0207686_105296482 186
198 3300025934 Ga0207686_10996831 Ga0207686_109968311 186
199 3300025941 Ga0207711_10031795 Ga0207711_100317953 186
200 3300025941 Ga0207711_10062255 Ga0207711_100622553 186
201 3300025941 Ga0207711_11282303 Ga0207711_112823031 186
202 3300025949 Ga0207667_10024942 Ga0207667_100249428 186
203 3300025961 Ga0207712_10232182 Ga0207712_102321822 186
204 3300025986 Ga0207658_10238495 Ga0207658_102384952 186
205 3300026035 Ga0207703_11150639 Ga0207703_111506392 186
206 3300026041 Ga0207639_10007931 Ga0207639_100079316 186
207 3300026041 Ga0207639_10705479 Ga0207639_107054792 186
208 3300026067 Ga0207678_10433046 Ga0207678_104330462 186
209 3300026088 Ga0207641_10276013 Ga0207641_102760132 186
210 3300026095 Ga0207676_10003182 Ga0207676_100031823 186
211 3300026116 Ga0207674_10011745 Ga0207674_100117459 186
212 3300026142 Ga0207698_10074912 Ga0207698_100749127 186
213 3300026142 Ga0207698_10091853 Ga0207698_100918531 186
214 3300026142 Ga0207698_10493800 Ga0207698_104938002 186
215 3300028379 Ga0268266_10096957 Ga0268266_100969572 186
216 3300031249 Ga0265339_10075455 Ga0265339_100754552 186
217 3300031712 Ga0265342_10040539 Ga0265342_100405392 186
218 3300045976 Ga0466967_1131608 Ga0466967_1131608_38_610 186
219 3300048915 Ga0496112_0081831 Ga0496112_0081831_2565_3137 186
220 3300048921 Ga0496118_0019744 Ga0496118_0019744_528_1115 186
221 3300048929 Ga0496126_0051596 Ga0496126_0051596_310_897 186
222 3300049571 Ga0501034_0000995 Ga0501034_0000995_33026_33598 186
223 3300049571 Ga0501034_0056197 Ga0501034_0056197_1986_2558 186
224 3300049572 Ga0501036_0018130 Ga0501036_0018130_3450_4022 186
225 3300049579 Ga0501043_0040290 Ga0501043_0040290_2803_3375 186
226 3300049579 Ga0501043_0040857 Ga0501043_0040857_298_870 186
227 3300049580 Ga0501046_0013397 Ga0501046_0013397_1552_2124 186
228 3300049581 Ga0501047_0001883 Ga0501047_0001883_10376_10948 186
229 3300049581 Ga0501047_0002999 Ga0501047_0002999_15326_15898 186
230 3300049583 Ga0501067_0000828 Ga0501067_0000828_9003_9575 186
231 3300049584 Ga0501068_0003899 Ga0501068_0003899_3670_4242 186
232 3300049585 Ga0501069_0001039 Ga0501069_0001039_1750_2322 186
233 3300049585 Ga0501069_0091296 Ga0501069_0091296_361_933 186
234 3300049586 Ga0501070_0000792 Ga0501070_0000792_16719_17291 186
235 3300049586 Ga0501070_0015308 Ga0501070_0015308_5708_6280 186
236 3300049586 Ga0501070_0831551 Ga0501070_0831551_118_690 186
237 3300049588 Ga0501072_0001039 Ga0501072_0001039_944_1516 186
238 3300049589 Ga0501073_0000970 Ga0501073_0000970_12962_13534 186
239 3300049589 Ga0501073_0136323 Ga0501073_0136323_930_1502 186
240 3300049590 Ga0501074_0005351 Ga0501074_0005351_8364_8936 186
241 3300049590 Ga0501074_0067247 Ga0501074_0067247_1227_1799 186
242 3300049742 Ga0501080_0000488 Ga0501080_0000488_16423_16995 186
243 3300049742 Ga0501080_0000782 Ga0501080_0000782_24377_24949 186
244 3300049742 Ga0501080_0005831 Ga0501080_0005831_8773_9345 186
245 3300049744 Ga0501083_0005678 Ga0501083_0005678_6435_7007 186
246 3300049822 Ga0501035_0175294 Ga0501035_0175294_126_698 186
247 3300049823 Ga0501044_0008495 Ga0501044_0008495_7142_7714 186
248 3300050508 nmdc:mga09592_429839_c1 nmdc:mga09592_429839_c1_321_896 186
249 3300050510 nmdc:mga06r32_59958_c1 nmdc:mga06r32_59958_c1_1504_2079 186
250 3300054114 Ga0501084_0145674 Ga0501084_0145674_1303_1875 186
251 3300054114 Ga0501084_0511929 Ga0501084_0511929_340_912 186
252 3300005546 Ga0070696_100099795 Ga0070696_1000997952 187
253 3300006237 Ga0097621_100119513 Ga0097621_1001195133 187
254 3300006847 Ga0075431_100031283 Ga0075431_1000312834 187
255 3300025924 Ga0207694_10029767 Ga0207694_100297673 187
256 3300025986 Ga0207658_10381140 Ga0207658_103811402 187
257 3300028379 Ga0268266_10004206 Ga0268266_100042061 187
258 3300031548 Ga0307408_100044366 Ga0307408_1000443663 187
259 3300031548 Ga0307408_100198132 Ga0307408_1001981323 187
260 3300031901 Ga0307406_10039952 Ga0307406_100399525 187
