F424597

General Info

Members Datasets Scaffolds Average Seq Length
368 199 736 156

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100375884|Ga0070659_1003758842
Length 154
Sequence MTLYFLVEYLHVLGAIVILGTGIGIAFFMLMAHRSRDADFIARTAEVVVIADALFTLSAVILQPITGGVLMVLSSTSLGERWLATSLVLYLVAGAFWVPVVFMQIEMRDLARAAAKQGELPPRYFALFRRWFAFGIPGFGSVMIILYLMIAKPF

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
195 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
196 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
197 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 3.26
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100375884 3300005366 Bacteria 1196
2 Ga0070683_100132797 3300005329 Bacteria 2356
3 Ga0070683_100176415 3300005329 Bacteria 2028
4 Ga0070680_100592225 3300005336 Bacteria 952
5 Ga0070668_100803637 3300005347 Bacteria 836
6 Ga0070674_100970701 3300005356 Bacteria 744
7 Ga0070709_10000760 3300005434 Bacteria 18193
8 Ga0070709_10006666 3300005434 Bacteria 6305
9 Ga0070714_100019578 3300005435 Bacteria 5517
10 Ga0070714_100049999 3300005435 Bacteria 3559
11 Ga0070714_100051686 3300005435 Bacteria 3505
12 Ga0070714_100194498 3300005435 Bacteria 1853
13 Ga0070713_100008103 3300005436 Bacteria 7430
14 Ga0070713_100011594 3300005436 Bacteria 6426
15 Ga0070713_100243004 3300005436 Bacteria 1640
16 Ga0070713_100499269 3300005436 Bacteria 1148
17 Ga0070713_101981703 3300005436 Bacteria 565
18 Ga0070710_10004347 3300005437 Bacteria 6712
19 Ga0070710_10006003 3300005437 Bacteria 5803
20 Ga0070710_10300356 3300005437 Bacteria 1048
21 Ga0070711_100000745 3300005439 Bacteria 16987
22 Ga0070711_100011289 3300005439 Bacteria 5542
23 Ga0070711_100020110 3300005439 Bacteria 4296
24 Ga0070711_100022366 3300005439 Bacteria 4097
25 Ga0070711_100073197 3300005439 Bacteria 2420
26 Ga0070705_100339824 3300005440 Bacteria 1091
27 Ga0070681_10062558 3300005458 Bacteria 3696
28 Ga0070681_10087827 3300005458 Bacteria 3062
29 Ga0070681_10146799 3300005458 Bacteria 2287
30 Ga0070681_10183358 3300005458 Bacteria 2014
31 Ga0070679_100048668 3300005530 Bacteria 4223
32 Ga0070679_100090000 3300005530 Bacteria 3057
33 Ga0070679_101277689 3300005530 Bacteria 679
34 Ga0070684_100350477 3300005535 Bacteria 1358
35 Ga0070684_100758584 3300005535 Bacteria 906
36 Ga0070697_101236905 3300005536 Bacteria 666
37 Ga0068853_100113021 3300005539 Bacteria 2414
38 Ga0068855_100031318 3300005563 Bacteria 6352
39 Ga0068855_100760326 3300005563 Bacteria 1033
40 Ga0068855_101164966 3300005563 Bacteria 803
41 Ga0068855_101516377 3300005563 Bacteria 688
42 Ga0068856_100382641 3300005614 Bacteria 1426
43 Ga0070702_100303756 3300005615 Bacteria 1105
44 Ga0068852_100700749 3300005616 Bacteria 1023
45 Ga0068859_100341828 3300005617 Bacteria 1591
46 Ga0068860_101001083 3300005843 Bacteria 854
47 Ga0070717_10000269 3300006028 Bacteria 35470
48 Ga0070717_10019608 3300006028 Bacteria 5307
49 Ga0070717_10022470 3300006028 Bacteria 4985
50 Ga0070717_10140893 3300006028 Bacteria 2080
51 Ga0070717_10464241 3300006028 Bacteria 1142
52 Ga0070717_10739871 3300006028 Bacteria 894
53 Ga0070715_10284432 3300006163 Bacteria 878
54 Ga0070715_10322866 3300006163 Bacteria 834
55 Ga0070716_100001898 3300006173 Bacteria 9483
56 Ga0070716_100198318 3300006173 Bacteria 1332
57 Ga0070716_100336582 3300006173 Bacteria 1063
58 Ga0070716_100708322 3300006173 Bacteria 770
59 Ga0070712_100027680 3300006175 Bacteria 3786
60 Ga0070712_100032048 3300006175 Bacteria 3546
