F424546

General Info

Members Datasets Scaffolds Average Seq Length
367 233 734 152

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876813996
Length 165
Sequence PHVTVFTDGACSGNPGPGGWGAILRFGDKEKELKGGEAHTTNNRMELMAAISALEALKRPCVVDLTTDSQYVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEKKPVKNVELWQRLDAALKPHQVRWHWIKGHAGHAENERADQLARDGIAMARLQERVGK

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
105 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
223 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
224 2643221734 Bosea sp. Root670 Isolate Unclassified
225 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
226 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
227 2818991467 Bosea vestrisii 3192 Isolate Unclassified
228 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
229 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
230 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
231 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
232 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
233 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.64
Metatranscriptomes 1.09
Isolates 3.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 10.9
Nodule 1.09
Rhizoplane 6.81
Rhizosphere 67.03
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000018 3300003187 Bacteria 238438
2 JGI25151J46595_10000812 3300003187 Bacteria 24940
3 JGI25406J46586_10000159 3300003203 Bacteria 30172
4 Ga0055526_1000362 3300003771 Bacteria 36713
5 Ga0055526_1000571 3300003771 Bacteria 29048
6 Ga0055524_1000048 3300003775 Bacteria 149598
7 Ga0070658_10199043 3300005327 Bacteria 1690
8 Ga0070683_100215680 3300005329 Bacteria 1823
9 Ga0070683_101413076 3300005329 Bacteria 669
10 Ga0070670_100010763 3300005331 Bacteria 7815
11 Ga0070682_100021607 3300005337 Bacteria 3801
12 Ga0068868_100055547 3300005338 Bacteria 3125
13 Ga0068868_100841423 3300005338 Bacteria 830
14 Ga0070660_100117054 3300005339 Bacteria 2125
15 Ga0070671_100608041 3300005355 Bacteria 945
16 Ga0070673_100947233 3300005364 Bacteria 800
17 Ga0070713_100157453 3300005436 Bacteria 2025
18 Ga0070700_100665156 3300005441 Bacteria 824
19 Ga0070663_100040222 3300005455 Bacteria 3272
20 Ga0070663_100221148 3300005455 Bacteria 1487
21 Ga0070678_100030346 3300005456 Bacteria 3716
22 Ga0070684_100251586 3300005535 Bacteria 1615
23 Ga0070672_100164426 3300005543 Bacteria 1843
24 Ga0070693_100235073 3300005547 Bacteria 1208
25 Ga0070693_100544587 3300005547 Bacteria 830
26 Ga0070693_100912306 3300005547 Bacteria 659
27 Ga0070665_100297778 3300005548 Bacteria 1615
28 Ga0070664_100039607 3300005564 Bacteria 3971
29 Ga0068857_100077706 3300005577 Bacteria 2962
30 Ga0068856_100430872 3300005614 Bacteria 1339
31 Ga0068863_100064143 3300005841 Bacteria 3474
32 Ga0068860_100284233 3300005843 Bacteria 1617
33 Ga0081455_10016179 3300005937 Bacteria 7211
34 Ga0081539_10000040 3300005985 Bacteria 292753
35 Ga0075363_100126211 3300006048 Bacteria 1433
36 Ga0075369_10138149 3300006186 Bacteria 1110
37 Ga0097621_100395420 3300006237 Bacteria 1237
38 Ga0068871_100194373 3300006358 Bacteria 1749
39 Ga0068865_100100580 3300006881 Bacteria 2116
40 Ga0068865_100587592 3300006881 Bacteria 940
