F424917

General Info

Members Datasets Scaffolds Average Seq Length
369 224 341 462

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10001885|Ga0055531_100018852
Length 491
Sequence MNKGPLHLGGMTSFQRGAAAPSGSHFGHMRKYLLIGVSAFVLGAGTMAYVSPIAQATSASKGQTYKMLELFGDVLQTVDNQYVSEVDNKKLIEAALDGMLTSLDPHSGYLSPDSFEDMQDTTRGEYGGLGIEVTSEDGVVKVISPIDGTPAMRAGIQAGDYITAVNGQSVLGLTVNEAVKQMRGAAGEAVTLTIAREKTDPFDVKLVREVIKPKAAIARMEGDYGYVRLPGFNEKATDALTASINELKAKNPNMKGLIFDLRNNPGGLLDQAVGVSDVFLDGGEVVSQRGRDPRDIQRYNAKPGDLLNGLPVVVLINQGSASAAEIVAGALQDRHRAELVGITSFGKGSVQTVIPLRGGADGALKLTTARYFTPSGRSIQKTGIEPDLEVAQTREQAQDIANRVWFSEASFKNALNADEGKSRQGIHTPAEAPPPGFDDKKGDFQLQRAIAVLKAGSVEAVPKLPKPQAKIAEVTAKAAAAAGKGPPVEKK

