F424773

General Info

Members Datasets Scaffolds Average Seq Length
368 168 736 225

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0139621|Ga0395899_0139621_162_974
Length 270
Sequence MRIAFVWSHAAEIDKPRIDFSPKFGGRYGGAGRVVQRLPSRGRAAISGRVTEIPPDIEWRTSESPVPYDEARAFMEQRAAAIRSGDASECVWLLEHPPLFTAGTSADPAELFNPLGFPVYEAGRGGRYTYHGPGQRVGYVMLDLDKRGKDIRCFVHSLEQWMIAALAELGVDAHRADGRIGIWVGAGAEEAKIGALGVRVRRWVTLHGFSLNVAPDLSHFAGIVPCGIEEFGVTSLDMLGKQMPLTSVDAALKRGFMPFLKALERKCKES

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
143 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
144 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0139621 3300037312 Bacteria 1725
2 JGI24739J22299_10081767 3300001989 Bacteria 992
3 JGI24737J22298_10087003 3300001990 Bacteria 928
4 JGI24743J22301_10005651 3300001991 Bacteria 2095
5 JGI24738J21930_10022694 3300002075 Bacteria 1297
6 Ga0065715_10014750 3300005293 Bacteria 1938
7 Ga0070658_10000033 3300005327 Bacteria 147380
8 Ga0070658_10012545 3300005327 Bacteria 6798
9 Ga0070676_10045987 3300005328 Bacteria 2544
10 Ga0070676_10170486 3300005328 Bacteria 1407
11 Ga0070690_100543097 3300005330 Bacteria 875
12 Ga0070670_100021736 3300005331 Bacteria 5518
13 Ga0070670_100238158 3300005331 Bacteria 1584
14 Ga0070677_10000514 3300005333 Bacteria 13266
15 Ga0070677_10002442 3300005333 Bacteria 5937
16 Ga0070677_10047485 3300005333 Bacteria 1721
17 Ga0070677_10051490 3300005333 Bacteria 1667
18 Ga0070666_10011685 3300005335 Bacteria 5521
19 Ga0070666_10203599 3300005335 Bacteria 1393
20 Ga0070680_100030889 3300005336 Bacteria 4304
21 Ga0068868_100000122 3300005338 Bacteria 49376
22 Ga0070660_100001694 3300005339 Bacteria 15120
23 Ga0070660_100038955 3300005339 Bacteria 3611
24 Ga0070660_100057385 3300005339 Bacteria 3015
25 Ga0070661_100292333 3300005344 Bacteria 1266
26 Ga0070692_10013866 3300005345 Bacteria 3767
27 Ga0070668_100068065 3300005347 Bacteria 2767
28 Ga0070668_100080331 3300005347 Bacteria 2554
29 Ga0070668_100119824 3300005347 Bacteria 2102
30 Ga0070669_100024764 3300005353 Bacteria 4306
31 Ga0070669_100048826 3300005353 Bacteria 3089
32 Ga0070669_100175435 3300005353 Bacteria 1673
33 Ga0070675_100001144 3300005354 Bacteria 19142
34 Ga0070675_100006999 3300005354 Bacteria 8667
35 Ga0070675_100400381 3300005354 Bacteria 1224
36 Ga0070671_100029903 3300005355 Bacteria 4494
37 Ga0070671_100037802 3300005355 Bacteria 4005
38 Ga0070674_100152930 3300005356 Bacteria 1743
39 Ga0070674_100199989 3300005356 Bacteria 1542
40 Ga0070673_100020250 3300005364 Bacteria 4795
41 Ga0070673_100320291 3300005364 Bacteria 1369
42 Ga0070659_100000032 3300005366 Bacteria 120241
43 Ga0070659_100004241 3300005366 Bacteria 10237
44 Ga0070659_100007209 3300005366 Bacteria 8069
45 Ga0070659_100016270 3300005366 Bacteria 5583
46 Ga0070659_100045682 3300005366 Bacteria 3431
47 Ga0070659_100072708 3300005366 Bacteria 2736
48 Ga0070659_100101311 3300005366 Bacteria 2318
49 Ga0070659_100275632 3300005366 Bacteria 1398
50 Ga0070667_100055027 3300005367 Bacteria 3360
51 Ga0070667_100091902 3300005367 Bacteria 2610
52 Ga0070713_100037458 3300005436 Bacteria 3921
53 Ga0070705_100658609 3300005440 Bacteria 817
54 Ga0070663_100012118 3300005455 Bacteria 5442
55 Ga0070678_100058167 3300005456 Bacteria 2836
56 Ga0070662_100021710 3300005457 Bacteria 4387
57 Ga0070662_100078292 3300005457 Bacteria 2455
58 Ga0070662_100325835 3300005457 Bacteria 1254
59 Ga0070662_100431497 3300005457 Bacteria 1091
60 Ga0070662_100605523 3300005457 Bacteria 922
