F424703

General Info

Members Datasets Scaffolds Average Seq Length
368 170 736 240

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10474040|Ga0157372_104740402
Length 268
Sequence MAGQLSATAAGGYEQAMGRLSGKVAIVTGAASGIGKAAVALFRSEGATVVGADVSEGADVRCDAGSEDQVRRLVEETAGAHGGLDIVFANAGISGGWASIAEQSAADWAEILRVNLIGPFLAIKYAAPILAKRGGGSIICTASVAGLRSGAGGAAYSASKAGVINLVQTASQQLSGTGVRVNAICPGLIETGMTKPMYDAARERGQEQRIGELNPLGRGGEADEIARAALFLASDDASYVNGTALVVDGGLSSSHPEARAYKLRALIE

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
167 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10474040 3300013307 Bacteria 1459
2 JGI24736J21556_1005456 3300001904 Bacteria 2147
3 JGI24740J21852_10008471 3300001979 Bacteria 4096
4 JGI24740J21852_10013162 3300001979 Bacteria 3095
5 JGI24740J21852_10047193 3300001979 Bacteria 1259
6 JGI24739J22299_10003650 3300001989 Bacteria 5875
7 JGI24737J22298_10007708 3300001990 Bacteria 3626
8 JGI24737J22298_10044936 3300001990 Bacteria 1350
9 JGI24735J21928_10044262 3300002067 Bacteria 1293
10 Ga0065715_10022479 3300005293 Bacteria 2522
11 Ga0065715_10150604 3300005293 Bacteria 1734
12 Ga0070658_10004884 3300005327 Bacteria 10922
13 Ga0070658_10021777 3300005327 Bacteria 5138
14 Ga0070658_10082544 3300005327 Bacteria 2641
15 Ga0070658_10102392 3300005327 Bacteria 2368
16 Ga0070658_10189071 3300005327 Bacteria 1735
17 Ga0070658_10321326 3300005327 Bacteria 1322
18 Ga0070676_10133016 3300005328 Bacteria 1575
19 Ga0070683_100343240 3300005329 Bacteria 1422
20 Ga0070690_100005284 3300005330 Bacteria 7241
21 Ga0070677_10034848 3300005333 Bacteria 1947
22 Ga0068869_100226656 3300005334 Bacteria 1483
23 Ga0070666_10002844 3300005335 Bacteria 10459
24 Ga0070680_100032927 3300005336 Bacteria 4173
25 Ga0068868_100005000 3300005338 Bacteria 9316
26 Ga0068868_100451281 3300005338 Bacteria 1118
27 Ga0068868_100552505 3300005338 Bacteria 1015
28 Ga0070660_100004844 3300005339 Bacteria 9298
29 Ga0070660_100013738 3300005339 Bacteria 5822
30 Ga0070660_100016916 3300005339 Bacteria 5307
31 Ga0070660_100144848 3300005339 Bacteria 1908
32 Ga0070661_100021281 3300005344 Bacteria 4630
33 Ga0070661_100056708 3300005344 Bacteria 2870
34 Ga0070661_100125846 3300005344 Bacteria 1922
35 Ga0070692_10029528 3300005345 Bacteria 2733
36 Ga0070668_100182739 3300005347 Bacteria 1714
37 Ga0070669_100039749 3300005353 Bacteria 3418
38 Ga0070669_100239411 3300005353 Bacteria 1441
39 Ga0070675_100002714 3300005354 Bacteria 13302
40 Ga0070675_100295302 3300005354 Bacteria 1427
41 Ga0070675_100778167 3300005354 Bacteria 874
42 Ga0070671_100004676 3300005355 Bacteria 10862
43 Ga0070671_100241850 3300005355 Bacteria 1532
44 Ga0070671_100474870 3300005355 Bacteria 1074
45 Ga0070674_100062822 3300005356 Bacteria 2597
46 Ga0070673_100063060 3300005364 Bacteria 2947
47 Ga0070659_100007979 3300005366 Bacteria 7715
48 Ga0070659_100087663 3300005366 Bacteria 2492
49 Ga0070659_100392937 3300005366 Bacteria 1170
50 Ga0070659_100465149 3300005366 Bacteria 1074
51 Ga0070667_100003895 3300005367 Bacteria 12670
52 Ga0070667_100046923 3300005367 Bacteria 3634
53 Ga0070713_100012893 3300005436 Bacteria 6150
54 Ga0070694_100003284 3300005444 Bacteria 9666
55 Ga0070663_100069687 3300005455 Bacteria 2555
56 Ga0070663_100369774 3300005455 Bacteria 1165
57 Ga0070662_100003335 3300005457 Bacteria 10015
58 Ga0070662_100008436 3300005457 Bacteria 6717
59 Ga0070662_100020254 3300005457 Bacteria 4527
60 Ga0070662_100094807 3300005457 Bacteria 2248
61 Ga0070662_100246406 3300005457 Bacteria 1435