61 Ga0070712_100042814 3300006175 Bacteria 3115
62 Ga0070712_100072854 3300006175 Bacteria 2462
63 Ga0070712_100148662 3300006175 Bacteria 1796
64 Ga0075367_10161753 3300006178 Bacteria 1392
65 Ga0068871_100183346 3300006358 Bacteria 1800
66 Ga0097620_100341821 3300006931 Bacteria 1591
67 Ga0099794_10136879 3300007265 Bacteria 1239
68 Ga0099794_10139320 3300007265 Bacteria 1228
69 Ga0099795_10271673 3300007788 Bacteria 737
70 Ga0105240_10127939 3300009093 Bacteria 3050
71 Ga0105240_10140953 3300009093 Bacteria 2882
72 Ga0105240_10160847 3300009093 Bacteria 2667
73 Ga0105240_10545527 3300009093 Unclassified 1283
74 Ga0105247_10027493 3300009101 Bacteria 3440
75 Ga0105247_10039877 3300009101 Bacteria 2870
76 Ga0105243_10635217 3300009148 Bacteria 1033
77 Ga0105241_11097616 3300009174 Bacteria 749
78 Ga0105242_10503410 3300009176 Bacteria 1152
79 Ga0105248_10069715 3300009177 Bacteria 3948
80 Ga0105237_10034392 3300009545 Bacteria 5132
81 Ga0105237_10523770 3300009545 Bacteria 1192
82 Ga0105238_10030061 3300009551 Bacteria 5528
83 Ga0105238_10171770 3300009551 Bacteria 2144
84 Ga0105238_12280341 3300009551 Bacteria 576
85 Ga0099796_10188983 3300010159 Bacteria 830
86 Ga0105239_10648462 3300010375 Bacteria 1206
87 Ga0157370_10253258 3300013104 Bacteria 1628
88 Ga0157369_10264371 3300013105 Bacteria 1794
89 Ga0157369_10438755 3300013105 Bacteria 1353
90 Ga0157369_11360742 3300013105 Bacteria 723
91 Ga0157374_10423269 3300013296 Bacteria 1331
92 Ga0163162_11587947 3300013306 Bacteria 746
93 Ga0157372_10128601 3300013307 Bacteria 2913
94 Ga0157372_11127950 3300013307 Bacteria 907
95 Ga0157375_11522108 3300013308 Bacteria 790
96 Ga0157379_10181148 3300014968 Bacteria 1903
97 Ga0157376_11117277 3300014969 Bacteria 814
98 Ga0163161_10968687 3300017792 Bacteria 724
99 Ga0213872_10138173 3300021361 Bacteria 1071
100 Ga0213876_10280737 3300021384 Bacteria 885
101 Ga0213871_10014095 3300021441 Bacteria 1890
102 Ga0224570_109665 3300022730 Bacteria 604
103 Ga0207692_10000948 3300025898 Bacteria 10529
104 Ga0207692_10001258 3300025898 Bacteria 9414
105 Ga0207692_10482251 3300025898 Bacteria 784
106 Ga0207710_10004234 3300025900 Bacteria 6290
107 Ga0207680_10458657 3300025903 Bacteria 905
108 Ga0207685_10000204 3300025905 Bacteria 9127
109 Ga0207685_10206588 3300025905 Bacteria 926
110 Ga0207699_10000309 3300025906 Bacteria 26099
111 Ga0207699_10071224 3300025906 Bacteria 2125
112 Ga0207699_10175910 3300025906 Bacteria 1435
113 Ga0207654_10800911 3300025911 Bacteria 680
114 Ga0207707_10037030 3300025912 Bacteria 4263
115 Ga0207707_10050290 3300025912 Bacteria 3631
116 Ga0207707_10067620 3300025912 Bacteria 3112
117 Ga0207707_10093837 3300025912 Bacteria 2622
118 Ga0207707_10145184 3300025912 Bacteria 2074
119 Ga0207695_10018913 3300025913 Bacteria 7947
120 Ga0207695_10091259 3300025913 Bacteria 3060
121 Ga0207695_11048318 3300025913 Bacteria 695
122 Ga0207671_10061843 3300025914 Bacteria 2779
123 Ga0207671_10351859 3300025914 Bacteria 1168
124 Ga0207693_10004948 3300025915 Bacteria 11198
125 Ga0207693_10037947 3300025915 Bacteria 3796
126 Ga0207693_10037980 3300025915 Bacteria 3794
127 Ga0207693_10137126 3300025915 Bacteria 1924
128 Ga0207693_10178062 3300025915 Bacteria 1673
129 Ga0207693_10187228 3300025915 Bacteria 1629
130 Ga0207663_10001983 3300025916 Bacteria 9708
131 Ga0207663_10002321 3300025916 Bacteria 9124
132 Ga0207663_10067298 3300025916 Bacteria 2296
133 Ga0207663_10078904 3300025916 Bacteria 2148