61 Ga0068867_100006599 3300005459 Bacteria 8202
62 Ga0070685_10201615 3300005466 Bacteria 1293
63 Ga0070679_100000084 3300005530 Bacteria 70823
64 Ga0070684_100122857 3300005535 Bacteria 2336
65 Ga0068853_100080985 3300005539 Bacteria 2842
66 Ga0070672_100057872 3300005543 Bacteria 3044
67 Ga0070672_100145163 3300005543 Bacteria 1960
68 Ga0070665_100000605 3300005548 Bacteria 49400
69 Ga0070665_100003133 3300005548 Bacteria 17806
70 Ga0070665_100012206 3300005548 Bacteria 8662
71 Ga0070665_100017069 3300005548 Bacteria 7281
72 Ga0070665_100020365 3300005548 Bacteria 6661
73 Ga0070665_100034841 3300005548 Bacteria 5064
74 Ga0070704_100594786 3300005549 Bacteria 972
75 Ga0068855_100284839 3300005563 Bacteria 1834
76 Ga0070664_100010130 3300005564 Bacteria 7643
77 Ga0070664_100022864 3300005564 Bacteria 5157
78 Ga0070664_100188579 3300005564 Bacteria 1836
79 Ga0068857_100021880 3300005577 Bacteria 5627
80 Ga0068857_100770124 3300005577 Bacteria 917
81 Ga0068854_100037591 3300005578 Bacteria 3399
82 Ga0068854_100108495 3300005578 Bacteria 2090
83 Ga0068852_100150245 3300005616 Bacteria 2165
84 Ga0068859_100047994 3300005617 Bacteria 4290
85 Ga0068859_100206811 3300005617 Bacteria 2048
86 Ga0068864_100067223 3300005618 Bacteria 3112
87 Ga0068863_100000131 3300005841 Bacteria 79059
88 Ga0068863_100003427 3300005841 Bacteria 15621
89 Ga0068863_100009521 3300005841 Bacteria 9476
90 Ga0068863_100021539 3300005841 Bacteria 6151
91 Ga0068863_100146651 3300005841 Bacteria 2257
92 Ga0068858_100022969 3300005842 Bacteria 5816
93 Ga0068860_100023617 3300005843 Bacteria 5942
94 Ga0068860_100050928 3300005843 Bacteria 3941
95 Ga0068862_100022631 3300005844 Bacteria 5258
96 Ga0068862_100084025 3300005844 Bacteria 2765
97 Ga0068862_100186633 3300005844 Bacteria 1863
98 Ga0081539_10025865 3300005985 Bacteria 3762
99 Ga0070717_10002536 3300006028 Bacteria 12862
100 Ga0075366_10192273 3300006195 Bacteria 1240
101 Ga0068871_100283703 3300006358 Bacteria 1449
102 Ga0068865_100020678 3300006881 Bacteria 4271
103 Ga0097620_100047991 3300006931 Bacteria 4290
104 Ga0097620_100206817 3300006931 Bacteria 2048
105 Ga0111539_10034238 3300009094 Bacteria 6162
106 Ga0105245_10072856 3300009098 Bacteria 3122
107 Ga0105245_10172062 3300009098 Bacteria 2063
108 Ga0105245_10235012 3300009098 Bacteria 1774
109 Ga0105243_10026939 3300009148 Bacteria 4402
110 Ga0105243_10073096 3300009148 Bacteria 2777
111 Ga0105242_10129586 3300009176 Bacteria 2175
112 Ga0105242_10755182 3300009176 Bacteria 958
113 Ga0105248_10093474 3300009177 Bacteria 3387
114 Ga0105248_10712549 3300009177 Bacteria 1132
115 Ga0105249_10465168 3300009553 Bacteria 1305
116 Ga0105246_10029057 3300011119 Bacteria 3636
117 Ga0157373_10146613 3300013100 Bacteria 1660
118 Ga0157371_10020597 3300013102 Bacteria 4853
119 Ga0157370_10108085 3300013104 Bacteria 2601
120 Ga0157369_10001977 3300013105 Bacteria 24695
121 Ga0157369_10009206 3300013105 Bacteria 11299
122 Ga0157374_10080171 3300013296 Bacteria 3095
123 Ga0157378_10656546 3300013297 Bacteria 1065
124 Ga0163162_10061583 3300013306 Bacteria 3790
125 Ga0157372_10033582 3300013307 Bacteria 5637
126 Ga0157372_11119157 3300013307 Bacteria 911
127 Ga0157375_10083594 3300013308 Bacteria 3237
128 Ga0163163_10008688 3300014325 Bacteria 9034
129 Ga0157380_10020886 3300014326 Bacteria 4903
130 Ga0157380_10147355 3300014326 Bacteria 2030
131 Ga0157377_10204489 3300014745 Bacteria 1256
132 Ga0213876_10000460 3300021384 Bacteria 32585
133 Ga0207697_10049932 3300025315 Bacteria 1727
134 Ga0207682_10001990 3300025893 Bacteria 9247