62 Ga0070681_10249023 3300005458 Bacteria 1689
63 Ga0068867_100003727 3300005459 Bacteria 10724
64 Ga0070679_100012647 3300005530 Bacteria 8073
65 Ga0070679_100190622 3300005530 Bacteria 2019
66 Ga0070684_100016587 3300005535 Bacteria 6023
67 Ga0070684_100114996 3300005535 Bacteria 2415
68 Ga0068853_100077677 3300005539 Bacteria 2901
69 Ga0068853_100096784 3300005539 Bacteria 2604
70 Ga0068853_100113381 3300005539 Bacteria 2410
71 Ga0068853_100213384 3300005539 Bacteria 1760
72 Ga0070672_100044982 3300005543 Bacteria 3412
73 Ga0070672_100106429 3300005543 Bacteria 2282
74 Ga0070695_100103174 3300005545 Bacteria 1924
75 Ga0070665_100000232 3300005548 Bacteria 92207
76 Ga0070665_100036922 3300005548 Bacteria 4913
77 Ga0068855_100010293 3300005563 Bacteria 11279
78 Ga0068855_100035121 3300005563 Bacteria 5972
79 Ga0068855_100150477 3300005563 Bacteria 2647
80 Ga0068855_101105287 3300005563 Bacteria 828
81 Ga0070664_100005277 3300005564 Bacteria 10368
82 Ga0070664_100275310 3300005564 Bacteria 1517
83 Ga0070664_100506522 3300005564 Bacteria 1113
84 Ga0068857_100038977 3300005577 Bacteria 4207
85 Ga0068857_100164473 3300005577 Bacteria 2014
86 Ga0068857_100281982 3300005577 Bacteria 1528
87 Ga0068857_100524002 3300005577 Bacteria 1114
88 Ga0068854_100039309 3300005578 Bacteria 3332
89 Ga0068856_100011799 3300005614 Bacteria 8469
90 Ga0068856_100044592 3300005614 Bacteria 4364
91 Ga0068856_100296299 3300005614 Bacteria 1635
92 Ga0070702_100272426 3300005615 Bacteria 1158
93 Ga0068852_100031772 3300005616 Bacteria 4363
94 Ga0068852_100099992 3300005616 Bacteria 2615
95 Ga0068852_100143725 3300005616 Bacteria 2210
96 Ga0068852_100249228 3300005616 Bacteria 1701
97 Ga0068852_100287659 3300005616 Bacteria 1586
98 Ga0068864_100085231 3300005618 Bacteria 2777
99 Ga0068864_100278256 3300005618 Bacteria 1561
100 Ga0068864_100330113 3300005618 Bacteria 1435
101 Ga0068863_100037827 3300005841 Bacteria 4592
102 Ga0068860_100013628 3300005843 Bacteria 7969
103 Ga0068860_100090012 3300005843 Bacteria 2922
104 Ga0068860_100141397 3300005843 Bacteria 2313
105 Ga0068860_100311044 3300005843 Bacteria 1545
106 Ga0068862_100021362 3300005844 Bacteria 5408
107 Ga0068862_100312534 3300005844 Bacteria 1448
108 Ga0070717_10002429 3300006028 Bacteria 13152
109 Ga0070712_100070891 3300006175 Bacteria 2492
110 Ga0075433_10212771 3300006852 Bacteria 1718
111 Ga0105240_10270593 3300009093 Bacteria 1956
112 Ga0105245_10422091 3300009098 Bacteria 1337
113 Ga0105243_10516572 3300009148 Bacteria 1135
114 Ga0105241_10267561 3300009174 Bacteria 1455
115 Ga0105242_10020035 3300009176 Bacteria 5242
116 Ga0105248_10001002 3300009177 Bacteria 31241
117 Ga0105237_10195954 3300009545 Bacteria 2020
118 Ga0105238_10428086 3300009551 Bacteria 1319
119 Ga0105249_10062799 3300009553 Bacteria 3411
120 Ga0105249_10708536 3300009553 Bacteria 1067
121 Ga0105239_10190057 3300010375 Bacteria 2299
122 Ga0105239_10508896 3300010375 Bacteria 1369
123 Ga0105246_10046146 3300011119 Bacteria 2970
124 Ga0105246_10181444 3300011119 Bacteria 1621
125 Ga0157373_10248275 3300013100 Bacteria 1258
126 Ga0157373_10522399 3300013100 Bacteria 859
127 Ga0157371_10013052 3300013102 Bacteria 6325
128 Ga0157371_10143367 3300013102 Bacteria 1702
129 Ga0157370_10143842 3300013104 Bacteria 2221
130 Ga0157369_10028517 3300013105 Bacteria 6179
131 Ga0157369_10232985 3300013105 Bacteria 1925
132 Ga0157374_10129114 3300013296 Bacteria 2445
133 Ga0157372_10709357 3300013307 Bacteria 1170
134 Ga0157372_10908757 3300013307 Bacteria 1021