41 Ga0075435_100266814 3300007076 Bacteria 1459
42 Ga0099794_10081872 3300007265 Bacteria 1593
43 Ga0105245_10202833 3300009098 Bacteria 1905
44 Ga0105248_10215317 3300009177 Bacteria 2164
45 Ga0105238_10009338 3300009551 Bacteria 9821
46 Ga0105238_10328138 3300009551 Bacteria 1517
47 Ga0105238_10658077 3300009551 Bacteria 1058
48 Ga0105238_10666856 3300009551 Bacteria 1051
49 Ga0105238_11271245 3300009551 Bacteria 761
50 Ga0105239_10053992 3300010375 Bacteria 4406
51 Ga0105246_10027306 3300011119 Bacteria 3739
52 Ga0157370_10557550 3300013104 Bacteria 1050
53 Ga0171462_1009 3300013250 Bacteria 344993
54 Ga0157374_10139206 3300013296 Bacteria 2355
55 Ga0157378_10864630 3300013297 Bacteria 933
56 Ga0157372_10296035 3300013307 Bacteria 1882
57 Ga0157372_10743580 3300013307 Bacteria 1140
58 Ga0157375_10069452 3300013308 Bacteria 3529
59 Ga0163163_10077532 3300014325 Bacteria 3318
60 Ga0157379_10106587 3300014968 Bacteria 2515
61 Ga0157376_10100874 3300014969 Bacteria 2521
62 Ga0157376_11974003 3300014969 Bacteria 621
63 Ga0213872_10059935 3300021361 Bacteria 1722
64 Ga0213872_10302536 3300021361 Bacteria 664
65 Ga0213876_10002427 3300021384 Bacteria 10962
66 Ga0213876_10164658 3300021384 Bacteria 1180
67 Ga0209677_100307 3300025253 Bacteria 32029
68 Ga0209148_1018535 3300025254 Bacteria 1167
69 Ga0209148_1036942 3300025254 Bacteria 695
70 Ga0209233_1004884 3300025261 Bacteria 4510
71 Ga0209455_1002991 3300025272 Bacteria 6210
72 Ga0209673_1016942 3300025273 Bacteria 2704
73 Ga0209675_1000462 3300025291 Bacteria 31165
74 Ga0209025_1000010 3300025294 Bacteria 986612
75 Ga0209025_1048992 3300025294 Bacteria 1706
76 Ga0209564_1000019 3300025295 Bacteria 573686
77 Ga0209564_1000034 3300025295 Bacteria 444284
78 Ga0209564_1000687 3300025295 Bacteria 49778
79 Ga0209758_1016374 3300025297 Bacteria 3771
80 Ga0209256_1000026 3300025299 Bacteria 432835
81 Ga0209256_1000232 3300025299 Bacteria 99687
82 Ga0207697_10196642 3300025315 Bacteria 886
83 Ga0207656_10202503 3300025321 Bacteria 959
84 Ga0207685_10023643 3300025905 Bacteria 2095
85 Ga0207699_10100782 3300025906 Bacteria 1832
86 Ga0207643_10536505 3300025908 Bacteria 750
87 Ga0207693_10000613 3300025915 Bacteria 31929
88 Ga0207663_10000432 3300025916 Bacteria 18236
89 Ga0207694_10188644 3300025924 Bacteria 1674
90 Ga0207659_10298684 3300025926 Bacteria 1322
91 Ga0207687_10149477 3300025927 Bacteria 1781
92 Ga0207700_10131452 3300025928 Bacteria 2044
93 Ga0207664_10015540 3300025929 Bacteria 5529
94 Ga0207644_10231223 3300025931 Bacteria 1469
95 Ga0207704_10332426 3300025938 Bacteria 1176
96 Ga0207711_10421408 3300025941 Bacteria 1242
97 Ga0207661_10283881 3300025944 Bacteria 1480
98 Ga0207679_10146359 3300025945 Bacteria 1917
99 Ga0207679_10158262 3300025945 Bacteria 1852
100 Ga0207677_10040152 3300026023 Bacteria 3083
101 Ga0207678_10024687 3300026067 Bacteria 5249
102 Ga0207678_10176423 3300026067 Bacteria 1824
103 Ga0207678_10401775 3300026067 Bacteria 1186
104 Ga0207702_11954674 3300026078 Bacteria 577
105 Ga0207641_10050522 3300026088 Bacteria 3518
106 Ga0207676_10111268 3300026095 Bacteria 2292
107 Ga0207683_10027699 3300026121 Bacteria 4896
108 Ga0207683_11666097 3300026121 Bacteria 587