134 Ga0207663_10693712 3300025916 Bacteria 806
135 Ga0207660_10766579 3300025917 Bacteria 787
136 Ga0207660_11052740 3300025917 Bacteria 663
137 Ga0207652_10042012 3300025921 Bacteria 3889
138 Ga0207652_10042685 3300025921 Bacteria 3861
139 Ga0207652_10328876 3300025921 Bacteria 1380
140 Ga0207694_10030285 3300025924 Bacteria 4133
141 Ga0207700_10001978 3300025928 Bacteria 11673
142 Ga0207700_10011092 3300025928 Bacteria 5730
143 Ga0207700_10025504 3300025928 Bacteria 4106
144 Ga0207700_10037247 3300025928 Bacteria 3521
145 Ga0207700_10066827 3300025928 Bacteria 2749
146 Ga0207700_10274397 3300025928 Bacteria 1448
147 Ga0207700_11207839 3300025928 Bacteria 675
148 Ga0207664_10065717 3300025929 Bacteria 2905
149 Ga0207664_10094547 3300025929 Bacteria 2457
150 Ga0207664_10136697 3300025929 Bacteria 2069
151 Ga0207664_10744760 3300025929 Bacteria 881
152 Ga0207669_10482009 3300025937 Bacteria 989
153 Ga0207665_10012866 3300025939 Bacteria 5503
154 Ga0207665_10021433 3300025939 Bacteria 4249
155 Ga0207665_10107800 3300025939 Bacteria 1954
156 Ga0207665_10109744 3300025939 Bacteria 1937
157 Ga0207665_10199570 3300025939 Bacteria 1457
158 Ga0207665_10269723 3300025939 Bacteria 1263
159 Ga0207665_10437074 3300025939 Bacteria 1002
160 Ga0207665_10805937 3300025939 Bacteria 742
161 Ga0207661_10005395 3300025944 Bacteria 9003
162 Ga0207661_10062014 3300025944 Bacteria 3023
163 Ga0207667_10059937 3300025949 Bacteria 3984
164 Ga0207667_10949086 3300025949 Bacteria 850
165 Ga0207703_10366804 3300026035 Bacteria 1329
166 Ga0207639_10479805 3300026041 Bacteria 1133
167 Ga0207708_10092846 3300026075 Bacteria 2329
168 Ga0207674_10184555 3300026116 Bacteria 2036
169 Ga0207698_10252141 3300026142 Bacteria 1616
170 Ga0209588_1096800 3300027671 Bacteria 950
171 Ga0268264_12057725 3300028381 Bacteria 580
172 Ga0307517_10000175 3300028786 Bacteria 105567
173 Ga0307515_10050256 3300028794 Bacteria 6250
174 Ga0307515_10257313 3300028794 Bacteria 1488
175 Ga0307515_10297197 3300028794 Bacteria 1304
176 Ga0307512_10153903 3300030522 Bacteria 1367
177 Ga0265330_10050572 3300031235 Bacteria 1823
178 Ga0265339_10112220 3300031249 Bacteria 1409
179 Ga0265316_10159878 3300031344 Bacteria 1685
180 Ga0307513_10043488 3300031456 Bacteria 4932
181 Ga0307513_10158756 3300031456 Bacteria 2157
182 Ga0307509_10557803 3300031507 Bacteria 822
183 Ga0307508_10000108 3300031616 Bacteria 97443
184 Ga0307508_10619621 3300031616 Bacteria 685
185 Ga0307508_10765033 3300031616 Bacteria 580
186 Ga0265314_10022258 3300031711 Bacteria 4857
187 Ga0265342_10008582 3300031712 Bacteria 7307
188 Ga0307516_10022755 3300031730 Bacteria 6433
189 Ga0307516_10028758 3300031730 Bacteria 5623
190 Ga0307516_10177686 3300031730 Bacteria 1864
191 Ga0307516_10443371 3300031730 Bacteria 955
192 Ga0307412_10103408 3300031911 Bacteria 2019
193 Ga0307411_11290640 3300032005 Bacteria 665
194 Ga0307415_101539723 3300032126 Bacteria 637
195 Ga0307507_10041628 3300033179 Bacteria 4594
196 Ga0316215_1004706 3300033544 Bacteria 1309
197 Ga0373926_0009339 3300035083 Bacteria 3276
198 Ga0373923_0006026 3300035111 Bacteria 4159
199 Ga0373923_0123374 3300035111 Bacteria 1159
200 Ga0373923_0281264 3300035111 Bacteria 784
201 Ga0373936_0118166 3300035113 Bacteria 1130
202 Ga0373945_0043045 3300035116 Bacteria 1637
203 Ga0373953_0051525 3300035117 Bacteria 1664
204 Ga0373953_0107757 3300035117 Bacteria 1176
205 Ga0373954_0023261 3300035118 Bacteria 2816
206 Ga0373954_0056104 3300035118 Bacteria 1853