135 Ga0157375_10022925 3300013308 Bacteria 5753
136 Ga0157380_10076538 3300014326 Bacteria 2724
137 Ga0157377_10003012 3300014745 Bacteria 7550
138 Ga0157379_10069700 3300014968 Bacteria 3145
139 Ga0206354_11089654 3300020081 Bacteria 1510
140 Ga0206353_10043428 3300020082 Bacteria 3735
141 Ga0213873_10000008 3300021358 Bacteria 263363
142 Ga0213876_10000005 3300021384 Bacteria 727326
143 Ga0207682_10009522 3300025893 Bacteria 3833
144 Ga0207682_10083563 3300025893 Bacteria 1373
145 Ga0207688_10027759 3300025901 Bacteria 3113
146 Ga0207688_10063331 3300025901 Bacteria 2086
147 Ga0207680_10000271 3300025903 Bacteria 24747
148 Ga0207647_10001771 3300025904 Bacteria 16572
149 Ga0207647_10024414 3300025904 Bacteria 3985
150 Ga0207647_10043394 3300025904 Bacteria 2815
151 Ga0207647_10060763 3300025904 Bacteria 2309
152 Ga0207645_10137877 3300025907 Bacteria 1589
153 Ga0207705_10001792 3300025909 Bacteria 16928
154 Ga0207705_10001965 3300025909 Bacteria 16037
155 Ga0207705_10026657 3300025909 Bacteria 4119
156 Ga0207705_10062202 3300025909 Bacteria 2696
157 Ga0207705_10313945 3300025909 Bacteria 1203
158 Ga0207705_10352085 3300025909 Bacteria 1135
159 Ga0207654_10269509 3300025911 Bacteria 1148
160 Ga0207695_10360805 3300025913 Bacteria 1340
161 Ga0207660_10036755 3300025917 Bacteria 3406
162 Ga0207657_10001185 3300025919 Bacteria 27703
163 Ga0207657_10008696 3300025919 Bacteria 10278
164 Ga0207657_10040385 3300025919 Bacteria 4134
165 Ga0207657_10044947 3300025919 Bacteria 3880
166 Ga0207649_10040572 3300025920 Bacteria 2830
167 Ga0207652_10010702 3300025921 Bacteria 7384
168 Ga0207681_10044990 3300025923 Bacteria 2961
169 Ga0207650_10087311 3300025925 Bacteria 2376
170 Ga0207659_10060308 3300025926 Bacteria 2730
171 Ga0207687_10382105 3300025927 Bacteria 1154
172 Ga0207644_10022842 3300025931 Bacteria 4276
173 Ga0207690_10001735 3300025932 Bacteria 13389
174 Ga0207690_10029201 3300025932 Bacteria 3503
175 Ga0207690_10048589 3300025932 Bacteria 2823
176 Ga0207706_10007349 3300025933 Bacteria 10185
177 Ga0207706_10011384 3300025933 Bacteria 8104
178 Ga0207706_10128740 3300025933 Bacteria 2226
179 Ga0207706_10501879 3300025933 Bacteria 1047
180 Ga0207709_10098110 3300025935 Bacteria 1931
181 Ga0207709_10384532 3300025935 Bacteria 1069
182 Ga0207669_10003543 3300025937 Bacteria 6761
183 Ga0207691_10050321 3300025940 Bacteria 3815
184 Ga0207691_10101369 3300025940 Bacteria 2569
185 Ga0207691_10207061 3300025940 Bacteria 1705
186 Ga0207711_10000823 3300025941 Bacteria 30322
187 Ga0207689_10005456 3300025942 Bacteria 11379
188 Ga0207661_10692027 3300025944 Bacteria 937
189 Ga0207679_10020953 3300025945 Bacteria 4423
190 Ga0207679_10395138 3300025945 Bacteria 1215
191 Ga0207679_10551948 3300025945 Bacteria 1034
192 Ga0207667_10060795 3300025949 Bacteria 3954
193 Ga0207667_10089697 3300025949 Bacteria 3177
194 Ga0207667_10206610 3300025949 Bacteria 2013
195 Ga0207651_10051799 3300025960 Bacteria 2795
196 Ga0207712_10000146 3300025961 Bacteria 73378
197 Ga0207668_10205196 3300025972 Bacteria 1572
198 Ga0207668_10322055 3300025972 Bacteria 1283
199 Ga0207658_10008282 3300025986 Bacteria 7081
200 Ga0207658_10228380 3300025986 Bacteria 1570
201 Ga0207677_10011889 3300026023 Bacteria 4982
202 Ga0207677_10019197 3300026023 Bacteria 4123
203 Ga0207677_10029235 3300026023 Bacteria 3499
204 Ga0207703_10004651 3300026035 Bacteria 11214
205 Ga0207639_10045447 3300026041 Bacteria 3307
206 Ga0207639_10064132 3300026041 Bacteria 2847
207 Ga0207639_10164928 3300026041 Bacteria 1871