109 Ga0207698_10236497 3300026142 Bacteria 1662
110 Ga0268266_10286346 3300028379 Bacteria 1533
111 Ga0307515_10051370 3300028794 Bacteria 6148
112 Ga0307515_10397329 3300028794 Bacteria 1005
113 Ga0265762_1062442 3300030760 Bacteria 768
114 Ga0265763_1021966 3300030763 Bacteria 677
115 Ga0265760_10317176 3300031090 Bacteria 554
116 Ga0265328_10096968 3300031239 Bacteria 1090
117 Ga0265331_10005804 3300031250 Bacteria 7395
118 Ga0265327_10017101 3300031251 Bacteria 4566
119 Ga0265327_10074864 3300031251 Bacteria 1685
120 Ga0265316_10236638 3300031344 Bacteria 1343
121 Ga0265316_10336808 3300031344 Bacteria 1094
122 Ga0307513_10526045 3300031456 Bacteria 897
123 Ga0307516_10005674 3300031730 Bacteria 14816
124 Ga0307516_10025698 3300031730 Bacteria 5992
125 Ga0307405_10510396 3300031731 Bacteria 965
126 Ga0307405_10723532 3300031731 Bacteria 827
127 Ga0307410_11160231 3300031852 Bacteria 672
128 Ga0307412_10242820 3300031911 Bacteria 1394
129 Ga0307416_100151735 3300032002 Bacteria 2126
130 Ga0307411_11232068 3300032005 Bacteria 679
131 Ga0307415_100112561 3300032126 Bacteria 2023
132 Ga0307507_10049267 3300033179 Bacteria 4085
133 Ga0307507_10385458 3300033179 Bacteria 805
134 Ga0307510_10031091 3300033180 Bacteria 6037
135 Ga0307510_10091986 3300033180 Bacteria 2872
136 Ga0307510_10277466 3300033180 Bacteria 1148
137 Ga0373959_0054187 3300034820 Bacteria 873
138 Ga0373929_0134157 3300035085 Bacteria 652
139 Ga0373936_0025081 3300035113 Bacteria 2330
140 Ga0373943_0037165 3300035170 Bacteria 2337
141 Ga0373927_0065606 3300035695 Bacteria 2348
142 Ga0373927_0174630 3300035695 Bacteria 1409
143 Ga0373933_0176247 3300035724 Bacteria 1362
144 Ga0373937_0180458 3300036401 Bacteria 1982
145 Ga0372808_019382 3300036459 Bacteria 977
146 Ga0373925_0265674 3300037068 Bacteria 1379
147 Ga0395900_0336438 3300037418 Bacteria 1486
148 Ga0395898_0691332 3300037466 Bacteria 962
149 Ga0395898_0703172 3300037466 Bacteria 952
150 Ga0436364_1420951 3300037853 Bacteria 899
151 Ga0395901_0071715 3300038443 Bacteria 3610
152 Ga0237816_04727 3300039145 Bacteria 934
153 Ga0436365_0616600 3300039437 Bacteria 2055
154 Ga0436365_1205653 3300039437 Bacteria 619
155 Ga0436360_0064494 3300039438 Bacteria 746
156 Ga0436360_0115571 3300039438 Bacteria 1029
157 Ga0436361_0021389 3300039447 Bacteria 898
158 Ga0436361_0737775 3300039447 Bacteria 678
159 Ga0436361_1183150 3300039447 Bacteria 1180
160 Ga0436363_1105639 3300039450 Bacteria 640
161 Ga0436363_1372737 3300039450 Bacteria 2706
162 Ga0451851_0602418 3300041507 Bacteria 582
163 Ga0466966_0077430 3300044684 Bacteria 2075
164 Ga0466966_0400268 3300044684 Bacteria 825
165 Ga0466968_0377571 3300044735 Bacteria 692
166 Ga0466970_0176294 3300044765 Bacteria 1185
167 Ga0466970_0235038 3300044765 Bacteria 1025
168 Ga0466970_0330118 3300044765 Bacteria 863
169 Ga0466970_0449348 3300044765 Bacteria 739
170 Ga0466970_0640295 3300044765 Bacteria 618
171 Ga0466959_0123461 3300045049 Bacteria 1839
172 Ga0466959_0681434 3300045049 Bacteria 689
173 Ga0466967_0029865 3300045976 Bacteria 4568
174 Ga0495590_0156997 3300046457 Bacteria 826
175 Ga0495651_0224335 3300046462 Bacteria 1298
176 Ga0495650_0048342 3300046471 Bacteria 1774