207 Ga0373943_0015958 3300035170 Bacteria 3419
208 Ga0373943_0236102 3300035170 Bacteria 1023
209 Ga0373946_0058439 3300035171 Bacteria 1634
210 Ga0373946_0097907 3300035171 Bacteria 1310
211 Ga0373924_0018866 3300035410 Bacteria 2665
212 Ga0373924_0020317 3300035410 Bacteria 2580
213 Ga0373935_0022440 3300035692 Bacteria 3871
214 Ga0373935_0226262 3300035692 Bacteria 1301
215 Ga0373935_0407413 3300035692 Bacteria 977
216 Ga0373927_0024767 3300035695 Bacteria 3921
217 Ga0373927_0043867 3300035695 Bacteria 2894
218 Ga0373927_0050171 3300035695 Bacteria 2698
219 Ga0373927_0065094 3300035695 Bacteria 2358
220 Ga0373927_0505684 3300035695 Bacteria 798
221 Ga0373933_0128335 3300035724 Bacteria 1593
222 Ga0373933_0181201 3300035724 Bacteria 1343
223 Ga0373947_0022347 3300035725 Bacteria 3668
224 Ga0373947_0036763 3300035725 Bacteria 2904
225 Ga0373947_0173083 3300035725 Bacteria 1402
226 Ga0373947_0277867 3300035725 Bacteria 1113
227 Ga0373947_0369205 3300035725 Bacteria 965
228 Ga0373937_0042105 3300036401 Bacteria 4167
229 Ga0373937_0217865 3300036401 Bacteria 1796
230 Ga0373937_0217894 3300036401 Bacteria 1796
231 Ga0372808_006395 3300036459 Bacteria 1586
232 Ga0373925_0006615 3300037068 Bacteria 8518
233 Ga0373925_0060473 3300037068 Bacteria 2845
234 Ga0373925_0166449 3300037068 Bacteria 1739
235 Ga0373925_0170924 3300037068 Bacteria 1716
236 Ga0373925_0310141 3300037068 Bacteria 1275
237 Ga0395905_0082891 3300037471 Bacteria 3005
238 Ga0436364_1047074 3300037853 Bacteria 1167
239 Ga0436364_1545287 3300037853 Bacteria 916
240 Ga0395901_0292434 3300038443 Bacteria 1690
241 Ga0395901_0312593 3300038443 Bacteria 1627
242 Ga0436365_1431221 3300039437 Bacteria 2364
243 Ga0436365_1621117 3300039437 Bacteria 1632
244 Ga0436360_1118093 3300039438 Bacteria 840
245 Ga0436360_1297972 3300039438 Bacteria 2040
246 Ga0436361_0735513 3300039447 Bacteria 895
247 Ga0436361_1037405 3300039447 Bacteria 1148
248 Ga0436363_0332415 3300039450 Bacteria 883
249 Ga0436363_1123481 3300039450 Bacteria 2965
250 Ga0436363_1373846 3300039450 Bacteria 576
251 Ga0439465_0128365 3300041413 Bacteria 893
252 Ga0451853_1616348 3300041512 Bacteria 1552
253 Ga0466972_0019580 3300044658 Bacteria 3383
254 Ga0466966_0090596 3300044684 Bacteria 1899
255 Ga0466963_0087111 3300044694 Bacteria 2123
256 Ga0466964_0033860 3300044706 Bacteria 2037
257 Ga0466964_0124093 3300044706 Bacteria 1168
258 Ga0466971_0111032 3300044719 Bacteria 1265
259 Ga0466968_0001671 3300044735 Bacteria 8000
260 Ga0466968_0169615 3300044735 Bacteria 1011
261 Ga0466957_0061568 3300044842 Bacteria 2304
262 Ga0466960_0007351 3300044901 Bacteria 4471
263 Ga0466958_0327453 3300045836 Bacteria 985
264 Ga0495592_0028999 3300046454 Bacteria 4190
265 Ga0495603_0063356 3300046455 Bacteria 2181
266 Ga0495603_0103563 3300046455 Bacteria 1661
267 Ga0495603_0394486 3300046455 Bacteria 793
268 Ga0495651_0091160 3300046462 Bacteria 2285
269 Ga0495653_0061244 3300046463 Bacteria 2848
270 Ga0495580_0032873 3300046472 Bacteria 3738
271 Ga0495580_0193600 3300046472 Bacteria 1402
272 Ga0495582_0009820 3300046473 Bacteria 5272
273 Ga0495582_0098796 3300046473 Bacteria 1634
274 Ga0495582_0138106 3300046473 Bacteria 1380
275 Ga0495582_0250373 3300046473 Bacteria 1016
276 Ga0495639_0008629 3300046475 Bacteria 4371
277 Ga0495639_0110318 3300046475 Bacteria 1305
278 Ga0495639_0253204 3300046475 Bacteria 871
279 Ga0495662_0192055 3300046476 Bacteria 1007
280 Ga0495664_0209720 3300046477 Bacteria 1180