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
18 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
19 2818991435 Caulobacter henricii 536 Isolate Unclassified
20 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
21 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
22 2849560528 Caulobacter zeae 410 Isolate Unclassified
23 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
24 2851153111 Caulobacter radicis 736 Isolate Unclassified
25 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
26 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
27 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
28 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
209 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
210 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
213 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
217 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 0
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.78
Nodule 0
Rhizoplane 1.9
Rhizosphere 66.4
Stem 0
Stem Tuber 0
Unclassified 11.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10011772 3300003323 Bacteria 16537
2 Ga0055537_1003552 3300003773 Bacteria 4764
3 Ga0055528_1007040 3300003790 Bacteria 5026
4 Ga0055530_10016271 3300003791 Bacteria 2385
5 Ga0055531_10000528 3300003794 Bacteria 34315
6 Ga0055531_10001885 3300003794 Bacteria 14679
7 Ga0055531_10005057 3300003794 Bacteria 7814
8 Ga0065165_1000554 3300005262 Bacteria 56028
9 Ga0065165_1000711 3300005262 Bacteria 47122
10 Ga0070658_10068309 3300005327 Bacteria 2905
11 Ga0070658_10173776 3300005327 Bacteria 1811
12 Ga0070670_100000022 3300005331 Bacteria 199146
13 Ga0068869_100064935 3300005334 Bacteria 2686
14 Ga0070680_100001019 3300005336 Bacteria 20015
15 Ga0070680_100025604 3300005336 Bacteria 4716
16 Ga0070660_100005603 3300005339 Bacteria 8705
17 Ga0070691_10013005 3300005341 Bacteria 3812
18 Ga0070668_100000042 3300005347 Bacteria 78694
19 Ga0070668_100003919 3300005347 Bacteria 10993
20 Ga0070669_100009491 3300005353 Bacteria 6930
21 Ga0070659_100000399 3300005366 Bacteria 32898
22 Ga0070667_100000508 3300005367 Bacteria 39312
23 Ga0070667_100013615 3300005367 Bacteria 6721
24 Ga0070663_100081124 3300005455 Bacteria 2384
25 Ga0070679_100011485 3300005530 Bacteria 8440
26 Ga0070679_100065487 3300005530 Bacteria 3622
27 Ga0068853_100027385 3300005539 Bacteria 4789
28 Ga0068853_100202315 3300005539 Bacteria 1808
29 Ga0070665_100000418 3300005548 Bacteria 62048
30 Ga0070665_100001884 3300005548 Bacteria 23770
31 Ga0070665_100014450 3300005548 Bacteria 7919
32 Ga0070665_100020455 3300005548 Bacteria 6647
33 Ga0070665_100033122 3300005548 Bacteria 5199
34 Ga0068855_100029782 3300005563 Bacteria 6527
35 Ga0068857_100052215 3300005577 Bacteria 3627
36 Ga0068854_100100902 3300005578 Bacteria 2164
37 Ga0068859_100001582 3300005617 Bacteria 23209
38 Ga0068859_100008132 3300005617 Bacteria 10635
39 Ga0068859_100037204 3300005617 Bacteria 4885
40 Ga0068864_100000757 3300005618 Bacteria 27175
41 Ga0068864_100000993 3300005618 Bacteria 23722
42 Ga0068861_100121357 3300005719 Bacteria 2109
43 Ga0068863_100000066 3300005841 Bacteria 117816
44 Ga0068863_100000119 3300005841 Bacteria 82539
45 Ga0068863_100015421 3300005841 Bacteria 7346
46 Ga0068863_100020615 3300005841 Bacteria 6300
47 Ga0068858_100002124 3300005842 Bacteria 20089
48 Ga0068858_100009974 3300005842 Bacteria 9020
49 Ga0068858_100011263 3300005842 Bacteria 8451
50 Ga0068860_100000133 3300005843 Bacteria 120382
51 Ga0068860_100000212 3300005843 Bacteria 91248
52 Ga0068860_100014882 3300005843 Bacteria 7606
53 Ga0068860_100048892 3300005843 Bacteria 4030
54 Ga0068862_100000619 3300005844 Bacteria 36984
55 Ga0068862_100007242 3300005844 Bacteria 9211
56 Ga0075363_100038688 3300006048 Bacteria 2509
57 Ga0075364_10002819 3300006051 Bacteria 9788
58 Ga0075366_10011615 3300006195 Bacteria 4976
59 Ga0068865_100003519 3300006881 Bacteria 9387
60 Ga0097620_100001582 3300006931 Bacteria 23209
61 Ga0097620_100008132 3300006931 Bacteria 10635
62 Ga0097620_100037205 3300006931 Bacteria 4885
63 Ga0105250_10005952 3300009092 Bacteria 5390
64 Ga0105240_10003577 3300009093 Bacteria 24115
65 Ga0105240_10003732 3300009093 Bacteria 23537
66 Ga0105240_10042086 3300009093 Bacteria 5824
67 Ga0105240_10084567 3300009093 Bacteria 3890
68 Ga0105240_10152854 3300009093 Bacteria 2747
69 Ga0105248_10003646 3300009177 Bacteria 17096
70 Ga0105248_10004488 3300009177 Bacteria 15447
71 Ga0105248_10021697 3300009177 Bacteria 7114
72 Ga0105248_10259985 3300009177 Bacteria 1954
73 Ga0105238_10028628 3300009551 Bacteria 5675
74 Ga0105249_10004052 3300009553 Bacteria 12632
75 Ga0157373_10002536 3300013100 Bacteria 13905
76 Ga0157373_10003975 3300013100 Bacteria 11151
77 Ga0157370_10075130 3300013104 Bacteria 3186
78 Ga0163162_10028334 3300013306 Bacteria 5541
79 Ga0163163_10018549 3300014325 Bacteria 6518
80 Ga0163163_10027653 3300014325 Bacteria 5436
81 Ga0157379_10000947 3300014968 Bacteria 23530
82 Ga0157379_10003056 3300014968 Bacteria 14141
83 Ga0157379_10037451 3300014968 Bacteria 4325
84 Ga0183365_10001 3300015684 Bacteria 2090444
85 Ga0213876_10000081 3300021384 Bacteria 108997
86 Ga0209026_1001029 3300025250 Bacteria 13706
87 Ga0209565_1000149 3300025263 Bacteria 96195
88 Ga0209673_1001274 3300025273 Bacteria 25852
89 Ga0209676_1000295 3300025292 Bacteria 100711
90 Ga0209676_1000414 3300025292 Bacteria 76877
91 Ga0209564_1002321 3300025295 Bacteria 15414
92 Ga0209758_1000936 3300025297 Bacteria 39430
93 Ga0209758_1002036 3300025297 Bacteria 21701
94 Ga0209050_1000245 3300025298 Bacteria 116929
95 Ga0209050_1000362 3300025298 Bacteria 87030
96 Ga0209256_1004236 3300025299 Bacteria 9195
97 Ga0209257_1000036 3300025304 Bacteria 616006
98 Ga0209257_1000282 3300025304 Bacteria 113789
99 Ga0209257_1001133 3300025304 Bacteria 34214
100 Ga0209257_1002271 3300025304 Bacteria 19599
101 Ga0209257_1005655 3300025304 Bacteria 8636
102 Ga0207696_1018916 3300025711 Bacteria 2253
103 Ga0207680_10019623 3300025903 Bacteria 3619
104 Ga0207705_10002027 3300025909 Bacteria 15769
105 Ga0207695_10000837 3300025913 Bacteria 56634
106 Ga0207695_10005800 3300025913 Bacteria 16258
107 Ga0207695_10005852 3300025913 Bacteria 16145
108 Ga0207695_10007867 3300025913 Bacteria 13459
109 Ga0207695_10035230 3300025913 Bacteria 5432
110 Ga0207660_10007742 3300025917 Bacteria 6956
111 Ga0207657_10017426 3300025919 Bacteria 6887
112 Ga0207657_10031047 3300025919 Bacteria 4844
113 Ga0207649_10144218 3300025920 Bacteria 1633
114 Ga0207652_10001554 3300025921 Bacteria 20200
115 Ga0207681_10045426 3300025923 Bacteria 2949