177 Ga0495639_0462582 3300046475 Bacteria 645
178 Ga0495643_0463647 3300046522 Bacteria 550
179 Ga0495648_0005505 3300046524 Bacteria 10504
180 Ga0495622_0174006 3300046557 Bacteria 967
181 Ga0495667_0051696 3300046559 Bacteria 2710
182 Ga0495625_0097231 3300046660 Bacteria 2027
183 Ga0495588_0002412 3300046674 Bacteria 7999
184 Ga0495657_0188176 3300046675 Bacteria 1263
185 Ga0495657_0810422 3300046675 Bacteria 535
186 Ga0495581_0328398 3300047315 Bacteria 893
187 Ga0495581_0495187 3300047315 Bacteria 711
188 Ga0495672_0055048 3300047320 Bacteria 2322
189 Ga0495681_0092733 3300047470 Bacteria 1331
190 Ga0495686_0045739 3300047472 Bacteria 2769
191 Ga0495615_0055983 3300048090 Bacteria 1028
192 Ga0495626_0053522 3300048091 Bacteria 1857
193 Ga0496100_0092234 3300048903 Bacteria 2069
194 Ga0496100_0192319 3300048903 Bacteria 1482
195 Ga0496101_0065503 3300048904 Bacteria 2649
196 Ga0496102_0001495 3300048905 Bacteria 20650
197 Ga0496102_0893994 3300048905 Bacteria 810
198 Ga0496103_0011220 3300048906 Bacteria 5307
199 Ga0496104_0112521 3300048907 Bacteria 2610
200 Ga0496104_0307578 3300048907 Bacteria 1498
201 Ga0496105_0006903 3300048908 Bacteria 8740
202 Ga0496105_0258296 3300048908 Bacteria 1409
203 Ga0496106_0058615 3300048909 Bacteria 2915
204 Ga0496107_0016179 3300048910 Bacteria 5234
205 Ga0496109_0029074 3300048912 Bacteria 4947
206 Ga0496109_0373363 3300048912 Bacteria 1347
207 Ga0496109_1213736 3300048912 Bacteria 691
208 Ga0496110_0078847 3300048913 Bacteria 2932
209 Ga0496110_0166447 3300048913 Bacteria 1999
210 Ga0496110_1022408 3300048913 Bacteria 734
211 Ga0496111_0019920 3300048914 Bacteria 4666
212 Ga0496111_0484603 3300048914 Bacteria 911
213 Ga0496112_0000244 3300048915 Bacteria 34762
214 Ga0496112_0513957 3300048915 Bacteria 1132
215 Ga0496113_0031772 3300048916 Bacteria 3834
216 Ga0496113_0595044 3300048916 Bacteria 886
217 Ga0496114_0008602 3300048917 Bacteria 8089
218 Ga0496116_0120889 3300048919 Bacteria 1516
219 Ga0496116_0169490 3300048919 Bacteria 1185
220 Ga0496117_0030357 3300048920 Bacteria 4150
221 Ga0496117_0146607 3300048920 Bacteria 1404
222 Ga0496118_0196466 3300048921 Bacteria 1200
223 Ga0496119_0109913 3300048922 Bacteria 1532
224 Ga0496121_0000454 3300048924 Bacteria 80561
225 Ga0496121_0105198 3300048924 Bacteria 2166
226 Ga0496121_0506868 3300048924 Bacteria 765
227 Ga0496122_0038875 3300048925 Bacteria 3803
228 Ga0496122_0087055 3300048925 Bacteria 2147
229 Ga0496122_0206962 3300048925 Bacteria 1141
230 Ga0496123_0056872 3300048926 Bacteria 2551
231 Ga0496123_0114974 3300048926 Bacteria 1528
232 Ga0496123_0173103 3300048926 Bacteria 1136
233 Ga0496124_0407321 3300048927 Bacteria 942
234 Ga0496124_0726982 3300048927 Bacteria 625
235 Ga0496125_0014779 3300048928 Bacteria 7583
236 Ga0496125_0217335 3300048928 Bacteria 1235
237 Ga0496125_0223807 3300048928 Bacteria 1210
238 Ga0496125_0240700 3300048928 Bacteria 1149
239 Ga0496126_0006462 3300048929 Bacteria 13061
240 Ga0496126_0021197 3300048929 Bacteria 6354
241 Ga0496126_0147241 3300048929 Bacteria 2021
242 Ga0496126_0220127 3300048929 Bacteria 1595
243 Ga0496126_0294811 3300048929 Bacteria 1340
244 Ga0496126_0577522 3300048929 Bacteria 888