281 Ga0495664_0354163 3300046477 Bacteria 884
282 Ga0495618_0040722 3300046514 Bacteria 2925
283 Ga0495628_0054700 3300046516 Bacteria 3146
284 Ga0495628_0703039 3300046516 Bacteria 714
285 Ga0495630_0034668 3300046517 Bacteria 3769
286 Ga0495644_0113953 3300046523 Bacteria 1026
287 Ga0495666_0021173 3300046526 Bacteria 3219
288 Ga0495652_0103922 3300046529 Bacteria 2298
289 Ga0495640_0031960 3300046533 Bacteria 3753
290 Ga0495640_0326945 3300046533 Bacteria 949
291 Ga0495645_0143977 3300046543 Bacteria 1661
292 Ga0495622_0051610 3300046557 Bacteria 1908
293 Ga0495667_0128356 3300046559 Bacteria 1636
294 Ga0495656_0432019 3300046615 Bacteria 692
295 Ga0495625_0055727 3300046660 Bacteria 2818
296 Ga0495588_0398860 3300046674 Bacteria 722
297 Ga0495588_0406414 3300046674 Bacteria 715
298 Ga0495657_0074231 3300046675 Bacteria 2213
299 Ga0495599_0137923 3300046678 Bacteria 1513
300 Ga0495646_0058895 3300046680 Bacteria 2295
301 Ga0495646_0536833 3300046680 Bacteria 598
302 Ga0495647_0012558 3300046681 Bacteria 2919
303 Ga0495658_0057122 3300046683 Bacteria 2228
304 Ga0495613_0327617 3300046689 Bacteria 1056
305 Ga0495613_0348732 3300046689 Bacteria 1017
306 Ga0495613_0422634 3300046689 Bacteria 907
307 Ga0495613_0740384 3300046689 Bacteria 645
308 Ga0495581_0057138 3300047315 Bacteria 2252
309 Ga0495604_0114107 3300047317 Bacteria 1965
310 Ga0495604_0188579 3300047317 Bacteria 1438
311 Ga0495674_0046309 3300047319 Bacteria 3860
312 Ga0495672_0044664 3300047320 Bacteria 2656
313 Ga0495676_0096055 3300047321 Bacteria 2204
314 Ga0495676_0198563 3300047321 Bacteria 1395
315 Ga0495684_0021095 3300047471 Bacteria 5018
316 Ga0495602_0367480 3300048088 Bacteria 1034
317 Ga0495602_0670212 3300048088 Bacteria 707
318 Ga0496100_0874958 3300048903 Bacteria 705
319 Ga0496101_0116751 3300048904 Bacteria 2014
320 Ga0496102_0230491 3300048905 Bacteria 1746
321 Ga0496102_0471318 3300048905 Bacteria 1177
322 Ga0496106_0000375 3300048909 Bacteria 31755
323 Ga0496106_0160798 3300048909 Bacteria 1776
324 Ga0496107_0212396 3300048910 Bacteria 1439
325 Ga0496108_0360538 3300048911 Bacteria 1269
326 Ga0496114_0302212 3300048917 Bacteria 1413
327 Ga0496115_0079569 3300048918 Bacteria 2668
328 Ga0496115_0096105 3300048918 Bacteria 2426
329 Ga0496115_0120319 3300048918 Bacteria 2160
330 Ga0496117_0008318 3300048920 Bacteria 9873
331 Ga0496118_0004601 3300048921 Bacteria 16216
332 Ga0496121_0000203 3300048924 Bacteria 130984
333 Ga0496121_0000839 3300048924 Bacteria 55686
334 Ga0496121_0089135 3300048924 Bacteria 2416
335 Ga0496121_0351073 3300048924 Bacteria 982
336 Ga0496121_0430557 3300048924 Bacteria 856
337 Ga0496121_0433291 3300048924 Bacteria 852
338 Ga0496124_0004555 3300048927 Bacteria 16114
339 Ga0496124_0736048 3300048927 Bacteria 620
340 Ga0496125_0078546 3300048928 Bacteria 2536
341 Ga0496125_0159508 3300048928 Bacteria 1535
342 Ga0496126_0013420 3300048929 Bacteria 8335
343 Ga0496126_0042038 3300048929 Bacteria 4224
344 Ga0496126_0162398 3300048929 Bacteria 1908
345 Ga0501079_0110522 3300049741 Bacteria 2136
346 nmdc:mga03n38_43484_c1 3300050490 Bacteria 1968
347 nmdc:mga06z11_577002_c1 3300050494 Bacteria 684
348 nmdc:mga06z11_709740_c1 3300050494 Bacteria 613
349 Ga0495601_0197700 3300053077 Bacteria 1314
350 Ga0495655_0013214 3300053083 Bacteria 1703
351 Ga0495655_0157698 3300053083 Bacteria 718
352 Ga0495595_0077985 3300053084 Bacteria 1574
353 Ga0495619_0137512 3300053085 Bacteria 1681