116 Ga0207681_10071186 3300025923 Bacteria 2425
117 Ga0207694_10027756 3300025924 Bacteria 4312
118 Ga0207694_10051459 3300025924 Bacteria 3192
119 Ga0207694_10070939 3300025924 Bacteria 2722
120 Ga0207650_10000016 3300025925 Bacteria 361958
121 Ga0207644_10004006 3300025931 Bacteria 9563
122 Ga0207690_10000898 3300025932 Bacteria 18981
123 Ga0207690_10025165 3300025932 Bacteria 3733
124 Ga0207704_10002243 3300025938 Bacteria 8675
125 Ga0207711_10001468 3300025941 Bacteria 21987
126 Ga0207711_10004188 3300025941 Bacteria 12355
127 Ga0207711_10005857 3300025941 Bacteria 10377
128 Ga0207711_10012427 3300025941 Bacteria 7078
129 Ga0207711_10081899 3300025941 Bacteria 2821
130 Ga0207711_10174195 3300025941 Bacteria 1954
131 Ga0207679_10010042 3300025945 Bacteria 6083
132 Ga0207667_10004404 3300025949 Bacteria 17251
133 Ga0207667_10034966 3300025949 Bacteria 5393
134 Ga0207651_10143842 3300025960 Bacteria 1846
135 Ga0207712_10002726 3300025961 Bacteria 11285
136 Ga0207712_10019620 3300025961 Bacteria 4419
137 Ga0207668_10000019 3300025972 Bacteria 152108
138 Ga0207668_10000241 3300025972 Bacteria 36742
139 Ga0207668_10024037 3300025972 Bacteria 3927
140 Ga0207668_10047301 3300025972 Bacteria 2944
141 Ga0207658_10000295 3300025986 Bacteria 52135
142 Ga0207703_10000049 3300026035 Bacteria 149817
143 Ga0207703_10002213 3300026035 Bacteria 17068
144 Ga0207703_10006921 3300026035 Bacteria 9026
145 Ga0207639_10040578 3300026041 Bacteria 3475
146 Ga0207641_10000011 3300026088 Bacteria 384362
147 Ga0207641_10000612 3300026088 Bacteria 39133
148 Ga0207641_10009691 3300026088 Bacteria 7936
149 Ga0207641_10242566 3300026088 Bacteria 1680
150 Ga0207648_10135510 3300026089 Bacteria 2169
151 Ga0207676_10002400 3300026095 Bacteria 13363
152 Ga0207676_10007791 3300026095 Bacteria 7616
153 Ga0207676_10039557 3300026095 Bacteria 3608
154 Ga0207674_10056120 3300026116 Bacteria 4001
155 Ga0207674_10258922 3300026116 Bacteria 1687
156 Ga0268266_10000003 3300028379 Bacteria 1701703
157 Ga0268266_10001814 3300028379 Bacteria 24161
158 Ga0268266_10003648 3300028379 Bacteria 15221
159 Ga0268266_10022099 3300028379 Bacteria 5423
160 Ga0268265_10001088 3300028380 Bacteria 24179
161 Ga0268265_10002074 3300028380 Bacteria 15637
162 Ga0268265_10007210 3300028380 Bacteria 7513
163 Ga0268265_10059397 3300028380 Bacteria 2925
164 Ga0268264_10000091 3300028381 Bacteria 233338
165 Ga0268264_10000207 3300028381 Bacteria 120086
166 Ga0268264_10008205 3300028381 Bacteria 8673
167 Ga0268264_10048705 3300028381 Bacteria 3525
168 Ga0307517_10000835 3300028786 Bacteria 53001
169 Ga0307517_10056810 3300028786 Bacteria 3808
170 Ga0307517_10058084 3300028786 Bacteria 3735
171 Ga0307515_10018388 3300028794 Bacteria 12655
172 Ga0265338_10021352 3300028800 Bacteria 6756
173 Ga0265338_10024430 3300028800 Bacteria 6174
174 Ga0265338_10123287 3300028800 Bacteria 2061
175 Ga0307511_10044142 3300030521 Bacteria 3708
176 Ga0265340_10030661 3300031247 Bacteria 2695
177 Ga0265327_10000110 3300031251 Bacteria 181251
178 Ga0265327_10000868 3300031251 Bacteria 44811
179 Ga0265327_10002406 3300031251 Bacteria 19853
180 Ga0307513_10000873 3300031456 Bacteria 43622
181 Ga0307513_10007022 3300031456 Bacteria 14647
182 Ga0307513_10007347 3300031456 Bacteria 14297
183 Ga0307513_10010412 3300031456 Bacteria 11657
184 Ga0307508_10080728 3300031616 Bacteria 2834
185 Ga0307516_10000030 3300031730 Bacteria 159694
186 Ga0307510_10017521 3300033180 Bacteria 8445
187 Ga0307510_10081427 3300033180 Bacteria 3139
188 Ga0307510_10086562 3300033180 Bacteria 3005
189 Ga0373946_0019579 3300035171 Bacteria 2609
190 Ga0373927_0000173 3300035695 Bacteria 50996
191 Ga0373933_0103781 3300035724 Bacteria 1767
192 Ga0373925_0000049 3300037068 Bacteria 128065
193 Ga0395899_0000052 3300037312 Bacteria 221643
194 Ga0395900_0000002 3300037418 Bacteria 671103
195 Ga0395900_0021999 3300037418 Bacteria 6520
196 Ga0395900_0126917 3300037418 Bacteria 2616
197 Ga0395898_0013561 3300037466 Bacteria 8388
198 Ga0395905_0000022 3300037471 Bacteria 321527
199 Ga0395905_0003587 3300037471 Bacteria 16515
200 Ga0395905_0009313 3300037471 Bacteria 9607
201 Ga0395905_0013716 3300037471 Bacteria 7759
202 Ga0395905_0048275 3300037471 Bacteria 3990
203 Ga0395901_0000013 3300038443 Bacteria 375733
204 Ga0395901_0041811 3300038443 Bacteria 4751
205 Ga0436365_0656099 3300039437 Bacteria 4996
206 Ga0436365_0895597 3300039437 Bacteria 3128
207 Ga0436365_1238940 3300039437 Bacteria 40642
208 Ga0436361_0011345 3300039447 Bacteria 39413
209 Ga0439465_0024076 3300041413 Bacteria 1918
210 Ga0439441_005814 3300042001 Bacteria 1932
211 Ga0466969_0023137 3300044656 Bacteria 3202
212 Ga0466966_0003014 3300044684 Bacteria 11108
213 Ga0466966_0066840 3300044684 Bacteria 2259
214 Ga0466961_0029791 3300044693 Bacteria 3506
215 Ga0466971_0000311 3300044719 Bacteria 18786
216 Ga0466970_0056787 3300044765 Bacteria 2092
217 Ga0466957_0001331 3300044842 Bacteria 12898
218 Ga0466959_0005667 3300045049 Bacteria 8593
219 Ga0466959_0137307 3300045049 Bacteria 1730
220 Ga0466958_0005692 3300045836 Bacteria 6731
221 Ga0495627_000879 3300046453 Bacteria 21159
222 Ga0495590_0002209 3300046457 Bacteria 8131
223 Ga0495638_0000441 3300046460 Bacteria 50064
224 Ga0495638_0001712 3300046460 Bacteria 19316
225 Ga0495638_0002843 3300046460 Bacteria 13873
226 Ga0495638_0003079 3300046460 Bacteria 13234
227 Ga0495638_0010399 3300046460 Bacteria 6468
228 Ga0495651_0229997 3300046462 Bacteria 1278
229 Ga0495650_0000046 3300046471 Bacteria 342987
230 Ga0495585_0036351 3300046492 Bacteria 2779
231 Ga0495596_0046547 3300046500 Bacteria 1704
232 Ga0495583_0000003 3300046506 Bacteria 709273
233 Ga0495583_0017464 3300046506 Bacteria 3807
234 Ga0495606_0002829 3300046507 Bacteria 19251
235 Ga0495610_0001569 3300046512 Bacteria 20131
236 Ga0495610_0002476 3300046512 Bacteria 15481
237 Ga0495610_0004650 3300046512 Bacteria 10038
238 Ga0495616_0003767 3300046513 Bacteria 9673
239 Ga0495620_0021516 3300046515 Bacteria 3131
240 Ga0495628_0078199 3300046516 Bacteria 2573
241 Ga0495632_0009448 3300046519 Bacteria 5885
242 Ga0495637_0002096 3300046520 Bacteria 11216
243 Ga0495637_0034386 3300046520 Bacteria 2220
244 Ga0495643_0021717 3300046522 Bacteria 3675
245 Ga0495648_0000553 3300046524 Bacteria 40143
246 Ga0495654_0000039 3300046530 Bacteria 185363
247 Ga0495609_0022104 3300046538 Bacteria 2932
248 Ga0495597_0003672 3300046542 Bacteria 8809
249 Ga0495645_0020765 3300046543 Bacteria 4744
250 Ga0495622_0000865 3300046557 Bacteria 16582
251 Ga0495668_0000141 3300046616 Bacteria 108840
252 Ga0495668_0017238 3300046616 Bacteria 4192