245 Ga0501031_0000476 3300049568 Bacteria 23367
246 Ga0501031_0006556 3300049568 Bacteria 7591
247 Ga0501031_0111407 3300049568 Bacteria 1787
248 Ga0501032_0003585 3300049569 Bacteria 11823
249 Ga0501032_0029642 3300049569 Bacteria 3753
250 Ga0501032_0100403 3300049569 Bacteria 1917
251 Ga0501033_0000513 3300049570 Bacteria 36373
252 Ga0501033_0001890 3300049570 Bacteria 18221
253 Ga0501033_0035609 3300049570 Bacteria 3732
254 Ga0501033_0107807 3300049570 Bacteria 2029
255 Ga0501033_1028504 3300049570 Bacteria 550
256 Ga0501034_0000181 3300049571 Bacteria 117767
257 Ga0501034_0193268 3300049571 Bacteria 1996
258 Ga0501034_0479660 3300049571 Bacteria 1159
259 Ga0501036_0000671 3300049572 Bacteria 25134
260 Ga0501036_0029385 3300049572 Bacteria 4644
261 Ga0501036_0050046 3300049572 Bacteria 3539
262 Ga0501036_0143686 3300049572 Bacteria 2013
263 Ga0501036_0395239 3300049572 Bacteria 1153
264 Ga0501037_0000059 3300049573 Bacteria 101459
265 Ga0501037_0000635 3300049573 Bacteria 27166
266 Ga0501037_0058401 3300049573 Bacteria 2815
267 Ga0501038_0000143 3300049574 Bacteria 61292
268 Ga0501038_0000377 3300049574 Bacteria 38374
269 Ga0501038_0022648 3300049574 Bacteria 5624
270 Ga0501039_0000069 3300049575 Bacteria 78211
271 Ga0501039_0037108 3300049575 Bacteria 3761
272 Ga0501039_0039196 3300049575 Bacteria 3659
273 Ga0501039_0071499 3300049575 Bacteria 2696
274 Ga0501039_0400127 3300049575 Bacteria 1078
275 Ga0501040_0191273 3300049576 Bacteria 1452
276 Ga0501040_0224575 3300049576 Bacteria 1336
277 Ga0501040_0302723 3300049576 Bacteria 1143
278 Ga0501041_0012868 3300049577 Bacteria 4957
279 Ga0501042_0049765 3300049578 Bacteria 2990
280 Ga0501042_0114640 3300049578 Bacteria 1940
281 Ga0501042_0296718 3300049578 Bacteria 1167
282 Ga0501043_0001151 3300049579 Bacteria 23285
283 Ga0501043_0003652 3300049579 Bacteria 12630
284 Ga0501043_0169696 3300049579 Bacteria 1702
285 Ga0501043_0270611 3300049579 Bacteria 1304
286 Ga0501046_0001007 3300049580 Bacteria 27552
287 Ga0501046_0019331 3300049580 Bacteria 5652
288 Ga0501047_0000149 3300049581 Bacteria 85138
289 Ga0501047_0246767 3300049581 Bacteria 1634
290 Ga0501048_0000128 3300049582 Bacteria 44557
291 Ga0501067_0013724 3300049583 Bacteria 4486
292 Ga0501067_0444348 3300049583 Bacteria 724
293 Ga0501068_0000868 3300049584 Bacteria 15731
294 Ga0501068_0077303 3300049584 Bacteria 2038
295 Ga0501069_0260745 3300049585 Bacteria 1012
296 Ga0501070_0015353 3300049586 Bacteria 6444
297 Ga0501070_0075733 3300049586 Bacteria 2786
298 Ga0501070_0249384 3300049586 Bacteria 1452
299 Ga0501070_0694467 3300049586 Bacteria 805
300 Ga0501071_0109357 3300049587 Bacteria 2042
301 Ga0501072_0001770 3300049588 Bacteria 16063
302 Ga0501072_0032357 3300049588 Bacteria 4096
303 Ga0501072_0178184 3300049588 Bacteria 1695
304 Ga0501072_0386742 3300049588 Bacteria 1110
305 Ga0501073_0000094 3300049589 Bacteria 56659
306 Ga0501073_0075981 3300049589 Bacteria 2338
307 Ga0501073_0464104 3300049589 Bacteria 875
308 Ga0501074_0000281 3300049590 Bacteria 29337
309 Ga0501075_0002322 3300049591 Bacteria 12625
310 Ga0501075_1386458 3300049591 Unclassified 532
311 Ga0501076_0008300 3300049592 Bacteria 7610