354 Ga0495619_0387185 3300053085 Bacteria 966
355 Ga0500647_0180813 3300053091 Bacteria 968
356 Ga0500595_001144 3300053119 Bacteria 14722
357 Ga0500559_0040661 3300053136 Bacteria 2025
358 Ga0500559_0089943 3300053136 Bacteria 1404
359 Ga0500568_0006552 3300053139 Bacteria 5829
360 Ga0500568_0066075 3300053139 Bacteria 1391
361 Ga0500573_0030700 3300053140 Bacteria 3099
362 Ga0500603_004984 3300053150 Bacteria 2851
363 Ga0500638_106692 3300053162 Bacteria 1299
364 Ga0500639_070569 3300053163 Bacteria 1781
365 Ga0500636_0089190 3300053177 Bacteria 1768
366 Ga0500636_0123808 3300053177 Bacteria 1447
367 Ga0500637_0103187 3300053178 Bacteria 1654
368 Ga0500596_055796 3300053735 Bacteria 653
369 Ga0070659_100375884
370 Ga0070683_100132797
371 Ga0070683_100176415
372 Ga0070680_100592225
373 Ga0070668_100803637
374 Ga0070674_100970701
375 Ga0070709_10000760
376 Ga0070709_10006666
377 Ga0070714_100019578
378 Ga0070714_100049999
379 Ga0070714_100051686
380 Ga0070714_100194498
381 Ga0070713_100008103
382 Ga0070713_100011594
383 Ga0070713_100243004
384 Ga0070713_100499269
385 Ga0070713_101981703
386 Ga0070710_10004347
387 Ga0070710_10006003
388 Ga0070710_10300356
389 Ga0070711_100000745
390 Ga0070711_100011289
391 Ga0070711_100020110
392 Ga0070711_100022366
393 Ga0070711_100073197
394 Ga0070705_100339824
395 Ga0070681_10062558
396 Ga0070681_10087827
397 Ga0070681_10146799
398 Ga0070681_10183358
399 Ga0070679_100048668
400 Ga0070679_100090000
401 Ga0070679_101277689
402 Ga0070684_100350477
403 Ga0070684_100758584
404 Ga0070697_101236905
405 Ga0068853_100113021
406 Ga0068855_100031318
407 Ga0068855_100760326
408 Ga0068855_101164966
409 Ga0068855_101516377
410 Ga0068856_100382641
411 Ga0070702_100303756
412 Ga0068852_100700749
413 Ga0068859_100341828
414 Ga0068860_101001083
415 Ga0070717_10000269
416 Ga0070717_10019608
417 Ga0070717_10022470
418 Ga0070717_10140893
419 Ga0070717_10464241
420 Ga0070717_10739871
421 Ga0070715_10284432
422 Ga0070715_10322866
423 Ga0070716_100001898
424 Ga0070716_100198318
425 Ga0070716_100336582
426 Ga0070716_100708322
427 Ga0070712_100027680
428 Ga0070712_100032048
429 Ga0070712_100042814
430 Ga0070712_100072854
431 Ga0070712_100148662
432 Ga0075367_10161753
433 Ga0068871_100183346
434 Ga0097620_100341821
435 Ga0099794_10136879
436 Ga0099794_10139320
437 Ga0099795_10271673
438 Ga0105240_10127939
439 Ga0105240_10140953
440 Ga0105240_10160847
441 Ga0105240_10545527
442 Ga0105247_10027493
443 Ga0105247_10039877
444 Ga0105243_10635217
445 Ga0105241_11097616
446 Ga0105242_10503410
447 Ga0105248_10069715
448 Ga0105237_10034392
449 Ga0105237_10523770
450 Ga0105238_10030061
451 Ga0105238_10171770
452 Ga0105238_12280341
453 Ga0099796_10188983
454 Ga0105239_10648462
455 Ga0157370_10253258
456 Ga0157369_10264371
457 Ga0157369_10438755
458 Ga0157369_11360742
459 Ga0157374_10423269
460 Ga0163162_11587947
461 Ga0157372_10128601
462 Ga0157372_11127950
463 Ga0157375_11522108
464 Ga0157379_10181148
465 Ga0157376_11117277
466 Ga0163161_10968687
467 Ga0213872_10138173
468 Ga0213876_10280737
469 Ga0213871_10014095
470 Ga0224570_109665
471 Ga0207692_10000948
472 Ga0207692_10001258
473 Ga0207692_10482251
474 Ga0207710_10004234
475 Ga0207680_10458657
476 Ga0207685_10000204
477 Ga0207685_10206588
478 Ga0207699_10000309
479 Ga0207699_10071224
480 Ga0207699_10175910
481 Ga0207654_10800911
482 Ga0207707_10037030
483 Ga0207707_10050290
484 Ga0207707_10067620
485 Ga0207707_10093837
486 Ga0207707_10145184
487 Ga0207695_10018913