208 Ga0207678_10006723 3300026067 Bacteria 10198
209 Ga0207678_10029096 3300026067 Bacteria 4822
210 Ga0207678_10298082 3300026067 Bacteria 1385
211 Ga0207702_10020794 3300026078 Bacteria 5428
212 Ga0207702_10025221 3300026078 Bacteria 4933
213 Ga0207641_10373187 3300026088 Bacteria 1364
214 Ga0207648_10011174 3300026089 Bacteria 8469
215 Ga0207676_10157601 3300026095 Bacteria 1963
216 Ga0207676_10267234 3300026095 Bacteria 1547
217 Ga0207676_10300787 3300026095 Bacteria 1465
218 Ga0207674_10006480 3300026116 Bacteria 13763
219 Ga0207674_10009135 3300026116 Bacteria 11373
220 Ga0207674_10017639 3300026116 Bacteria 7785
221 Ga0207674_10362113 3300026116 Bacteria 1402
222 Ga0207683_10392420 3300026121 Bacteria 1276
223 Ga0207698_10039963 3300026142 Bacteria 3480
224 Ga0207698_10054200 3300026142 Bacteria 3084
225 Ga0207698_10059661 3300026142 Bacteria 2963
226 Ga0207698_10138841 3300026142 Bacteria 2090
227 Ga0207698_10166060 3300026142 Bacteria 1937
228 Ga0207698_10184950 3300026142 Bacteria 1850
229 Ga0207698_10544406 3300026142 Bacteria 1137
230 Ga0209974_10029879 3300027876 Bacteria 1806
231 Ga0268266_10000425 3300028379 Bacteria 63734
232 Ga0268265_10013880 3300028380 Bacteria 5482
233 Ga0268264_10000594 3300028381 Bacteria 43886
234 Ga0268264_10040064 3300028381 Bacteria 3871
235 Ga0307408_100039162 3300031548 Bacteria 3348
236 Ga0307408_100123463 3300031548 Bacteria 2009
237 Ga0307408_100389625 3300031548 Bacteria 1193
238 Ga0307405_10015996 3300031731 Bacteria 4079
239 Ga0307405_10049637 3300031731 Bacteria 2594
240 Ga0307405_10160506 3300031731 Bacteria 1591
241 Ga0307413_10027395 3300031824 Bacteria 3157
242 Ga0307413_10034252 3300031824 Bacteria 2900
243 Ga0307413_10075492 3300031824 Bacteria 2140
244 Ga0307413_10095074 3300031824 Bacteria 1952
245 Ga0307410_10005219 3300031852 Bacteria 6841
246 Ga0307410_10024738 3300031852 Bacteria 3756
247 Ga0307410_10079771 3300031852 Bacteria 2294
248 Ga0307410_10210186 3300031852 Bacteria 1490
249 Ga0307406_10049041 3300031901 Bacteria 2670
250 Ga0307406_10054994 3300031901 Bacteria 2542
251 Ga0307406_10207687 3300031901 Bacteria 1446
252 Ga0307407_10059747 3300031903 Bacteria 2221
253 Ga0307407_10116261 3300031903 Bacteria 1687
254 Ga0307407_10468612 3300031903 Bacteria 917
255 Ga0307412_10036414 3300031911 Bacteria 3152
256 Ga0307412_10059232 3300031911 Bacteria 2565
257 Ga0307412_10103327 3300031911 Bacteria 2019
258 Ga0307409_100014270 3300031995 Bacteria 5158
259 Ga0307409_100048294 3300031995 Bacteria 3237
260 Ga0307409_100089997 3300031995 Bacteria 2510
261 Ga0307416_100008475 3300032002 Bacteria 6638
262 Ga0307416_100022589 3300032002 Bacteria 4543
263 Ga0307416_100048518 3300032002 Bacteria 3369
264 Ga0307416_100213081 3300032002 Bacteria 1844
265 Ga0307416_100770871 3300032002 Bacteria 1056
266 Ga0307414_10115015 3300032004 Bacteria 2056
267 Ga0307414_10158322 3300032004 Bacteria 1795
268 Ga0307414_10394309 3300032004 Bacteria 1200
269 Ga0307411_10003991 3300032005 Bacteria 6971
270 Ga0307411_10051409 3300032005 Bacteria 2688
271 Ga0307411_10088116 3300032005 Bacteria 2157
272 Ga0307411_10166263 3300032005 Bacteria 1658
273 Ga0307415_100028971 3300032126 Bacteria 3531
274 Ga0307415_100124742 3300032126 Bacteria 1938
275 Ga0307415_100161400 3300032126 Bacteria 1737
276 Ga0373943_0167040 3300035170 Bacteria 1202
277 Ga0395899_0000103 3300037312 Bacteria 147274
278 Ga0395899_0001198 3300037312 Bacteria 22796
279 Ga0395899_0001279 3300037312 Bacteria 21800
280 Ga0395899_0027657 3300037312 Bacteria 4273