135 Ga0207682_10027693 3300025893 Bacteria 2258
136 Ga0207682_10113970 3300025893 Bacteria 1193
137 Ga0207688_10016578 3300025901 Bacteria 3997
138 Ga0207688_10094671 3300025901 Bacteria 1718
139 Ga0207688_10123422 3300025901 Bacteria 1513
140 Ga0207688_10199683 3300025901 Bacteria 1198
141 Ga0207680_10034052 3300025903 Bacteria 2911
142 Ga0207647_10011752 3300025904 Bacteria 6123
143 Ga0207647_10015198 3300025904 Bacteria 5286
144 Ga0207645_10002619 3300025907 Bacteria 14027
145 Ga0207645_10355748 3300025907 Bacteria 980
146 Ga0207643_10114013 3300025908 Bacteria 1595
147 Ga0207705_10000002 3300025909 Bacteria 2046852
148 Ga0207705_10000101 3300025909 Bacteria 98231
149 Ga0207705_10000616 3300025909 Bacteria 29762
150 Ga0207707_10145679 3300025912 Bacteria 2071
151 Ga0207695_10090561 3300025913 Bacteria 3074
152 Ga0207660_10021848 3300025917 Bacteria 4306
153 Ga0207657_10004276 3300025919 Bacteria 15131
154 Ga0207657_10010107 3300025919 Bacteria 9433
155 Ga0207657_10020135 3300025919 Bacteria 6313
156 Ga0207657_10118498 3300025919 Bacteria 2179
157 Ga0207657_10197247 3300025919 Bacteria 1621
158 Ga0207657_10254881 3300025919 Bacteria 1398
159 Ga0207649_10087000 3300025920 Bacteria 2038
160 Ga0207649_10153364 3300025920 Bacteria 1589
161 Ga0207652_10000001 3300025921 Bacteria 1006643
162 Ga0207652_10000002 3300025921 Bacteria 878035
163 Ga0207681_10015308 3300025923 Bacteria 4783
164 Ga0207681_10064155 3300025923 Bacteria 2535
165 Ga0207681_10078935 3300025923 Bacteria 2318
166 Ga0207681_10104962 3300025923 Bacteria 2045
167 Ga0207681_10241450 3300025923 Bacteria 1406
168 Ga0207650_10014094 3300025925 Bacteria 5552
169 Ga0207650_10019235 3300025925 Bacteria 4795
170 Ga0207650_10073021 3300025925 Bacteria 2583
171 Ga0207650_10353934 3300025925 Bacteria 1208
172 Ga0207659_10011906 3300025926 Bacteria 5510
173 Ga0207659_10080836 3300025926 Bacteria 2402
174 Ga0207687_10190619 3300025927 Bacteria 1595
175 Ga0207687_10219916 3300025927 Bacteria 1495
176 Ga0207687_10460087 3300025927 Bacteria 1056
177 Ga0207644_10000220 3300025931 Bacteria 39427
178 Ga0207690_10000001 3300025932 Bacteria 807539
179 Ga0207690_10001708 3300025932 Bacteria 13507
180 Ga0207690_10001858 3300025932 Bacteria 12978
181 Ga0207690_10031146 3300025932 Bacteria 3411
182 Ga0207690_10076619 3300025932 Bacteria 2322
183 Ga0207690_10202874 3300025932 Bacteria 1507
184 Ga0207706_10010556 3300025933 Bacteria 8436
185 Ga0207706_10017047 3300025933 Bacteria 6551
186 Ga0207706_10292109 3300025933 Bacteria 1421
187 Ga0207706_10469893 3300025933 Bacteria 1087
188 Ga0207669_10003508 3300025937 Bacteria 6788
189 Ga0207691_10013488 3300025940 Bacteria 7818
190 Ga0207691_10047129 3300025940 Bacteria 3957
191 Ga0207691_10115136 3300025940 Bacteria 2388
192 Ga0207689_10053805 3300025942 Bacteria 3316
193 Ga0207679_10012541 3300025945 Bacteria 5529
194 Ga0207679_10078443 3300025945 Bacteria 2516
195 Ga0207651_10009634 3300025960 Bacteria 5304
196 Ga0207651_10046973 3300025960 Bacteria 2908
197 Ga0207651_10084479 3300025960 Bacteria 2299
198 Ga0207651_10118846 3300025960 Bacteria 2000
199 Ga0207668_10000422 3300025972 Bacteria 26686
200 Ga0207668_10000964 3300025972 Bacteria 17306
201 Ga0207668_10165334 3300025972 Bacteria 1729
202 Ga0207668_10185298 3300025972 Bacteria 1645
203 Ga0207640_10038228 3300025981 Bacteria 3027
204 Ga0207640_10420804 3300025981 Bacteria 1093
205 Ga0207640_10614190 3300025981 Bacteria 922
206 Ga0207658_10024669 3300025986 Bacteria 4209
207 Ga0207658_10145946 3300025986 Bacteria 1921