488 Ga0207695_10091259
489 Ga0207695_11048318
490 Ga0207671_10061843
491 Ga0207671_10351859
492 Ga0207693_10004948
493 Ga0207693_10037947
494 Ga0207693_10037980
495 Ga0207693_10137126
496 Ga0207693_10178062
497 Ga0207693_10187228
498 Ga0207663_10001983
499 Ga0207663_10002321
500 Ga0207663_10067298
501 Ga0207663_10078904
502 Ga0207663_10693712
503 Ga0207660_10766579
504 Ga0207660_11052740
505 Ga0207652_10042012
506 Ga0207652_10042685
507 Ga0207652_10328876
508 Ga0207694_10030285
509 Ga0207700_10001978
510 Ga0207700_10011092
511 Ga0207700_10025504
512 Ga0207700_10037247
513 Ga0207700_10066827
514 Ga0207700_10274397
515 Ga0207700_11207839
516 Ga0207664_10065717
517 Ga0207664_10094547
518 Ga0207664_10136697
519 Ga0207664_10744760
520 Ga0207669_10482009
521 Ga0207665_10012866
522 Ga0207665_10021433
523 Ga0207665_10107800
524 Ga0207665_10109744
525 Ga0207665_10199570
526 Ga0207665_10269723
527 Ga0207665_10437074
528 Ga0207665_10805937
529 Ga0207661_10005395
530 Ga0207661_10062014
531 Ga0207667_10059937
532 Ga0207667_10949086
533 Ga0207703_10366804
534 Ga0207639_10479805
535 Ga0207708_10092846
536 Ga0207674_10184555
537 Ga0207698_10252141
538 Ga0209588_1096800
539 Ga0268264_12057725
540 Ga0307517_10000175
541 Ga0307515_10050256
542 Ga0307515_10257313
543 Ga0307515_10297197
544 Ga0307512_10153903
545 Ga0265330_10050572
546 Ga0265339_10112220
547 Ga0265316_10159878
548 Ga0307513_10043488
549 Ga0307513_10158756
550 Ga0307509_10557803
551 Ga0307508_10000108
552 Ga0307508_10619621
553 Ga0307508_10765033
554 Ga0265314_10022258
555 Ga0265342_10008582
556 Ga0307516_10022755
557 Ga0307516_10028758
558 Ga0307516_10177686
559 Ga0307516_10443371
560 Ga0307412_10103408
561 Ga0307411_11290640
562 Ga0307415_101539723
563 Ga0307507_10041628
564 Ga0316215_1004706
565 Ga0373926_0009339
566 Ga0373923_0006026
567 Ga0373923_0123374
568 Ga0373923_0281264
569 Ga0373936_0118166
570 Ga0373945_0043045
571 Ga0373953_0051525
572 Ga0373953_0107757
573 Ga0373954_0023261
574 Ga0373954_0056104
575 Ga0373943_0015958
576 Ga0373943_0236102
577 Ga0373946_0058439
578 Ga0373946_0097907
579 Ga0373924_0018866
580 Ga0373924_0020317
581 Ga0373935_0022440
582 Ga0373935_0226262
583 Ga0373935_0407413
584 Ga0373927_0024767
585 Ga0373927_0043867
586 Ga0373927_0050171
587 Ga0373927_0065094
588 Ga0373927_0505684
589 Ga0373933_0128335
590 Ga0373933_0181201
591 Ga0373947_0022347
592 Ga0373947_0036763
593 Ga0373947_0173083
594 Ga0373947_0277867
595 Ga0373947_0369205
596 Ga0373937_0042105
597 Ga0373937_0217865
598 Ga0373937_0217894
599 Ga0372808_006395
600 Ga0373925_0006615
601 Ga0373925_0060473
602 Ga0373925_0166449
603 Ga0373925_0170924
604 Ga0373925_0310141
605 Ga0395905_0082891
606 Ga0436364_1047074
607 Ga0436364_1545287
608 Ga0395901_0292434
609 Ga0395901_0312593
610 Ga0436365_1431221
611 Ga0436365_1621117
612 Ga0436360_1118093
613 Ga0436360_1297972
614 Ga0436361_0735513
615 Ga0436361_1037405
616 Ga0436363_0332415
617 Ga0436363_1123481
618 Ga0436363_1373846
619 Ga0439465_0128365
620 Ga0451853_1616348
621 Ga0466972_0019580
622 Ga0466966_0090596
623 Ga0466963_0087111
624 Ga0466964_0033860
625 Ga0466964_0124093
626 Ga0466971_0111032
627 Ga0466968_0001671
628 Ga0466968_0169615
629 Ga0466957_0061568
630 Ga0466960_0007351
631 Ga0466958_0327453
632 Ga0495592_0028999
633 Ga0495603_0063356
634 Ga0495603_0103563
635 Ga0495603_0394486
636 Ga0495651_0091160
637 Ga0495653_0061244
638 Ga0495580_0032873
639 Ga0495580_0193600
640 Ga0495582_0009820
641 Ga0495582_0098796