281 Ga0395899_0128734 3300037312 Bacteria 1809
282 Ga0395899_0144165 3300037312 Bacteria 1692
283 Ga0395900_0000093 3300037418 Bacteria 166505
284 Ga0395900_0007133 3300037418 Bacteria 11578
285 Ga0395900_0018451 3300037418 Bacteria 7115
286 Ga0395900_0019762 3300037418 Bacteria 6865
287 Ga0395900_0020612 3300037418 Bacteria 6734
288 Ga0395900_0052801 3300037418 Bacteria 4184
289 Ga0395900_0234801 3300037418 Bacteria 1842
290 Ga0395900_0466237 3300037418 Bacteria 1217
291 Ga0395900_0753922 3300037418 Bacteria 904
292 Ga0395898_0000053 3300037466 Bacteria 279600
293 Ga0395898_0001084 3300037466 Bacteria 42107
294 Ga0395898_0016261 3300037466 Bacteria 7613
295 Ga0395898_0016833 3300037466 Bacteria 7468
296 Ga0395898_0039628 3300037466 Bacteria 4662
297 Ga0395898_0092684 3300037466 Bacteria 2905
298 Ga0395898_0271506 3300037466 Bacteria 1617
299 Ga0395898_0304460 3300037466 Bacteria 1520
300 Ga0395898_0845550 3300037466 Bacteria 854
301 Ga0395898_0921501 3300037466 Bacteria 811
302 Ga0395905_0000031 3300037471 Bacteria 286757
303 Ga0395905_0000259 3300037471 Bacteria 79396
304 Ga0395905_0001268 3300037471 Bacteria 31200
305 Ga0395905_0002525 3300037471 Bacteria 20191
306 Ga0395905_0002788 3300037471 Bacteria 19144
307 Ga0395905_0005106 3300037471 Bacteria 13488
308 Ga0395905_0021539 3300037471 Bacteria 6094
309 Ga0395905_0030204 3300037471 Bacteria 5108
310 Ga0395905_0062731 3300037471 Bacteria 3476
311 Ga0395905_0068609 3300037471 Bacteria 3321
312 Ga0395905_0085477 3300037471 Bacteria 2956
313 Ga0395905_0094511 3300037471 Bacteria 2804
314 Ga0395905_0147386 3300037471 Bacteria 2214
315 Ga0395905_0149630 3300037471 Bacteria 2196
316 Ga0395905_0177695 3300037471 Bacteria 1998
317 Ga0395905_0195142 3300037471 Bacteria 1898
318 Ga0395905_0343221 3300037471 Bacteria 1385
319 Ga0395901_0000339 3300038443 Bacteria 56917
320 Ga0395901_0004476 3300038443 Bacteria 14099
321 Ga0395901_0013519 3300038443 Bacteria 8300
322 Ga0395901_0015714 3300038443 Bacteria 7711
323 Ga0395901_0038598 3300038443 Bacteria 4940
324 Ga0395901_0062086 3300038443 Bacteria 3888
325 Ga0395901_0171037 3300038443 Bacteria 2280
326 Ga0395901_0247684 3300038443 Bacteria 1857
327 Ga0395901_0333035 3300038443 Bacteria 1569
328 Ga0395901_0425253 3300038443 Bacteria 1361
329 Ga0395901_0450522 3300038443 Bacteria 1316
330 Ga0395901_0460860 3300038443 Bacteria 1299
331 Ga0395901_0617386 3300038443 Bacteria 1091
332 Ga0436365_1858586 3300039437 Bacteria 166193
333 Ga0436362_1202204 3300039453 Bacteria 19125
334 Ga0466966_0092974 3300044684 Bacteria 1871
335 Ga0466966_0179889 3300044684 Bacteria 1283
336 Ga0466961_0048397 3300044693 Bacteria 2717
337 Ga0466963_0077183 3300044694 Bacteria 2250
338 Ga0466963_0090130 3300044694 Bacteria 2087
339 Ga0466963_0302427 3300044694 Bacteria 1125
340 Ga0466971_0039376 3300044719 Bacteria 2121
341 Ga0466959_0156713 3300045049 Bacteria 1602
342 Ga0466958_0009293 3300045836 Bacteria 5475
343 Ga0466958_0249630 3300045836 Bacteria 1135
344 Ga0466967_0243244 3300045976 Bacteria 1717
345 Ga0495643_0082864 3300046522 Bacteria 1666
346 Ga0495663_0036025 3300046525 Bacteria 1488
347 Ga0495645_0274667 3300046543 Bacteria 1111
348 Ga0495669_0042246 3300046684 Bacteria 2026
349 Ga0495670_0112948 3300046691 Bacteria 1407
350 Ga0496101_0116725 3300048904 Bacteria 2014
351 Ga0496107_0021772 3300048910 Bacteria 4530
352 Ga0496107_0102997 3300048910 Bacteria 2094
353 Ga0496108_0010651 3300048911 Bacteria 7459
354 Ga0496109_0043226 3300048912 Bacteria 4084