253 Ga0495668_0047210 3300046616 Bacteria 2391
254 Ga0495625_0000854 3300046660 Bacteria 41503
255 Ga0495625_0030844 3300046660 Bacteria 3995
256 Ga0495669_0000014 3300046684 Bacteria 140832
257 Ga0495669_0013682 3300046684 Bacteria 3463
258 Ga0495613_0000606 3300046689 Bacteria 28653
259 Ga0495671_0044173 3300046692 Bacteria 2235
260 Ga0495589_0045195 3300046794 Bacteria 2188
261 Ga0495660_0079070 3300046810 Bacteria 1728
262 Ga0495672_0006648 3300047320 Bacteria 8884
263 Ga0495679_002625 3300047446 Bacteria 9023
264 Ga0495673_0000853 3300047469 Bacteria 28329
265 Ga0495673_0002362 3300047469 Bacteria 13394
266 Ga0495673_0002411 3300047469 Bacteria 13183
267 Ga0495686_0003003 3300047472 Bacteria 14994
268 Ga0495686_0005941 3300047472 Bacteria 9499
269 Ga0495686_0008466 3300047472 Bacteria 7545
270 Ga0495686_0114262 3300047472 Bacteria 1616
271 Ga0496101_0101776 3300048904 Bacteria 2151
272 Ga0496102_0029701 3300048905 Bacteria 4892
273 Ga0496107_0000200 3300048910 Bacteria 31399
274 Ga0496107_0082271 3300048910 Bacteria 2348
275 Ga0496110_0045521 3300048913 Bacteria 3836
276 Ga0496115_0000398 3300048918 Bacteria 35876
277 Ga0496115_0061290 3300048918 Bacteria 3033
278 Ga0496118_0003370 3300048921 Bacteria 20186
279 Ga0496121_0000042 3300048924 Bacteria 342304
280 Ga0496121_0001011 3300048924 Bacteria 50244
281 Ga0496124_0004035 3300048927 Bacteria 17450
282 Ga0496126_0006901 3300048929 Bacteria 12578
283 Ga0495678_004316 3300049459 Bacteria 8281
284 Ga0501033_0102750 3300049570 Bacteria 2085
285 Ga0501034_0078328 3300049571 Bacteria 3310
286 Ga0501037_0073026 3300049573 Bacteria 2495
287 Ga0501043_0059490 3300049579 Bacteria 2999
288 Ga0501047_0002867 3300049581 Bacteria 16362
289 Ga0501047_0004238 3300049581 Bacteria 13503
290 Ga0501047_0166995 3300049581 Bacteria 2071
291 Ga0501047_0245915 3300049581 Bacteria 1638
292 Ga0501257_005515 3300049686 Bacteria 2791
293 Ga0501035_0001647 3300049822 Bacteria 22563
294 Ga0501044_0001701 3300049823 Bacteria 25811
295 nmdc:mga00v17_725_c1 3300050491 Bacteria 18009
296 nmdc:mga0k408_89786_c1 3300050493 Bacteria 1805
297 nmdc:mga07m45_41179_c1 3300050496 Bacteria 2586
298 Ga0500635_0000172 3300053080 Bacteria 33572
299 Ga0500635_0006944 3300053080 Bacteria 3047
300 Ga0500578_0000077 3300053086 Bacteria 108269
301 Ga0500643_000458 3300053087 Bacteria 30192
302 Ga0500643_017395 3300053087 Bacteria 2408
303 Ga0500644_0000194 3300053088 Bacteria 37615
304 Ga0500647_0005791 3300053091 Bacteria 5167
305 Ga0500641_0002022 3300053096 Bacteria 7201
306 Ga0500641_0002332 3300053096 Bacteria 6725
307 Ga0500556_0001380 3300053104 Bacteria 10608
308 Ga0500556_0023023 3300053104 Bacteria 2030
309 Ga0500562_000787 3300053108 Bacteria 7749
310 Ga0500562_000830 3300053108 Bacteria 7522
311 Ga0500562_002662 3300053108 Bacteria 4441
312 Ga0500569_002175 3300053109 Bacteria 3824
313 Ga0500572_000556 3300053111 Bacteria 12713
314 Ga0500594_0000360 3300053118 Bacteria 10136
315 Ga0500595_017547 3300053119 Bacteria 2639
316 Ga0500595_021934 3300053119 Bacteria 2272
317 Ga0500608_000028 3300053122 Bacteria 66949
318 Ga0500608_000578 3300053122 Bacteria 13519
319 Ga0500608_002674 3300053122 Bacteria 6536
320 Ga0500614_000902 3300053123 Bacteria 7485
321 Ga0500618_000189 3300053125 Bacteria 50500
322 Ga0500559_0000042 3300053136 Bacteria 101570
323 Ga0500559_0000221 3300053136 Bacteria 45774
324 Ga0500559_0003397 3300053136 Bacteria 7846
325 Ga0500559_0018108 3300053136 Bacteria 2977
326 Ga0500564_000177 3300053138 Bacteria 17045
327 Ga0500577_0003448 3300053142 Bacteria 4107
328 Ga0500590_004633 3300053148 Bacteria 6517
329 Ga0500622_0003711 3300053156 Bacteria 10011
330 Ga0500622_0004483 3300053156 Bacteria 8749
331 Ga0500622_0044312 3300053156 Bacteria 2305
332 Ga0500622_0093826 3300053156 Bacteria 1485
333 Ga0500627_0013483 3300053158 Bacteria 3101
334 Ga0500636_0003575 3300053177 Bacteria 8761
335 Ga0500636_0009231 3300053177 Bacteria 5733
336 Ga0500637_0011222 3300053178 Bacteria 4624
337 Ga0500637_0078322 3300053178 Bacteria 1907
338 Ga0500625_016778 3300053729 Bacteria 3416
339 Ga0500645_002714 3300053730 Bacteria 7686
340 Ga0500645_002864 3300053730 Bacteria 7391
341 Ga0500645_024892 3300053730 Bacteria 1827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0229997 Ga0495651_0229997_45_1199 359
2 3300044765 Ga0466970_0056787 Ga0466970_0056787_12_1274 392
3 3300047472 Ga0495686_0114262 Ga0495686_0114262_11_1312 409
4 3300026116 Ga0207674_10258922 Ga0207674_102589222 410
5 3300041413 Ga0439465_0024076 Ga0439465_0024076_626_1900 411
6 3300042001 Ga0439441_005814 Ga0439441_005814_630_1907 411
7 3300047469 Ga0495673_0000853 Ga0495673_0000853_5225_6613 429
8 3300053136 Ga0500559_0000221 Ga0500559_0000221_11132_12526 429
9 3300046512 Ga0495610_0002476 Ga0495610_0002476_11255_12646 432
10 3300003773 Ga0055537_1003552 Ga0055537_10035522 435
11 3300003790 Ga0055528_1007040 Ga0055528_10070402 435
12 3300025263 Ga0209565_1000149 Ga0209565_100014926 435
13 3300025273 Ga0209673_1001274 Ga0209673_10012744 435
14 3300025299 Ga0209256_1004236 Ga0209256_10042366 435
15 3300049570 Ga0501033_0102750 Ga0501033_0102750_237_1718 435
16 3300053087 Ga0500643_000458 Ga0500643_000458_4901_6277 436
17 3300053096 Ga0500641_0002022 Ga0500641_0002022_2228_3604 436
18 3300053156 Ga0500622_0093826 Ga0500622_0093826_11_1387 436
19 3300053730 Ga0500645_002864 Ga0500645_002864_5800_7176 436
20 3300003794 Ga0055531_10000528 Ga0055531_100005287 437
21 3300025292 Ga0209676_1000295 Ga0209676_100029583 437
22 3300025292 Ga0209676_1000414 Ga0209676_100041411 437
23 3300025298 Ga0209050_1000362 Ga0209050_100036275 437
24 3300025304 Ga0209257_1000282 Ga0209257_100028278 437
25 3300025304 Ga0209257_1005655 Ga0209257_10056554 437
26 3300048927 Ga0496124_0004035 Ga0496124_0004035_1061_2452 437
27 3300048929 Ga0496126_0006901 Ga0496126_0006901_6570_7961 437
28 3300050496 nmdc:mga07m45_41179_c1 nmdc:mga07m45_41179_c1_98_1489 437
29 3300053122 Ga0500608_000028 Ga0500608_000028_19167_20558 437
30 3300053136 Ga0500559_0003397 Ga0500559_0003397_1667_3058 437
31 3300053177 Ga0500636_0003575 Ga0500636_0003575_5546_6967 437
32 3300025941 Ga0207711_10004188 Ga0207711_100041888 439
33 3300028794 Ga0307515_10018388 Ga0307515_100183886 440
34 3300031247 Ga0265340_10030661 Ga0265340_100306612 440
35 3300046660 Ga0495625_0000854 Ga0495625_0000854_26782_28173 440
36 3300005334 Ga0068869_100064935 Ga0068869_1000649352 441
37 3300028380 Ga0268265_10059397 Ga0268265_100593972 441
38 3300035724 Ga0373933_0103781 Ga0373933_0103781_139_1572 441
39 3300046689 Ga0495613_0000606 Ga0495613_0000606_14333_15763 441