208 Ga0207658_10731160 3300025986 Bacteria 895
209 Ga0207677_10000176 3300026023 Bacteria 50717
210 Ga0207703_10012518 3300026035 Bacteria 6612
211 Ga0207639_10272844 3300026041 Bacteria 1484
212 Ga0207678_10000308 3300026067 Bacteria 43995
213 Ga0207678_10019212 3300026067 Bacteria 6000
214 Ga0207641_10000004 3300026088 Bacteria 481088
215 Ga0207641_10004537 3300026088 Bacteria 12006
216 Ga0207641_10121406 3300026088 Bacteria 2332
217 Ga0207641_10154005 3300026088 Bacteria 2084
218 Ga0207648_10038307 3300026089 Bacteria 4219
219 Ga0207676_10005996 3300026095 Bacteria 8571
220 Ga0207674_10001036 3300026116 Bacteria 36260
221 Ga0207674_10013212 3300026116 Bacteria 9182
222 Ga0207674_10062124 3300026116 Bacteria 3773
223 Ga0207674_10794368 3300026116 Bacteria 913
224 Ga0207683_10012270 3300026121 Bacteria 7313
225 Ga0207683_10072252 3300026121 Bacteria 3051
226 Ga0268266_10000337 3300028379 Bacteria 73510
227 Ga0268266_10007048 3300028379 Bacteria 10207
228 Ga0268266_10015462 3300028379 Bacteria 6548
229 Ga0268266_10029186 3300028379 Bacteria 4689
230 Ga0268266_10043975 3300028379 Bacteria 3817
231 Ga0268266_10099795 3300028379 Bacteria 2556
232 Ga0268265_10010084 3300028380 Bacteria 6377
233 Ga0268265_10016545 3300028380 Bacteria 5070
234 Ga0268265_10077331 3300028380 Bacteria 2613
235 Ga0268265_10873185 3300028380 Bacteria 881
236 Ga0268264_10020564 3300028381 Bacteria 5392
237 Ga0268264_10050759 3300028381 Bacteria 3455
238 Ga0316182_1428887 3300030745 Bacteria 904
239 Ga0307408_100158779 3300031548 Bacteria 1794
240 Ga0307405_10009605 3300031731 Bacteria 4968
241 Ga0307405_10252419 3300031731 Bacteria 1313
242 Ga0307413_10027219 3300031824 Bacteria 3165
243 Ga0307413_10029365 3300031824 Bacteria 3075
244 Ga0307413_10030704 3300031824 Bacteria 3021
245 Ga0307413_10069321 3300031824 Bacteria 2213
246 Ga0307413_10212038 3300031824 Bacteria 1407
247 Ga0307413_10271463 3300031824 Bacteria 1270
248 Ga0307413_10376503 3300031824 Bacteria 1104
249 Ga0307410_10005283 3300031852 Bacteria 6813
250 Ga0307410_10011728 3300031852 Bacteria 5029
251 Ga0307410_10058722 3300031852 Bacteria 2624
252 Ga0307410_10068176 3300031852 Bacteria 2456
253 Ga0307410_10114154 3300031852 Bacteria 1959
254 Ga0307410_10119533 3300031852 Bacteria 1919
255 Ga0307410_10278562 3300031852 Bacteria 1311
256 Ga0307410_10404990 3300031852 Bacteria 1103
257 Ga0307410_10417059 3300031852 Bacteria 1088
258 Ga0307410_10464581 3300031852 Bacteria 1035
259 Ga0307410_10655531 3300031852 Bacteria 881
260 Ga0307406_10089567 3300031901 Bacteria 2068
261 Ga0307407_10016273 3300031903 Bacteria 3699
262 Ga0307412_10088629 3300031911 Bacteria 2159
263 Ga0307412_10104463 3300031911 Bacteria 2010
264 Ga0307412_10139542 3300031911 Bacteria 1773
265 Ga0307412_10242104 3300031911 Bacteria 1396
266 Ga0307409_100004214 3300031995 Bacteria 8018
267 Ga0307409_100022190 3300031995 Bacteria 4370
268 Ga0307409_100068459 3300031995 Bacteria 2808
269 Ga0307409_100160746 3300031995 Bacteria 1964
270 Ga0307409_100166468 3300031995 Bacteria 1935
271 Ga0307409_100406202 3300031995 Bacteria 1302
272 Ga0307409_100767991 3300031995 Bacteria 969
273 Ga0307409_100951230 3300031995 Bacteria 875
274 Ga0307416_100031907 3300032002 Bacteria 3973
275 Ga0307416_100042709 3300032002 Bacteria 3542
276 Ga0307416_100735518 3300032002 Bacteria 1078
277 Ga0307416_101097188 3300032002 Bacteria 900
278 Ga0307414_10006253 3300032004 Bacteria 6626
279 Ga0307414_10015260 3300032004 Bacteria 4634
280 Ga0307414_10017034 3300032004 Bacteria 4437