642 Ga0495582_0138106
643 Ga0495582_0250373
644 Ga0495639_0008629
645 Ga0495639_0110318
646 Ga0495639_0253204
647 Ga0495662_0192055
648 Ga0495664_0209720
649 Ga0495664_0354163
650 Ga0495618_0040722
651 Ga0495628_0054700
652 Ga0495628_0703039
653 Ga0495630_0034668
654 Ga0495644_0113953
655 Ga0495666_0021173
656 Ga0495652_0103922
657 Ga0495640_0031960
658 Ga0495640_0326945
659 Ga0495645_0143977
660 Ga0495622_0051610
661 Ga0495667_0128356
662 Ga0495656_0432019
663 Ga0495625_0055727
664 Ga0495588_0398860
665 Ga0495588_0406414
666 Ga0495657_0074231
667 Ga0495599_0137923
668 Ga0495646_0058895
669 Ga0495646_0536833
670 Ga0495647_0012558
671 Ga0495658_0057122
672 Ga0495613_0327617
673 Ga0495613_0348732
674 Ga0495613_0422634
675 Ga0495613_0740384
676 Ga0495581_0057138
677 Ga0495604_0114107
678 Ga0495604_0188579
679 Ga0495674_0046309
680 Ga0495672_0044664
681 Ga0495676_0096055
682 Ga0495676_0198563
683 Ga0495684_0021095
684 Ga0495602_0367480
685 Ga0495602_0670212
686 Ga0496100_0874958
687 Ga0496101_0116751
688 Ga0496102_0230491
689 Ga0496102_0471318
690 Ga0496106_0000375
691 Ga0496106_0160798
692 Ga0496107_0212396
693 Ga0496108_0360538
694 Ga0496114_0302212
695 Ga0496115_0079569
696 Ga0496115_0096105
697 Ga0496115_0120319
698 Ga0496117_0008318
699 Ga0496118_0004601
700 Ga0496121_0000203
701 Ga0496121_0000839
702 Ga0496121_0089135
703 Ga0496121_0351073
704 Ga0496121_0430557
705 Ga0496121_0433291
706 Ga0496124_0004555
707 Ga0496124_0736048
708 Ga0496125_0078546
709 Ga0496125_0159508
710 Ga0496126_0013420
711 Ga0496126_0042038
712 Ga0496126_0162398
713 Ga0501079_0110522
714 nmdc:mga03n38_43484_c1
715 nmdc:mga06z11_577002_c1
716 nmdc:mga06z11_709740_c1
717 Ga0495601_0197700
718 Ga0495655_0013214
719 Ga0495655_0157698
720 Ga0495595_0077985
721 Ga0495619_0137512
722 Ga0495619_0387185
723 Ga0500647_0180813
724 Ga0500595_001144
725 Ga0500559_0040661
726 Ga0500559_0089943
727 Ga0500568_0006552
728 Ga0500568_0066075
729 Ga0500573_0030700
730 Ga0500603_004984
731 Ga0500638_106692
732 Ga0500639_070569
733 Ga0500636_0089190
734 Ga0500636_0123808
735 Ga0500637_0103187
736 Ga0500596_055796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

5

153

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.823 6 149
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.7628 7 149
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.7617 6 149
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.7474 7 149
4yjw-assembly1.cif.gz_A crystal structure of a duf3829 family protein (bvu_3067) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.7165 79 149
ID Description Score Start End Superfamily
af_K7LU78_450_565_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8392 80 152 1.20.58.390
af_Q9M109_490_601_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8306 75 152 1.20.58.390
af_Q4PIV2_6_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8202 81 154 1.20.140.150
af_A0A0P0Y0S8_693_805_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.784 78 149 1.10.287.70
af_P26039_1846_1970_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7667 11 144 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A847ZVG7-F1-model_v4 DUF2269 family protein 0.9827 77 155 GO:0016020
AF-A0A847ZVG7-F1-model_v4 DUF2269 family protein 0.9707 77 155 GO:0016020
AF-A0A1F8I2W7-F1-model_v4 deleted 0.9702 23 154
AF-A0A143ZNN8-F1-model_v4 Uncharacterized membrane protein 0.97 4 154 GO:0016020
AF-X6G4R9-F1-model_v4 Membrane protein 0.9696 2 154 GO:0016020

Map