40 3300048918 Ga0496115_0061290 Ga0496115_0061290_1248_2684 441
41 iso_pu_bacteria 2582581279 2585148785 441
42 3300049822 Ga0501035_0001647 Ga0501035_0001647_20240_21691 442
43 iso_pu_bacteria 2510917020 2511123176 442
44 iso_pu_bacteria 2582581280 2585152596 442
45 iso_pu_bacteria 2582581293 2585196877 442
46 iso_pu_bacteria 2585428106 2587919089 442
47 iso_pu_bacteria 2643221545 2643748931 442
48 iso_pu_bacteria 2643221552 2643783113 442
49 iso_pu_bacteria 2643221583 2643927023 442
50 iso_pu_bacteria 2643221584 2643930287 442
51 iso_pu_bacteria 2643221640 2644227501 442
52 iso_pu_bacteria 2643221642 2644236981 442
53 iso_pu_bacteria 2643221691 2644509310 442
54 iso_pu_bacteria 2791355048 2792460407 442
55 iso_pu_bacteria 2843744320 2843745095 442
56 iso_pu_bacteria 2849560528 2849564113 442
57 iso_pu_bacteria 2849573788 2849575574 442
58 iso_pu_bacteria 2851153111 2851155244 442
59 iso_pu_bacteria 2857504554 2857508492 442
60 iso_pu_bacteria 2898329390 2898331141 442
61 iso_pu_bacteria 2928531327 2928531787 442
62 3300006195 Ga0075366_10011615 Ga0075366_100116156 443
63 3300009093 Ga0105240_10003577 Ga0105240_1000357724 443
64 3300025913 Ga0207695_10005800 Ga0207695_100058009 443
65 iso_pu_bacteria 2884960567 2884961288 443
66 3300013100 Ga0157373_10002536 Ga0157373_100025368 444
67 3300013100 Ga0157373_10003975 Ga0157373_100039758 444
68 3300021384 Ga0213876_10000081 Ga0213876_10000081101 444
69 3300025945 Ga0207679_10010042 Ga0207679_100100421 444
70 3300031251 Ga0265327_10000868 Ga0265327_1000086815 444
71 3300039437 Ga0436365_1238940 Ga0436365_1238940_15064_16464 444
72 3300046500 Ga0495596_0046547 Ga0495596_0046547_233_1672 444
73 3300053091 Ga0500647_0005791 Ga0500647_0005791_462_1859 444
74 3300053111 Ga0500572_000556 Ga0500572_000556_4470_5891 444
75 3300053136 Ga0500559_0000042 Ga0500559_0000042_21185_22621 444
76 3300026088 Ga0207641_10242566 Ga0207641_102425661 445
77 3300028800 Ga0265338_10024430 Ga0265338_100244302 445
78 3300031251 Ga0265327_10002406 Ga0265327_100024067 445
79 3300033180 Ga0307510_10081427 Ga0307510_100814272 445
80 3300037418 Ga0395900_0126917 Ga0395900_0126917_1044_2426 445
81 3300037471 Ga0395905_0048275 Ga0395905_0048275_1756_3189 445
82 3300038443 Ga0395901_0041811 Ga0395901_0041811_2174_3607 445
83 3300046457 Ga0495590_0002209 Ga0495590_0002209_4493_5878 445
84 3300046460 Ga0495638_0000441 Ga0495638_0000441_43539_44924 445
85 3300046460 Ga0495638_0010399 Ga0495638_0010399_3340_4725 445
86 3300046512 Ga0495610_0001569 Ga0495610_0001569_12316_13701 445
87 3300046520 Ga0495637_0034386 Ga0495637_0034386_181_1566 445
88 3300046524 Ga0495648_0000553 Ga0495648_0000553_5076_6461 445
89 3300046616 Ga0495668_0017238 Ga0495668_0017238_1001_2386 445
90 3300046692 Ga0495671_0044173 Ga0495671_0044173_259_1644 445
91 3300047469 Ga0495673_0002411 Ga0495673_0002411_5250_6635 445
92 3300047472 Ga0495686_0005941 Ga0495686_0005941_6452_7837 445
93 3300049459 Ga0495678_004316 Ga0495678_004316_2424_3809 445
94 3300053086 Ga0500578_0000077 Ga0500578_0000077_7049_8434 445
95 3300053088 Ga0500644_0000194 Ga0500644_0000194_10474_11859 445
96 3300053104 Ga0500556_0023023 Ga0500556_0023023_423_1808 445
97 3300053108 Ga0500562_002662 Ga0500562_002662_441_1826 445
98 3300053118 Ga0500594_0000360 Ga0500594_0000360_4495_5880 445
99 3300053138 Ga0500564_000177 Ga0500564_000177_10908_12293 445
100 3300053156 Ga0500622_0003711 Ga0500622_0003711_3573_5045 445
101 3300053156 Ga0500622_0004483 Ga0500622_0004483_2677_4062 445
102 iso_pu_bacteria 2643221614 2644087290 445
103 iso_pu_bacteria 2643221661 2644344666 445
104 iso_pu_bacteria 2643221666 2644366650 445
105 3300003791 Ga0055530_10016271 Ga0055530_100162712 446
106 3300003794 Ga0055531_10001885 Ga0055531_100018852 446
107 3300003794 Ga0055531_10005057 Ga0055531_100050572 446
108 3300005262 Ga0065165_1000554 Ga0065165_10005548 446
109 3300005262 Ga0065165_1000711 Ga0065165_100071144 446
110 3300005327 Ga0070658_10068309 Ga0070658_100683092 446
111 3300005327 Ga0070658_10173776 Ga0070658_101737762 446
112 3300005331 Ga0070670_100000022 Ga0070670_1000000229 446
113 3300005336 Ga0070680_100001019 Ga0070680_10000101915 446
114 3300005336 Ga0070680_100025604 Ga0070680_1000256046 446
115 3300005339 Ga0070660_100005603 Ga0070660_1000056034 446
116 3300005341 Ga0070691_10013005 Ga0070691_100130052 446
117 3300005347 Ga0070668_100000042 Ga0070668_1000000425 446
118 3300005347 Ga0070668_100003919 Ga0070668_10000391912 446
119 3300005353 Ga0070669_100009491 Ga0070669_1000094917 446
120 3300005366 Ga0070659_100000399 Ga0070659_10000039928 446
121 3300005367 Ga0070667_100000508 Ga0070667_1000005088 446
122 3300005367 Ga0070667_100013615 Ga0070667_1000136157 446
123 3300005455 Ga0070663_100081124 Ga0070663_1000811241 446
124 3300005530 Ga0070679_100011485 Ga0070679_1000114854 446
125 3300005530 Ga0070679_100065487 Ga0070679_1000654873 446
126 3300005539 Ga0068853_100202315 Ga0068853_1002023152 446
127 3300005548 Ga0070665_100000418 Ga0070665_10000041844 446
128 3300005548 Ga0070665_100001884 Ga0070665_10000188422 446
129 3300005548 Ga0070665_100014450 Ga0070665_1000144508 446
130 3300005548 Ga0070665_100020455 Ga0070665_1000204557 446
131 3300005548 Ga0070665_100033122 Ga0070665_1000331222 446
132 3300005563 Ga0068855_100029782 Ga0068855_1000297824 446
133 3300005577 Ga0068857_100052215 Ga0068857_1000522153 446
134 3300005578 Ga0068854_100100902 Ga0068854_1001009021 446
135 3300005617 Ga0068859_100001582 Ga0068859_10000158220 446
136 3300005617 Ga0068859_100037204 Ga0068859_1000372043 446
137 3300005618 Ga0068864_100000757 Ga0068864_10000075710 446
138 3300005618 Ga0068864_100000993 Ga0068864_1000009937 446
139 3300005719 Ga0068861_100121357 Ga0068861_1001213571 446
140 3300005841 Ga0068863_100000066 Ga0068863_100000066102 446
141 3300005841 Ga0068863_100000119 Ga0068863_10000011937 446
142 3300005841 Ga0068863_100015421 Ga0068863_1000154212 446
143 3300005842 Ga0068858_100002124 Ga0068858_10000212415 446
144 3300005842 Ga0068858_100009974 Ga0068858_1000099749 446
145 3300005842 Ga0068858_100011263 Ga0068858_1000112635 446
146 3300005843 Ga0068860_100000133 Ga0068860_100000133115 446
147 3300005843 Ga0068860_100000212 Ga0068860_10000021285 446
148 3300005843 Ga0068860_100048892 Ga0068860_1000488923 446
149 3300005844 Ga0068862_100000619 Ga0068862_1000006193 446
150 3300006048 Ga0075363_100038688 Ga0075363_1000386881 446
151 3300006051 Ga0075364_10002819 Ga0075364_100028197 446
152 3300006881 Ga0068865_100003519 Ga0068865_1000035195 446
153 3300006931 Ga0097620_100001582 Ga0097620_10000158210 446