281 Ga0307414_10067242 3300032004 Bacteria 2566
282 Ga0307414_10586092 3300032004 Bacteria 998
283 Ga0307414_10624422 3300032004 Bacteria 969
284 Ga0307411_10008478 3300032005 Bacteria 5331
285 Ga0307411_10016660 3300032005 Bacteria 4163
286 Ga0307411_10022656 3300032005 Bacteria 3703
287 Ga0307411_10030841 3300032005 Bacteria 3290
288 Ga0307411_10041037 3300032005 Bacteria 2941
289 Ga0307411_10074846 3300032005 Bacteria 2309
290 Ga0307411_10228612 3300032005 Bacteria 1448
291 Ga0307411_10314165 3300032005 Bacteria 1262
292 Ga0307411_10367643 3300032005 Bacteria 1178
293 Ga0307415_100086423 3300032126 Bacteria 2257
294 Ga0307415_100149771 3300032126 Bacteria 1794
295 Ga0373959_0026591 3300034820 Bacteria 1145
296 Ga0373949_0055164 3300035090 Bacteria 1010
297 Ga0395899_0120102 3300037312 Bacteria 1883
298 Ga0395900_0006312 3300037418 Bacteria 12363
299 Ga0395900_0008585 3300037418 Bacteria 10500
300 Ga0395900_0022241 3300037418 Bacteria 6487
301 Ga0395900_0022887 3300037418 Bacteria 6394
302 Ga0395900_0042981 3300037418 Bacteria 4656
303 Ga0395900_0175373 3300037418 Bacteria 2180
304 Ga0395900_0222183 3300037418 Bacteria 1903
305 Ga0395900_0287149 3300037418 Bacteria 1635
306 Ga0395900_0509896 3300037418 Bacteria 1152
307 Ga0395900_0826527 3300037418 Bacteria 853
308 Ga0395898_0094095 3300037466 Bacteria 2880
309 Ga0395898_0172733 3300037466 Bacteria 2066
310 Ga0395898_0267207 3300037466 Bacteria 1631
311 Ga0395898_0425077 3300037466 Bacteria 1266
312 Ga0395905_0000264 3300037471 Bacteria 78482
313 Ga0395905_0002035 3300037471 Bacteria 23108
314 Ga0395905_0069336 3300037471 Bacteria 3302
315 Ga0395905_0099410 3300037471 Bacteria 2732
316 Ga0395905_0155007 3300037471 Bacteria 2154
317 Ga0395905_0524289 3300037471 Bacteria 1085
318 Ga0395905_0632035 3300037471 Bacteria 972
319 Ga0395905_0702672 3300037471 Bacteria 913
320 Ga0395901_0000372 3300038443 Bacteria 53814
321 Ga0395901_0003284 3300038443 Bacteria 16278
322 Ga0395901_0025804 3300038443 Bacteria 6033
323 Ga0395901_0086073 3300038443 Bacteria 3286
324 Ga0395901_0095606 3300038443 Bacteria 3113
325 Ga0395901_0097284 3300038443 Bacteria 3085
326 Ga0395901_0402528 3300038443 Bacteria 1406
327 Ga0395901_0583510 3300038443 Bacteria 1129
328 Ga0395901_0650957 3300038443 Bacteria 1057
329 Ga0395901_1005694 3300038443 Bacteria 809
330 Ga0436365_1353505 3300039437 Bacteria 22625
331 Ga0436363_0955047 3300039450 Bacteria 878
332 Ga0439438_050559 3300041405 Bacteria 1058
333 Ga0439443_000296 3300042003 Bacteria 4086
334 Ga0439448_0033178 3300042005 Bacteria 1646
335 Ga0439455_0047223 3300042012 Bacteria 1117
336 Ga0450912_001102 3300042116 Bacteria 1566
337 Ga0450889_000098 3300042144 Bacteria 8310
338 Ga0450906_009848 3300042145 Bacteria 1814
339 Ga0439458_0005849 3300042157 Bacteria 2755
340 Ga0439458_0007083 3300042157 Bacteria 2496
341 Ga0439464_0069945 3300042439 Bacteria 1037
342 Ga0466966_0102004 3300044684 Bacteria 1774
343 Ga0466963_0479493 3300044694 Bacteria 878
344 Ga0453684_0232304 3300044712 Bacteria 2129
345 Ga0495633_0012949 3300046558 Bacteria 4414
346 Ga0495668_0004070 3300046616 Bacteria 10602
347 Ga0495668_0107749 3300046616 Bacteria 1524
348 Ga0495625_0196138 3300046660 Bacteria 1335
349 Ga0495659_0032978 3300046664 Bacteria 1816
350 Ga0495669_0011007 3300046684 Bacteria 3831
351 Ga0495669_0044562 3300046684 Bacteria 1976
352 Ga0495670_0108700 3300046691 Bacteria 1433
353 Ga0495670_0147444 3300046691 Bacteria 1233
354 Ga0495685_046601 3300047447 Bacteria 1475