355 Ga0496109_0058015 3300048912 Bacteria 3535
356 Ga0496110_0002515 3300048913 Bacteria 13774
357 Ga0496111_0028532 3300048914 Bacteria 3955
358 Ga0496112_0013201 3300048915 Bacteria 7620
359 Ga0496112_0523185 3300048915 Bacteria 1121
360 Ga0496113_0009123 3300048916 Bacteria 6499
361 Ga0501067_0096918 3300049583 Bacteria 1638
362 Ga0501069_0097913 3300049585 Bacteria 1663
363 Ga0501198_006475 3300049649 Bacteria 1669
364 Ga0501279_009752 3300049775 Bacteria 1289
365 nmdc:mga0n895_321030_c1 3300050512 Bacteria 1569
366 nmdc:mga0a205_11550_c1 3300050515 Bacteria 8136
367 Ga0466962_0002451 3300061719 Bacteria 8803
368 Ga0466962_0200114 3300061719 Bacteria 976
369 Ga0157372_10474040
370 JGI24736J21556_1005456
371 JGI24740J21852_10008471
372 JGI24740J21852_10013162
373 JGI24740J21852_10047193
374 JGI24739J22299_10003650
375 JGI24737J22298_10007708
376 JGI24737J22298_10044936
377 JGI24735J21928_10044262
378 Ga0065715_10022479
379 Ga0065715_10150604
380 Ga0070658_10004884
381 Ga0070658_10021777
382 Ga0070658_10082544
383 Ga0070658_10102392
384 Ga0070658_10189071
385 Ga0070658_10321326
386 Ga0070676_10133016
387 Ga0070683_100343240
388 Ga0070690_100005284
389 Ga0070677_10034848
390 Ga0068869_100226656
391 Ga0070666_10002844
392 Ga0070680_100032927
393 Ga0068868_100005000
394 Ga0068868_100451281
395 Ga0068868_100552505
396 Ga0070660_100004844
397 Ga0070660_100013738
398 Ga0070660_100016916
399 Ga0070660_100144848
400 Ga0070661_100021281
401 Ga0070661_100056708
402 Ga0070661_100125846
403 Ga0070692_10029528
404 Ga0070668_100182739
405 Ga0070669_100039749
406 Ga0070669_100239411
407 Ga0070675_100002714
408 Ga0070675_100295302
409 Ga0070675_100778167
410 Ga0070671_100004676
411 Ga0070671_100241850
412 Ga0070671_100474870
413 Ga0070674_100062822
414 Ga0070673_100063060
415 Ga0070659_100007979
416 Ga0070659_100087663
417 Ga0070659_100392937
418 Ga0070659_100465149
419 Ga0070667_100003895
420 Ga0070667_100046923
421 Ga0070713_100012893
422 Ga0070694_100003284
423 Ga0070663_100069687
424 Ga0070663_100369774
425 Ga0070662_100003335
426 Ga0070662_100008436
427 Ga0070662_100020254
428 Ga0070662_100094807
429 Ga0070662_100246406
430 Ga0070681_10249023
431 Ga0068867_100003727
432 Ga0070679_100012647
433 Ga0070679_100190622
434 Ga0070684_100016587
435 Ga0070684_100114996
436 Ga0068853_100077677
437 Ga0068853_100096784
438 Ga0068853_100113381
439 Ga0068853_100213384
440 Ga0070672_100044982
441 Ga0070672_100106429
442 Ga0070695_100103174
443 Ga0070665_100000232
444 Ga0070665_100036922
445 Ga0068855_100010293
446 Ga0068855_100035121
447 Ga0068855_100150477
448 Ga0068855_101105287
449 Ga0070664_100005277
450 Ga0070664_100275310
451 Ga0070664_100506522
452 Ga0068857_100038977
453 Ga0068857_100164473
454 Ga0068857_100281982
455 Ga0068857_100524002
456 Ga0068854_100039309
457 Ga0068856_100011799
458 Ga0068856_100044592
459 Ga0068856_100296299
460 Ga0070702_100272426
461 Ga0068852_100031772
462 Ga0068852_100099992
463 Ga0068852_100143725
464 Ga0068852_100249228
465 Ga0068852_100287659
466 Ga0068864_100085231
467 Ga0068864_100278256
468 Ga0068864_100330113
469 Ga0068863_100037827
470 Ga0068860_100013628
471 Ga0068860_100090012
472 Ga0068860_100141397
473 Ga0068860_100311044
474 Ga0068862_100021362
475 Ga0068862_100312534
476 Ga0070717_10002429
477 Ga0070712_100070891
478 Ga0075433_10212771
479 Ga0105240_10270593
480 Ga0105245_10422091
481 Ga0105243_10516572
482 Ga0105241_10267561
483 Ga0105242_10020035
484 Ga0105248_10001002
485 Ga0105237_10195954
486 Ga0105238_10428086
487 Ga0105249_10062799