154 3300006931 Ga0097620_100037205 Ga0097620_1000372054 446
155 3300009092 Ga0105250_10005952 Ga0105250_100059522 446
156 3300009093 Ga0105240_10003732 Ga0105240_1000373211 446
157 3300009093 Ga0105240_10042086 Ga0105240_100420862 446
158 3300009093 Ga0105240_10084567 Ga0105240_100845673 446
159 3300009093 Ga0105240_10152854 Ga0105240_101528542 446
160 3300009177 Ga0105248_10003646 Ga0105248_1000364611 446
161 3300009177 Ga0105248_10004488 Ga0105248_100044888 446
162 3300009177 Ga0105248_10021697 Ga0105248_100216977 446
163 3300009177 Ga0105248_10259985 Ga0105248_102599851 446
164 3300009551 Ga0105238_10028628 Ga0105238_100286281 446
165 3300009553 Ga0105249_10004052 Ga0105249_100040528 446
166 3300013306 Ga0163162_10028334 Ga0163162_100283346 446
167 3300014325 Ga0163163_10018549 Ga0163163_100185498 446
168 3300014325 Ga0163163_10027653 Ga0163163_100276532 446
169 3300014968 Ga0157379_10000947 Ga0157379_100009475 446
170 3300014968 Ga0157379_10003056 Ga0157379_1000305614 446
171 3300014968 Ga0157379_10037451 Ga0157379_100374512 446
172 3300025250 Ga0209026_1001029 Ga0209026_100102913 446
173 3300025295 Ga0209564_1002321 Ga0209564_10023218 446
174 3300025297 Ga0209758_1000936 Ga0209758_100093629 446
175 3300025297 Ga0209758_1002036 Ga0209758_100203610 446
176 3300025298 Ga0209050_1000245 Ga0209050_100024575 446
177 3300025304 Ga0209257_1000036 Ga0209257_100003642 446
178 3300025304 Ga0209257_1001133 Ga0209257_100113324 446
179 3300025304 Ga0209257_1002271 Ga0209257_100227113 446
180 3300025711 Ga0207696_1018916 Ga0207696_10189162 446
181 3300025903 Ga0207680_10019623 Ga0207680_100196232 446
182 3300025909 Ga0207705_10002027 Ga0207705_1000202714 446
183 3300025913 Ga0207695_10000837 Ga0207695_1000083735 446
184 3300025913 Ga0207695_10005852 Ga0207695_1000585212 446
185 3300025913 Ga0207695_10007867 Ga0207695_1000786711 446
186 3300025913 Ga0207695_10035230 Ga0207695_100352302 446
187 3300025917 Ga0207660_10007742 Ga0207660_100077425 446
188 3300025919 Ga0207657_10017426 Ga0207657_100174261 446
189 3300025919 Ga0207657_10031047 Ga0207657_100310476 446
190 3300025920 Ga0207649_10144218 Ga0207649_101442181 446
191 3300025921 Ga0207652_10001554 Ga0207652_1000155418 446
192 3300025923 Ga0207681_10045426 Ga0207681_100454262 446
193 3300025924 Ga0207694_10027756 Ga0207694_100277563 446
194 3300025924 Ga0207694_10051459 Ga0207694_100514592 446
195 3300025924 Ga0207694_10070939 Ga0207694_100709393 446
196 3300025925 Ga0207650_10000016 Ga0207650_10000016138 446
197 3300025931 Ga0207644_10004006 Ga0207644_100040066 446
198 3300025932 Ga0207690_10000898 Ga0207690_1000089820 446
199 3300025932 Ga0207690_10025165 Ga0207690_100251652 446
200 3300025938 Ga0207704_10002243 Ga0207704_100022436 446
201 3300025941 Ga0207711_10001468 Ga0207711_1000146822 446
202 3300025941 Ga0207711_10005857 Ga0207711_1000585712 446
203 3300025941 Ga0207711_10012427 Ga0207711_100124277 446
204 3300025941 Ga0207711_10081899 Ga0207711_100818992 446
205 3300025941 Ga0207711_10174195 Ga0207711_101741951 446
206 3300025949 Ga0207667_10004404 Ga0207667_1000440410 446
207 3300025949 Ga0207667_10034966 Ga0207667_100349663 446
208 3300025960 Ga0207651_10143842 Ga0207651_101438421 446
209 3300025961 Ga0207712_10002726 Ga0207712_100027268 446
210 3300025961 Ga0207712_10019620 Ga0207712_100196203 446
211 3300025972 Ga0207668_10000019 Ga0207668_10000019106 446
212 3300025972 Ga0207668_10000241 Ga0207668_1000024119 446
213 3300025972 Ga0207668_10047301 Ga0207668_100473012 446
214 3300025986 Ga0207658_10000295 Ga0207658_1000029540 446
215 3300026035 Ga0207703_10000049 Ga0207703_10000049154 446
216 3300026035 Ga0207703_10002213 Ga0207703_100022132 446
217 3300026035 Ga0207703_10006921 Ga0207703_100069219 446
218 3300026088 Ga0207641_10000011 Ga0207641_10000011287 446
219 3300026088 Ga0207641_10000612 Ga0207641_1000061237 446
220 3300026089 Ga0207648_10135510 Ga0207648_101355101 446
221 3300026095 Ga0207676_10002400 Ga0207676_100024004 446
222 3300026095 Ga0207676_10007791 Ga0207676_100077915 446
223 3300026095 Ga0207676_10039557 Ga0207676_100395573 446
224 3300026116 Ga0207674_10056120 Ga0207674_100561203 446
225 3300028379 Ga0268266_10000003 Ga0268266_100000031141 446
226 3300028379 Ga0268266_10001814 Ga0268266_1000181425 446
227 3300028379 Ga0268266_10003648 Ga0268266_100036488 446
228 3300028379 Ga0268266_10022099 Ga0268266_100220991 446
229 3300028380 Ga0268265_10001088 Ga0268265_1000108811 446
230 3300028380 Ga0268265_10002074 Ga0268265_100020742 446
231 3300028381 Ga0268264_10000091 Ga0268264_10000091179 446
232 3300028381 Ga0268264_10000207 Ga0268264_1000020757 446
233 3300028381 Ga0268264_10048705 Ga0268264_100487053 446
234 3300028786 Ga0307517_10000835 Ga0307517_1000083536 446
235 3300028786 Ga0307517_10056810 Ga0307517_100568102 446
236 3300028786 Ga0307517_10058084 Ga0307517_100580842 446
237 3300030521 Ga0307511_10044142 Ga0307511_100441422 446
238 3300031456 Ga0307513_10007347 Ga0307513_1000734712 446
239 3300031456 Ga0307513_10010412 Ga0307513_100104122 446
240 3300031616 Ga0307508_10080728 Ga0307508_100807282 446
241 3300033180 Ga0307510_10017521 Ga0307510_100175217 446
242 3300035171 Ga0373946_0019579 Ga0373946_0019579_574_1962 446
243 3300035695 Ga0373927_0000173 Ga0373927_0000173_12426_13814 446
244 3300037068 Ga0373925_0000049 Ga0373925_0000049_55195_56583 446
245 3300037312 Ga0395899_0000052 Ga0395899_0000052_86821_88224 446
246 3300037418 Ga0395900_0000002 Ga0395900_0000002_614243_615646 446
247 3300037418 Ga0395900_0021999 Ga0395900_0021999_1631_3034 446
248 3300037466 Ga0395898_0013561 Ga0395898_0013561_6016_7419 446
249 3300037471 Ga0395905_0003587 Ga0395905_0003587_2730_4133 446
250 3300037471 Ga0395905_0013716 Ga0395905_0013716_3085_4488 446
251 3300038443 Ga0395901_0000013 Ga0395901_0000013_88139_89542 446
252 3300039437 Ga0436365_0656099 Ga0436365_0656099_2494_3885 446
253 3300044684 Ga0466966_0066840 Ga0466966_0066840_820_2205 446
254 3300046453 Ga0495627_000879 Ga0495627_000879_5655_7043 446
255 3300046460 Ga0495638_0001712 Ga0495638_0001712_6188_7579 446
256 3300046492 Ga0495585_0036351 Ga0495585_0036351_1249_2646 446
257 3300046506 Ga0495583_0017464 Ga0495583_0017464_872_2257 446
258 3300046516 Ga0495628_0078199 Ga0495628_0078199_580_1977 446
259 3300046522 Ga0495643_0021717 Ga0495643_0021717_16_1410 446
260 3300046538 Ga0495609_0022104 Ga0495609_0022104_573_1967 446
261 3300046542 Ga0495597_0003672 Ga0495597_0003672_1289_2683 446
262 3300046543 Ga0495645_0020765 Ga0495645_0020765_3167_4564 446
263 3300046557 Ga0495622_0000865 Ga0495622_0000865_3992_5386 446
264 3300046616 Ga0495668_0047210 Ga0495668_0047210_875_2266 446