355 Ga0495686_0290270 3300047472 Bacteria 906
356 Ga0496109_0468244 3300048912 Bacteria 1190
357 Ga0496109_0760078 3300048912 Bacteria 907
358 Ga0496110_0544923 3300048913 Bacteria 1054
359 Ga0501034_0965420 3300049571 Bacteria 737
360 Ga0501043_0619027 3300049579 Bacteria 798
361 Ga0501069_0188470 3300049585 Bacteria 1193
362 Ga0501070_0301898 3300049586 Bacteria 1304
363 Ga0501071_0393309 3300049587 Bacteria 1058
364 Ga0501225_0070728 3300049705 Bacteria 992
365 nmdc:mga0qj67_17142_c1 3300050509 Bacteria 5504
366 nmdc:mga0qj67_492947_c1 3300050509 Bacteria 985
367 nmdc:mga08y16_114603_c1 3300050511 Bacteria 2806
368 nmdc:mga0n895_539626_c1 3300050512 Bacteria 1173
369 Ga0395899_0139621
370 JGI24739J22299_10081767
371 JGI24737J22298_10087003
372 JGI24743J22301_10005651
373 JGI24738J21930_10022694
374 Ga0065715_10014750
375 Ga0070658_10000033
376 Ga0070658_10012545
377 Ga0070676_10045987
378 Ga0070676_10170486
379 Ga0070690_100543097
380 Ga0070670_100021736
381 Ga0070670_100238158
382 Ga0070677_10000514
383 Ga0070677_10002442
384 Ga0070677_10047485
385 Ga0070677_10051490
386 Ga0070666_10011685
387 Ga0070666_10203599
388 Ga0070680_100030889
389 Ga0068868_100000122
390 Ga0070660_100001694
391 Ga0070660_100038955
392 Ga0070660_100057385
393 Ga0070661_100292333
394 Ga0070692_10013866
395 Ga0070668_100068065
396 Ga0070668_100080331
397 Ga0070668_100119824
398 Ga0070669_100024764
399 Ga0070669_100048826
400 Ga0070669_100175435
401 Ga0070675_100001144
402 Ga0070675_100006999
403 Ga0070675_100400381
404 Ga0070671_100029903
405 Ga0070671_100037802
406 Ga0070674_100152930
407 Ga0070674_100199989
408 Ga0070673_100020250
409 Ga0070673_100320291
410 Ga0070659_100000032
411 Ga0070659_100004241
412 Ga0070659_100007209
413 Ga0070659_100016270
414 Ga0070659_100045682
415 Ga0070659_100072708
416 Ga0070659_100101311
417 Ga0070659_100275632
418 Ga0070667_100055027
419 Ga0070667_100091902
420 Ga0070713_100037458
421 Ga0070705_100658609
422 Ga0070663_100012118
423 Ga0070678_100058167
424 Ga0070662_100021710
425 Ga0070662_100078292
426 Ga0070662_100325835
427 Ga0070662_100431497
428 Ga0070662_100605523
429 Ga0068867_100006599
430 Ga0070685_10201615
431 Ga0070679_100000084
432 Ga0070684_100122857
433 Ga0068853_100080985
434 Ga0070672_100057872
435 Ga0070672_100145163
436 Ga0070665_100000605
437 Ga0070665_100003133
438 Ga0070665_100012206
439 Ga0070665_100017069
440 Ga0070665_100020365
441 Ga0070665_100034841
442 Ga0070704_100594786
443 Ga0068855_100284839
444 Ga0070664_100010130
445 Ga0070664_100022864
446 Ga0070664_100188579
447 Ga0068857_100021880
448 Ga0068857_100770124
449 Ga0068854_100037591
450 Ga0068854_100108495
451 Ga0068852_100150245
452 Ga0068859_100047994
453 Ga0068859_100206811
454 Ga0068864_100067223
455 Ga0068863_100000131
456 Ga0068863_100003427
457 Ga0068863_100009521
458 Ga0068863_100021539
459 Ga0068863_100146651
460 Ga0068858_100022969
461 Ga0068860_100023617
462 Ga0068860_100050928
463 Ga0068862_100022631
464 Ga0068862_100084025
465 Ga0068862_100186633
466 Ga0081539_10025865
467 Ga0070717_10002536
468 Ga0075366_10192273
469 Ga0068871_100283703
470 Ga0068865_100020678
471 Ga0097620_100047991
472 Ga0097620_100206817
473 Ga0111539_10034238
474 Ga0105245_10072856
475 Ga0105245_10172062
476 Ga0105245_10235012
477 Ga0105243_10026939
478 Ga0105243_10073096
479 Ga0105242_10129586
480 Ga0105242_10755182
481 Ga0105248_10093474
482 Ga0105248_10712549
483 Ga0105249_10465168
484 Ga0105246_10029057
485 Ga0157373_10146613
486 Ga0157371_10020597
487 Ga0157370_10108085
488 Ga0157369_10001977