261 3300032002 Ga0307416_100560184 Ga0307416_1005601842 187
262 3300032005 Ga0307411_10221140 Ga0307411_102211401 187
263 3300049515 Ga0501292_034072 Ga0501292_034072_69_668 187
264 3300049521 Ga0501298_044914 Ga0501298_044914_264_863 187
265 3300049522 Ga0501299_007778 Ga0501299_007778_1101_1700 187
266 3300049649 Ga0501198_064453 Ga0501198_064453_65_664 187
267 3300049679 Ga0501249_007749 Ga0501249_007749_1180_1779 187
268 3300050510 nmdc:mga06r32_148616_c1 nmdc:mga06r32_148616_c1_708_1283 187
269 3300005344 Ga0070661_100482309 Ga0070661_1004823091 188
270 3300025920 Ga0207649_10309173 Ga0207649_103091732 188
271 3300039437 Ga0436365_0950736 Ga0436365_0950736_146_742 188
272 3300039453 Ga0436362_0390077 Ga0436362_0390077_4660_5256 188
273 3300005329 Ga0070683_100606536 Ga0070683_1006065361 189
274 3300005329 Ga0070683_101161411 Ga0070683_1011614111 189
275 3300005563 Ga0068855_100132158 Ga0068855_1001321583 189
276 3300005563 Ga0068855_100391859 Ga0068855_1003918592 189
277 3300009093 Ga0105240_10009389 Ga0105240_1000938912 189
278 3300013104 Ga0157370_10006305 Ga0157370_100063052 189
279 3300025913 Ga0207695_10048495 Ga0207695_100484956 189
280 3300025913 Ga0207695_10829616 Ga0207695_108296162 189
281 3300025949 Ga0207667_10011715 Ga0207667_100117155 189
282 3300025949 Ga0207667_10655246 Ga0207667_106552462 189
283 3300005293 Ga0065715_10255302 Ga0065715_102553023 190
284 3300005333 Ga0070677_10010114 Ga0070677_100101141 190
285 3300005340 Ga0070689_100059732 Ga0070689_1000597324 190
286 3300005356 Ga0070674_100235412 Ga0070674_1002354122 190
287 3300005364 Ga0070673_100151093 Ga0070673_1001510931 190
288 3300005456 Ga0070678_100024629 Ga0070678_1000246293 190
289 3300005456 Ga0070678_100861522 Ga0070678_1008615221 190
290 3300005459 Ga0068867_100796728 Ga0068867_1007967281 190
291 3300005536 Ga0070697_100393529 Ga0070697_1003935291 190
292 3300005981 Ga0081538_10045599 Ga0081538_100455992 190
293 3300009177 Ga0105248_10685788 Ga0105248_106857882 190
294 3300013297 Ga0157378_10231704 Ga0157378_102317042 190
295 3300025893 Ga0207682_10019363 Ga0207682_100193634 190
296 3300025923 Ga0207681_10197893 Ga0207681_101978931 190
297 3300025926 Ga0207659_10089881 Ga0207659_100898812 190
298 3300025936 Ga0207670_10199962 Ga0207670_101999622 190
299 3300025960 Ga0207651_10526126 Ga0207651_105261261 190
300 3300026121 Ga0207683_10035673 Ga0207683_100356732 190
301 3300049585 Ga0501069_0052143 Ga0501069_0052143_1669_2268 190
302 3300005616 Ga0068852_100000682 Ga0068852_1000006826 191
303 3300005834 Ga0068851_10001347 Ga0068851_100013476 191
304 3300006237 Ga0097621_100024495 Ga0097621_1000244956 191
305 3300009093 Ga0105240_10091110 Ga0105240_100911103 191
306 3300009174 Ga0105241_10232605 Ga0105241_102326052 191
307 3300009177 Ga0105248_10117907 Ga0105248_101179072 191
308 3300025321 Ga0207656_10000295 Ga0207656_1000029513 191
309 3300025911 Ga0207654_10159116 Ga0207654_101591162 191
310 3300025913 Ga0207695_10242574 Ga0207695_102425742 191
311 3300026023 Ga0207677_10010557 Ga0207677_100105575 191
312 3300026142 Ga0207698_10009947 Ga0207698_100099477 191
313 3300046531 Ga0495665_0038510 Ga0495665_0038510_686_1378 191
314 3300048907 Ga0496104_0142847 Ga0496104_0142847_119_730 191
315 3300048913 Ga0496110_0058000 Ga0496110_0058000_2662_3273 191
316 3300005338 Ga0068868_100014468 Ga0068868_1000144686 192
317 3300005338 Ga0068868_100023939 Ga0068868_1000239392 192
318 3300005539 Ga0068853_100247168 Ga0068853_1002471682 192
319 3300005577 Ga0068857_100087189 Ga0068857_1000871892 192
320 3300005616 Ga0068852_100236724 Ga0068852_1002367242 192
321 3300005616 Ga0068852_100412422 Ga0068852_1004124222 192
322 3300005618 Ga0068864_100015352 Ga0068864_1000153524 192
323 3300005841 Ga0068863_100004295 Ga0068863_1000042952 192
324 3300005842 Ga0068858_100583315 Ga0068858_1005833151 192
325 3300005843 Ga0068860_100001039 Ga0068860_1000010399 192