265 3300046684 Ga0495669_0013682 Ga0495669_0013682_40_1434 446
266 3300046794 Ga0495589_0045195 Ga0495589_0045195_749_2137 446
267 3300046810 Ga0495660_0079070 Ga0495660_0079070_166_1557 446
268 3300047469 Ga0495673_0002362 Ga0495673_0002362_2617_4008 446
269 3300047472 Ga0495686_0003003 Ga0495686_0003003_12316_13710 446
270 3300048905 Ga0496102_0029701 Ga0496102_0029701_1825_3219 446
271 3300048910 Ga0496107_0082271 Ga0496107_0082271_59_1444 446
272 3300048913 Ga0496110_0045521 Ga0496110_0045521_245_1630 446
273 3300048918 Ga0496115_0000398 Ga0496115_0000398_23945_25333 446
274 3300048921 Ga0496118_0003370 Ga0496118_0003370_1557_2951 446
275 3300048924 Ga0496121_0000042 Ga0496121_0000042_104878_106272 446
276 3300049581 Ga0501047_0002867 Ga0501047_0002867_4162_5550 446
277 3300049581 Ga0501047_0245915 Ga0501047_0245915_96_1484 446
278 3300049686 Ga0501257_005515 Ga0501257_005515_540_1937 446
279 3300050491 nmdc:mga00v17_725_c1 nmdc:mga00v17_725_c1_3137_4525 446
280 3300050493 nmdc:mga0k408_89786_c1 nmdc:mga0k408_89786_c1_61_1449 446
281 3300053080 Ga0500635_0000172 Ga0500635_0000172_3435_4829 446
282 3300053087 Ga0500643_017395 Ga0500643_017395_267_1643 446
283 3300053096 Ga0500641_0002332 Ga0500641_0002332_2346_3734 446
284 3300053108 Ga0500562_000787 Ga0500562_000787_2215_3606 446
285 3300053108 Ga0500562_000830 Ga0500562_000830_2846_4234 446
286 3300053109 Ga0500569_002175 Ga0500569_002175_1086_2480 446
287 3300053119 Ga0500595_017547 Ga0500595_017547_242_1636 446
288 3300053119 Ga0500595_021934 Ga0500595_021934_82_1473 446
289 3300053122 Ga0500608_002674 Ga0500608_002674_4647_6041 446
290 3300053123 Ga0500614_000902 Ga0500614_000902_5129_6523 446
291 3300053136 Ga0500559_0018108 Ga0500559_0018108_57_1451 446
292 3300053142 Ga0500577_0003448 Ga0500577_0003448_2196_3584 446
293 3300053148 Ga0500590_004633 Ga0500590_004633_687_2081 446
294 3300053156 Ga0500622_0044312 Ga0500622_0044312_45_1436 446
295 3300053177 Ga0500636_0009231 Ga0500636_0009231_485_1879 446
296 3300053178 Ga0500637_0011222 Ga0500637_0011222_1775_3169 446
297 3300053178 Ga0500637_0078322 Ga0500637_0078322_169_1563 446
298 3300053729 Ga0500625_016778 Ga0500625_016778_965_2359 446
299 3300053730 Ga0500645_024892 Ga0500645_024892_250_1641 446
300 iso_pu_bacteria 2643221598 2643998753 446
301 iso_pu_bacteria 2818991435 2819537671 446
302 iso_pu_bacteria 2818991454 2819647448 446
303 3300005617 Ga0068859_100008132 Ga0068859_1000081328 447
304 3300005841 Ga0068863_100020615 Ga0068863_1000206154 447
305 3300005843 Ga0068860_100014882 Ga0068860_1000148824 447
306 3300005844 Ga0068862_100007242 Ga0068862_1000072424 447
307 3300006931 Ga0097620_100008132 Ga0097620_1000081328 447
308 3300025923 Ga0207681_10071186 Ga0207681_100711862 447
309 3300025972 Ga0207668_10024037 Ga0207668_100240372 447
310 3300026088 Ga0207641_10009691 Ga0207641_100096916 447
311 3300028380 Ga0268265_10007210 Ga0268265_100072107 447
312 3300028381 Ga0268264_10008205 Ga0268264_100082054 447
313 3300028800 Ga0265338_10021352 Ga0265338_100213521 447
314 3300031456 Ga0307513_10007022 Ga0307513_1000702217 447
315 3300031730 Ga0307516_10000030 Ga0307516_1000003098 447
316 3300033180 Ga0307510_10086562 Ga0307510_100865622 447
317 3300046460 Ga0495638_0002843 Ga0495638_0002843_10330_11724 447
318 3300046460 Ga0495638_0003079 Ga0495638_0003079_6762_8156 447
319 3300046471 Ga0495650_0000046 Ga0495650_0000046_104844_106238 447
320 3300046506 Ga0495583_0000003 Ga0495583_0000003_199791_201185 447
321 3300046507 Ga0495606_0002829 Ga0495606_0002829_10684_12078 447
322 3300046512 Ga0495610_0004650 Ga0495610_0004650_6401_7795 447
323 3300046513 Ga0495616_0003767 Ga0495616_0003767_1516_2910 447
324 3300046515 Ga0495620_0021516 Ga0495620_0021516_337_1731 447
325 3300046519 Ga0495632_0009448 Ga0495632_0009448_3166_4560 447
326 3300046520 Ga0495637_0002096 Ga0495637_0002096_6067_7461 447
327 3300046530 Ga0495654_0000039 Ga0495654_0000039_7214_8608 447
328 3300046616 Ga0495668_0000141 Ga0495668_0000141_93076_94467 447
329 3300047320 Ga0495672_0006648 Ga0495672_0006648_4143_5537 447
330 3300047446 Ga0495679_002625 Ga0495679_002625_6612_8006 447
331 3300047472 Ga0495686_0008466 Ga0495686_0008466_75_1469 447
332 3300048904 Ga0496101_0101776 Ga0496101_0101776_590_1984 447
333 3300048910 Ga0496107_0000200 Ga0496107_0000200_3837_5231 447
334 3300048924 Ga0496121_0001011 Ga0496121_0001011_21912_23306 447
335 3300049573 Ga0501037_0073026 Ga0501037_0073026_940_2334 447
336 3300049581 Ga0501047_0004238 Ga0501047_0004238_23_1432 447
337 3300049581 Ga0501047_0166995 Ga0501047_0166995_457_1851 447
338 3300049823 Ga0501044_0001701 Ga0501044_0001701_847_2241 447
339 3300053104 Ga0500556_0001380 Ga0500556_0001380_5475_6869 447
340 3300053125 Ga0500618_000189 Ga0500618_000189_20148_21542 447
341 3300053158 Ga0500627_0013483 Ga0500627_0013483_813_2207 447
342 3300053730 Ga0500645_002714 Ga0500645_002714_4618_6012 447
343 3300046660 Ga0495625_0030844 Ga0495625_0030844_398_1789 448
344 3300046684 Ga0495669_0000014 Ga0495669_0000014_35386_36777 448
345 3300031456 Ga0307513_10000873 Ga0307513_1000087312 449
346 3300039437 Ga0436365_0895597 Ga0436365_0895597_201_1655 449
347 3300039447 Ga0436361_0011345 Ga0436361_0011345_5543_6976 449
348 3300005539 Ga0068853_100027385 Ga0068853_1000273854 450
349 3300026041 Ga0207639_10040578 Ga0207639_100405783 450
350 3300028800 Ga0265338_10123287 Ga0265338_101232872 450
351 3300031251 Ga0265327_10000110 Ga0265327_1000011037 450
352 3300013104 Ga0157370_10075130 Ga0157370_100751302 456
353 3300015684 Ga0183365_10001 Ga0183365_10001627 456
354 3300053122 Ga0500608_000578 Ga0500608_000578_2967_4463 456
355 3300049571 Ga0501034_0078328 Ga0501034_0078328_1219_2691 457
356 3300044842 Ga0466957_0001331 Ga0466957_0001331_8998_10461 459
357 iso_pu_bacteria 2739367756 2739792563 459
358 3300044656 Ga0466969_0023137 Ga0466969_0023137_57_1520 460
359 3300044684 Ga0466966_0003014 Ga0466966_0003014_921_2384 460
360 3300044693 Ga0466961_0029791 Ga0466961_0029791_31_1494 460
361 3300044719 Ga0466971_0000311 Ga0466971_0000311_11831_13294 460
362 3300045049 Ga0466959_0005667 Ga0466959_0005667_2541_4004 460
363 3300045836 Ga0466958_0005692 Ga0466958_0005692_4220_5683 460
364 3300049579 Ga0501043_0059490 Ga0501043_0059490_435_1901 461
365 3300037471 Ga0395905_0000022 Ga0395905_0000022_100553_102010 463
366 3300045049 Ga0466959_0137307 Ga0466959_0137307_176_1624 463
367 3300053080 Ga0500635_0006944 Ga0500635_0006944_331_1815 463
368 3300003323 rootH1_10011772 rootH1_1001177215 465
369 3300037471 Ga0395905_0009313 Ga0395905_0009313_5882_7354 465