489 Ga0157369_10009206
490 Ga0157374_10080171
491 Ga0157378_10656546
492 Ga0163162_10061583
493 Ga0157372_10033582
494 Ga0157372_11119157
495 Ga0157375_10083594
496 Ga0163163_10008688
497 Ga0157380_10020886
498 Ga0157380_10147355
499 Ga0157377_10204489
500 Ga0213876_10000460
501 Ga0207697_10049932
502 Ga0207682_10001990
503 Ga0207682_10027693
504 Ga0207682_10113970
505 Ga0207688_10016578
506 Ga0207688_10094671
507 Ga0207688_10123422
508 Ga0207688_10199683
509 Ga0207680_10034052
510 Ga0207647_10011752
511 Ga0207647_10015198
512 Ga0207645_10002619
513 Ga0207645_10355748
514 Ga0207643_10114013
515 Ga0207705_10000002
516 Ga0207705_10000101
517 Ga0207705_10000616
518 Ga0207707_10145679
519 Ga0207695_10090561
520 Ga0207660_10021848
521 Ga0207657_10004276
522 Ga0207657_10010107
523 Ga0207657_10020135
524 Ga0207657_10118498
525 Ga0207657_10197247
526 Ga0207657_10254881
527 Ga0207649_10087000
528 Ga0207649_10153364
529 Ga0207652_10000001
530 Ga0207652_10000002
531 Ga0207681_10015308
532 Ga0207681_10064155
533 Ga0207681_10078935
534 Ga0207681_10104962
535 Ga0207681_10241450
536 Ga0207650_10014094
537 Ga0207650_10019235
538 Ga0207650_10073021
539 Ga0207650_10353934
540 Ga0207659_10011906
541 Ga0207659_10080836
542 Ga0207687_10190619
543 Ga0207687_10219916
544 Ga0207687_10460087
545 Ga0207644_10000220
546 Ga0207690_10000001
547 Ga0207690_10001708
548 Ga0207690_10001858
549 Ga0207690_10031146
550 Ga0207690_10076619
551 Ga0207690_10202874
552 Ga0207706_10010556
553 Ga0207706_10017047
554 Ga0207706_10292109
555 Ga0207706_10469893
556 Ga0207669_10003508
557 Ga0207691_10013488
558 Ga0207691_10047129
559 Ga0207691_10115136
560 Ga0207689_10053805
561 Ga0207679_10012541
562 Ga0207679_10078443
563 Ga0207651_10009634
564 Ga0207651_10046973
565 Ga0207651_10084479
566 Ga0207651_10118846
567 Ga0207668_10000422
568 Ga0207668_10000964
569 Ga0207668_10165334
570 Ga0207668_10185298
571 Ga0207640_10038228
572 Ga0207640_10420804
573 Ga0207640_10614190
574 Ga0207658_10024669
575 Ga0207658_10145946
576 Ga0207658_10731160
577 Ga0207677_10000176
578 Ga0207703_10012518
579 Ga0207639_10272844
580 Ga0207678_10000308
581 Ga0207678_10019212
582 Ga0207641_10000004
583 Ga0207641_10004537
584 Ga0207641_10121406
585 Ga0207641_10154005
586 Ga0207648_10038307
587 Ga0207676_10005996
588 Ga0207674_10001036
589 Ga0207674_10013212
590 Ga0207674_10062124
591 Ga0207674_10794368
592 Ga0207683_10012270
593 Ga0207683_10072252
594 Ga0268266_10000337
595 Ga0268266_10007048
596 Ga0268266_10015462
597 Ga0268266_10029186
598 Ga0268266_10043975
599 Ga0268266_10099795
600 Ga0268265_10010084
601 Ga0268265_10016545
602 Ga0268265_10077331
603 Ga0268265_10873185
604 Ga0268264_10020564
605 Ga0268264_10050759
606 Ga0316182_1428887
607 Ga0307408_100158779
608 Ga0307405_10009605
609 Ga0307405_10252419
610 Ga0307413_10027219
611 Ga0307413_10029365
612 Ga0307413_10030704
613 Ga0307413_10069321
614 Ga0307413_10212038
615 Ga0307413_10271463
616 Ga0307413_10376503
617 Ga0307410_10005283
618 Ga0307410_10011728
619 Ga0307410_10058722
620 Ga0307410_10068176
621 Ga0307410_10114154
622 Ga0307410_10119533
623 Ga0307410_10278562
624 Ga0307410_10404990
625 Ga0307410_10417059
626 Ga0307410_10464581
627 Ga0307410_10655531
628 Ga0307406_10089567
629 Ga0307407_10016273
630 Ga0307412_10088629
631 Ga0307412_10104463
632 Ga0307412_10139542
633 Ga0307412_10242104
634 Ga0307409_100004214
635 Ga0307409_100022190
636 Ga0307409_100068459
637 Ga0307409_100160746
638 Ga0307409_100166468
639 Ga0307409_100406202
640 Ga0307409_100767991
641 Ga0307409_100951230