488 Ga0105249_10708536
489 Ga0105239_10190057
490 Ga0105239_10508896
491 Ga0105246_10046146
492 Ga0105246_10181444
493 Ga0157373_10248275
494 Ga0157373_10522399
495 Ga0157371_10013052
496 Ga0157371_10143367
497 Ga0157370_10143842
498 Ga0157369_10028517
499 Ga0157369_10232985
500 Ga0157374_10129114
501 Ga0157372_10709357
502 Ga0157372_10908757
503 Ga0157375_10022925
504 Ga0157380_10076538
505 Ga0157377_10003012
506 Ga0157379_10069700
507 Ga0206354_11089654
508 Ga0206353_10043428
509 Ga0213873_10000008
510 Ga0213876_10000005
511 Ga0207682_10009522
512 Ga0207682_10083563
513 Ga0207688_10027759
514 Ga0207688_10063331
515 Ga0207680_10000271
516 Ga0207647_10001771
517 Ga0207647_10024414
518 Ga0207647_10043394
519 Ga0207647_10060763
520 Ga0207645_10137877
521 Ga0207705_10001792
522 Ga0207705_10001965
523 Ga0207705_10026657
524 Ga0207705_10062202
525 Ga0207705_10313945
526 Ga0207705_10352085
527 Ga0207654_10269509
528 Ga0207695_10360805
529 Ga0207660_10036755
530 Ga0207657_10001185
531 Ga0207657_10008696
532 Ga0207657_10040385
533 Ga0207657_10044947
534 Ga0207649_10040572
535 Ga0207652_10010702
536 Ga0207681_10044990
537 Ga0207650_10087311
538 Ga0207659_10060308
539 Ga0207687_10382105
540 Ga0207644_10022842
541 Ga0207690_10001735
542 Ga0207690_10029201
543 Ga0207690_10048589
544 Ga0207706_10007349
545 Ga0207706_10011384
546 Ga0207706_10128740
547 Ga0207706_10501879
548 Ga0207709_10098110
549 Ga0207709_10384532
550 Ga0207669_10003543
551 Ga0207691_10050321
552 Ga0207691_10101369
553 Ga0207691_10207061
554 Ga0207711_10000823
555 Ga0207689_10005456
556 Ga0207661_10692027
557 Ga0207679_10020953
558 Ga0207679_10395138
559 Ga0207679_10551948
560 Ga0207667_10060795
561 Ga0207667_10089697
562 Ga0207667_10206610
563 Ga0207651_10051799
564 Ga0207712_10000146
565 Ga0207668_10205196
566 Ga0207668_10322055
567 Ga0207658_10008282
568 Ga0207658_10228380
569 Ga0207677_10011889
570 Ga0207677_10019197
571 Ga0207677_10029235
572 Ga0207703_10004651
573 Ga0207639_10045447
574 Ga0207639_10064132
575 Ga0207639_10164928
576 Ga0207678_10006723
577 Ga0207678_10029096
578 Ga0207678_10298082
579 Ga0207702_10020794
580 Ga0207702_10025221
581 Ga0207641_10373187
582 Ga0207648_10011174
583 Ga0207676_10157601
584 Ga0207676_10267234
585 Ga0207676_10300787
586 Ga0207674_10006480
587 Ga0207674_10009135
588 Ga0207674_10017639
589 Ga0207674_10362113
590 Ga0207683_10392420
591 Ga0207698_10039963
592 Ga0207698_10054200
593 Ga0207698_10059661
594 Ga0207698_10138841
595 Ga0207698_10166060
596 Ga0207698_10184950
597 Ga0207698_10544406
598 Ga0209974_10029879
599 Ga0268266_10000425
600 Ga0268265_10013880
601 Ga0268264_10000594
602 Ga0268264_10040064
603 Ga0307408_100039162
604 Ga0307408_100123463
605 Ga0307408_100389625
606 Ga0307405_10015996
607 Ga0307405_10049637
608 Ga0307405_10160506
609 Ga0307413_10027395
610 Ga0307413_10034252
611 Ga0307413_10075492
612 Ga0307413_10095074
613 Ga0307410_10005219
614 Ga0307410_10024738
615 Ga0307410_10079771
616 Ga0307410_10210186
617 Ga0307406_10049041
618 Ga0307406_10054994
619 Ga0307406_10207687
620 Ga0307407_10059747
621 Ga0307407_10116261
622 Ga0307407_10468612
623 Ga0307412_10036414
624 Ga0307412_10059232
625 Ga0307412_10103327
626 Ga0307409_100014270
627 Ga0307409_100048294
628 Ga0307409_100089997
629 Ga0307416_100008475
630 Ga0307416_100022589
631 Ga0307416_100048518
632 Ga0307416_100213081
633 Ga0307416_100770871
634 Ga0307414_10115015
635 Ga0307414_10158322
636 Ga0307414_10394309
637 Ga0307411_10003991
638 Ga0307411_10051409
639 Ga0307411_10088116