326 3300006358 Ga0068871_100037485 Ga0068871_1000374853 192
327 3300009094 Ga0111539_10039733 Ga0111539_100397333 192
328 3300009098 Ga0105245_10098759 Ga0105245_100987593 192
329 3300009174 Ga0105241_10044798 Ga0105241_100447984 192
330 3300009174 Ga0105241_10380673 Ga0105241_103806732 192
331 3300009176 Ga0105242_10019918 Ga0105242_100199186 192
332 3300009177 Ga0105248_10487701 Ga0105248_104877012 192
333 3300009551 Ga0105238_10040183 Ga0105238_100401833 192
334 3300009551 Ga0105238_10080589 Ga0105238_100805892 192
335 3300010375 Ga0105239_10046986 Ga0105239_100469864 192
336 3300011119 Ga0105246_10051748 Ga0105246_100517482 192
337 3300011119 Ga0105246_10055316 Ga0105246_100553162 192
338 3300011119 Ga0105246_10359743 Ga0105246_103597432 192
339 3300013102 Ga0157371_10189437 Ga0157371_101894372 192
340 3300013105 Ga0157369_10098027 Ga0157369_100980272 192
341 3300013296 Ga0157374_10794677 Ga0157374_107946772 192
342 3300013307 Ga0157372_10092772 Ga0157372_100927724 192
343 3300014325 Ga0163163_10010035 Ga0163163_100100353 192
344 3300014968 Ga0157379_10001050 Ga0157379_100010509 192
345 3300025924 Ga0207694_10141953 Ga0207694_101419532 192
346 3300025944 Ga0207661_10254301 Ga0207661_102543012 192
347 3300026023 Ga0207677_10016516 Ga0207677_100165165 192
348 3300026035 Ga0207703_10548894 Ga0207703_105488941 192
349 3300026041 Ga0207639_10121646 Ga0207639_101216463 192
350 3300026088 Ga0207641_10031446 Ga0207641_100314465 192
351 3300026088 Ga0207641_10637071 Ga0207641_106370712 192
352 3300026116 Ga0207674_10016802 Ga0207674_100168027 192
353 3300026142 Ga0207698_10312214 Ga0207698_103122143 192
354 3300028381 Ga0268264_10028728 Ga0268264_100287283 192
355 3300042461 Ga0439460_0021885 Ga0439460_0021885_96_686 192
356 3300050511 nmdc:mga08y16_64839_c1 nmdc:mga08y16_64839_c1_1219_1833 192
357 3300053085 Ga0495619_0197522 Ga0495619_0197522_132_761 192
358 3300030879 Ga0265765_1003897 Ga0265765_10038973 193
359 3300045049 Ga0466959_0127173 Ga0466959_0127173_1091_1708 194
360 3300027907 Ga0207428_10015569 Ga0207428_100155693 195
361 3300031090 Ga0265760_10010217 Ga0265760_100102173 196
362 3300031090 Ga0265760_10000634 Ga0265760_100006347 198
363 3300005327 Ga0070658_10539972 Ga0070658_105399722 201
364 3300005468 Ga0070707_100355154 Ga0070707_1003551542 201
365 3300005468 Ga0070707_100769202 Ga0070707_1007692022 201
366 3300005471 Ga0070698_100708938 Ga0070698_1007089382 201
367 3300005536 Ga0070697_100000274 Ga0070697_10000027435 201
368 3300025922 Ga0207646_10137007 Ga0207646_101370072 201
369 3300000546 LJNas_1001570 LJNas_10015701 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

23

199

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9769 12 189
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9688 13 193
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9677 13 193
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9518 13 193
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9507 12 189
ID Description Score Start End Superfamily
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9744 18 193 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9742 12 191 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9467 12 198 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9434 12 191 1.10.340.30
af_A0A1D6I4F4_25_202_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.939 17 190 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7T9GAR2-F1-model_v4 deleted 0.9999 12 191
AF-U5CS78-F1-model_v4 DNA-3-methyladenine glycosylase 0.9997 11 191 GO:0006284
GO:0008725
GO:0046872
AF-A0A357VPW6-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9995 37 191 GO:0006284
GO:0008725
GO:0046872
AF-A0A496UUB5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9994 28 191 GO:0006284
GO:0008725
GO:0046872
AF-A0A4R2KPL8-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9993 12 191 GO:0006284
GO:0008725
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map