642 Ga0307416_100031907
643 Ga0307416_100042709
644 Ga0307416_100735518
645 Ga0307416_101097188
646 Ga0307414_10006253
647 Ga0307414_10015260
648 Ga0307414_10017034
649 Ga0307414_10067242
650 Ga0307414_10586092
651 Ga0307414_10624422
652 Ga0307411_10008478
653 Ga0307411_10016660
654 Ga0307411_10022656
655 Ga0307411_10030841
656 Ga0307411_10041037
657 Ga0307411_10074846
658 Ga0307411_10228612
659 Ga0307411_10314165
660 Ga0307411_10367643
661 Ga0307415_100086423
662 Ga0307415_100149771
663 Ga0373959_0026591
664 Ga0373949_0055164
665 Ga0395899_0120102
666 Ga0395900_0006312
667 Ga0395900_0008585
668 Ga0395900_0022241
669 Ga0395900_0022887
670 Ga0395900_0042981
671 Ga0395900_0175373
672 Ga0395900_0222183
673 Ga0395900_0287149
674 Ga0395900_0509896
675 Ga0395900_0826527
676 Ga0395898_0094095
677 Ga0395898_0172733
678 Ga0395898_0267207
679 Ga0395898_0425077
680 Ga0395905_0000264
681 Ga0395905_0002035
682 Ga0395905_0069336
683 Ga0395905_0099410
684 Ga0395905_0155007
685 Ga0395905_0524289
686 Ga0395905_0632035
687 Ga0395905_0702672
688 Ga0395901_0000372
689 Ga0395901_0003284
690 Ga0395901_0025804
691 Ga0395901_0086073
692 Ga0395901_0095606
693 Ga0395901_0097284
694 Ga0395901_0402528
695 Ga0395901_0583510
696 Ga0395901_0650957
697 Ga0395901_1005694
698 Ga0436365_1353505
699 Ga0436363_0955047
700 Ga0439438_050559
701 Ga0439443_000296
702 Ga0439448_0033178
703 Ga0439455_0047223
704 Ga0450912_001102
705 Ga0450889_000098
706 Ga0450906_009848
707 Ga0439458_0005849
708 Ga0439458_0007083
709 Ga0439464_0069945
710 Ga0466966_0102004
711 Ga0466963_0479493
712 Ga0453684_0232304
713 Ga0495633_0012949
714 Ga0495668_0004070
715 Ga0495668_0107749
716 Ga0495625_0196138
717 Ga0495659_0032978
718 Ga0495669_0011007
719 Ga0495669_0044562
720 Ga0495670_0108700
721 Ga0495670_0147444
722 Ga0495685_046601
723 Ga0495686_0290270
724 Ga0496109_0468244
725 Ga0496109_0760078
726 Ga0496110_0544923
727 Ga0501034_0965420
728 Ga0501043_0619027
729 Ga0501069_0188470
730 Ga0501070_0301898
731 Ga0501071_0393309
732 Ga0501225_0070728
733 nmdc:mga0qj67_17142_c1
734 nmdc:mga0qj67_492947_c1
735 nmdc:mga08y16_114603_c1
736 nmdc:mga0n895_539626_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

67

257

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9051 1 211
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8866 6 209
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8585 6 209
4tvw-assembly2.cif.gz_B resorufin ligase with bound resorufin-amp analog 0.7472 3 209
2dkg-assembly1.cif.gz_A crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mg(2+) 0.7263 1 213
ID Description Score Start End Superfamily
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.908 1 208 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8957 5 210 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8874 1 208 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8868 6 208 3.30.930.10
af_O36017_5_216_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8817 8 207 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A7C5MWQ3-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9714 5 118 GO:0016874
GO:0033819
AF-A0A1M3J313-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9675 6 207 GO:0005737
GO:0016874
GO:0033819
AF-A0A7C3ZYF6-F1-model_v4 Lipoate-protein ligase B 0.9658 6 111 GO:0016874
GO:0033819
AF-A0A378ZVT7-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9653 4 207 GO:0005737
GO:0033819
AF-A0A7X3YY72-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9632 5 209 GO:0005737
GO:0033819

Map