640 Ga0307411_10166263
641 Ga0307415_100028971
642 Ga0307415_100124742
643 Ga0307415_100161400
644 Ga0373943_0167040
645 Ga0395899_0000103
646 Ga0395899_0001198
647 Ga0395899_0001279
648 Ga0395899_0027657
649 Ga0395899_0128734
650 Ga0395899_0144165
651 Ga0395900_0000093
652 Ga0395900_0007133
653 Ga0395900_0018451
654 Ga0395900_0019762
655 Ga0395900_0020612
656 Ga0395900_0052801
657 Ga0395900_0234801
658 Ga0395900_0466237
659 Ga0395900_0753922
660 Ga0395898_0000053
661 Ga0395898_0001084
662 Ga0395898_0016261
663 Ga0395898_0016833
664 Ga0395898_0039628
665 Ga0395898_0092684
666 Ga0395898_0271506
667 Ga0395898_0304460
668 Ga0395898_0845550
669 Ga0395898_0921501
670 Ga0395905_0000031
671 Ga0395905_0000259
672 Ga0395905_0001268
673 Ga0395905_0002525
674 Ga0395905_0002788
675 Ga0395905_0005106
676 Ga0395905_0021539
677 Ga0395905_0030204
678 Ga0395905_0062731
679 Ga0395905_0068609
680 Ga0395905_0085477
681 Ga0395905_0094511
682 Ga0395905_0147386
683 Ga0395905_0149630
684 Ga0395905_0177695
685 Ga0395905_0195142
686 Ga0395905_0343221
687 Ga0395901_0000339
688 Ga0395901_0004476
689 Ga0395901_0013519
690 Ga0395901_0015714
691 Ga0395901_0038598
692 Ga0395901_0062086
693 Ga0395901_0171037
694 Ga0395901_0247684
695 Ga0395901_0333035
696 Ga0395901_0425253
697 Ga0395901_0450522
698 Ga0395901_0460860
699 Ga0395901_0617386
700 Ga0436365_1858586
701 Ga0436362_1202204
702 Ga0466966_0092974
703 Ga0466966_0179889
704 Ga0466961_0048397
705 Ga0466963_0077183
706 Ga0466963_0090130
707 Ga0466963_0302427
708 Ga0466971_0039376
709 Ga0466959_0156713
710 Ga0466958_0009293
711 Ga0466958_0249630
712 Ga0466967_0243244
713 Ga0495643_0082864
714 Ga0495663_0036025
715 Ga0495645_0274667
716 Ga0495669_0042246
717 Ga0495670_0112948
718 Ga0496101_0116725
719 Ga0496107_0021772
720 Ga0496107_0102997
721 Ga0496108_0010651
722 Ga0496109_0043226
723 Ga0496109_0058015
724 Ga0496110_0002515
725 Ga0496111_0028532
726 Ga0496112_0013201
727 Ga0496112_0523185
728 Ga0496113_0009123
729 Ga0501067_0096918
730 Ga0501069_0097913
731 Ga0501198_006475
732 Ga0501279_009752
733 nmdc:mga0n895_321030_c1
734 nmdc:mga0a205_11550_c1
735 Ga0466962_0002451
736 Ga0466962_0200114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

202

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

252

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dqx-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.8795 6 222
4dqx-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.8792 6 222
2cfc-assembly1.cif.gz_D structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases 0.872 11 218
4dqx-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.8712 7 222
4dqx-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.8658 6 221
ID Description Score Start End Superfamily
2cfcD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.872 11 218 3.40.50.720
af_G5EGA6_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8684 1 219 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8635 8 221 3.40.50.720
4cqlI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8606 4 219 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8594 2 152 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V9U3D7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9099 8 157 GO:0006635
AF-G2ITG9-F1-model_v4 LinC-like SDR-family protein 0.9 5 218 GO:0016491
AF-A0A382JCU2-F1-model_v4 Oxidoreductase 0.8984 5 152 GO:0016491
AF-A0A4R4SZ51-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.8944 5 157 GO:0016616
AF-A0A7C8L6R0-F1-model_v4 deleted 0.8908 6 215

Map