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03572

Peptidase_S41

Peptidase family S41

223

390

0.97

PF17820

PDZ_6

PDZ domain

141

196

0.95

PF00595

PDZ

PDZ domain

118

195

0.92

PF13180

PDZ_2

PDZ domain

127

206

0.9

PF22694

CtpB_N-like

Activating protease CtpB N-terminal domain

35

114

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bxg-assembly1.cif.gz_A 1.45 angstrom resolution crystal structure of pdz domain of carboxy-terminal protease from vibrio cholerae in complex with peptide. 0.9089 95 183
2zpm-assembly1.cif.gz_A crystal structure analysis of pdz domain b 0.8737 110 179
4rqy-assembly2.cif.gz_B re-refined structure of 1te0 - structural analysis of degs, a stress sensor of the bacterial periplasm 0.8653 95 182
4rr1-assembly1.cif.gz_A re-refinement of entry 1sot, crystal structure of the degs stress sensor 0.8605 95 182
6ew9-assembly1.cif.gz_C crystal structure of degs stress sensor protease in complex with activating dnrlglvyqf peptide 0.8602 95 184
ID Description Score Start End Superfamily
af_Q5ZA08_147_239_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9434 97 181 2.30.42.10
af_O23614_210_301_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9185 97 183 2.30.42.10
1fc6A02 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9182 97 183 2.30.42.10
af_Q9VCS4_31_120_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9051 97 166 2.30.42.10
af_Q8I103_336_425_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8733 99 164 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A7S0TP60-F1-model_v4 PDZ domain-containing protein 0.9475 95 181
AF-A0A2E5T0W1-F1-model_v4 PDZ domain-containing protein 0.9445 95 182 GO:0004175
GO:0007165
GO:0016020
GO:0030288
AF-A0A7S0YHU7-F1-model_v4 PDZ domain-containing protein 0.9398 95 183
AF-A0A538Q8G7-F1-model_v4 PDZ domain-containing protein 0.9328 95 181 GO:0030246
AF-A0A2H0DLI1-F1-model_v4 PDZ domain-containing protein 0.9256 90 179

Feature Viewer

pLDDT pTM Quality
75.16 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map