312 Ga0501076_0177152 3300049592 Bacteria 1738
313 Ga0501077_0018071 3300049593 Bacteria 4456
314 Ga0501077_0619307 3300049593 Bacteria 695
315 Ga0501079_0002423 3300049741 Bacteria 13539
316 Ga0501079_0056469 3300049741 Bacteria 3029
317 Ga0501080_0000277 3300049742 Bacteria 38616
318 Ga0501080_0029470 3300049742 Bacteria 5110
319 Ga0501080_0209144 3300049742 Bacteria 1788
320 Ga0501081_0015008 3300049743 Bacteria 5112
321 Ga0501083_0213532 3300049744 Bacteria 1258
322 Ga0501035_0006961 3300049822 Bacteria 10560
323 Ga0501035_0049686 3300049822 Bacteria 3758
324 Ga0501044_0000443 3300049823 Bacteria 50672
325 Ga0501044_0023965 3300049823 Bacteria 6485
326 Ga0501044_0077074 3300049823 Bacteria 3381
327 Ga0501044_0306540 3300049823 Bacteria 1515
328 Ga0501045_0013203 3300049824 Bacteria 5826
329 Ga0501045_0116176 3300049824 Bacteria 1985
330 Ga0501045_0255084 3300049824 Bacteria 1305
331 nmdc:mga00v17_225084_c1 3300050491 Bacteria 1215
332 nmdc:mga0yw44_15037_c1 3300050492 Bacteria 4132
333 nmdc:mga0sz30_46456_c1 3300050516 Bacteria 1833
334 Ga0495601_0029339 3300053077 Bacteria 3411
335 Ga0500643_002443 3300053087 Bacteria 9600
336 Ga0500583_0018636 3300053092 Bacteria 2826
337 Ga0500566_0055260 3300053094 Bacteria 2261
338 Ga0500555_005440 3300053103 Bacteria 3610
339 Ga0500572_000044 3300053111 Bacteria 38009
340 Ga0500618_068546 3300053125 Bacteria 796
341 Ga0500642_0153544 3300053130 Bacteria 1080
342 Ga0500559_0000075 3300053136 Bacteria 77303
343 Ga0500559_0000419 3300053136 Bacteria 30438
344 Ga0500590_015186 3300053148 Bacteria 3976
345 Ga0500616_0153704 3300053153 Bacteria 1062
346 Ga0500616_0181700 3300053153 Bacteria 946
347 Ga0500639_020458 3300053163 Bacteria 3493
348 Ga0500636_0012541 3300053177 Bacteria 4968
349 Ga0500596_009128 3300053735 Bacteria 1556
350 Ga0501084_0001874 3300054114 Bacteria 16763
351 Ga0501084_0002378 3300054114 Bacteria 15132
352 Ga0501082_0011631 3300060353 Bacteria 7566
353 Ga0501082_0480738 3300060353 Bacteria 1086
354 Ga0501082_0951640 3300060353 Bacteria 751
355 Ga0530510_0020859 3300061734 Bacteria 4660
356 2876813996 2876808645 Bacteria 8824342
357 2524465469 2524023210 Bacteria 9029266
358 2644733777 2643221734 Bacteria 5365412
359 2753076208 2751185734 Bacteria 8863695
360 2778125101 2775507255 Bacteria 3945731
361 2819716935 2818991467 Bacteria 5893227
362 2893067933 2893066018 Bacteria 6158120
363 2917701549 2917699015 Bacteria 7043791
364 2941534769 2941531003 Bacteria 7653939
365 2984592100 2984592036 Bacteria 3670284
366 8056681533 8056681323 Bacteria 8472857
367 8056974327 8056967851 Bacteria 9038162
368 JGI25151J46595_10000018
369 JGI25151J46595_10000812
370 JGI25406J46586_10000159
371 Ga0055526_1000362
372 Ga0055526_1000571
373 Ga0055524_1000048
374 Ga0070658_10199043
375 Ga0070683_100215680
376 Ga0070683_101413076
377 Ga0070670_100010763
378 Ga0070682_100021607
379 Ga0068868_100055547
380 Ga0068868_100841423
381 Ga0070660_100117054
382 Ga0070671_100608041
383 Ga0070673_100947233
384 Ga0070713_100157453
385 Ga0070700_100665156
386 Ga0070663_100040222
387 Ga0070663_100221148
388 Ga0070678_100030346
389 Ga0070684_100251586
390 Ga0070672_100164426
391 Ga0070693_100235073
392 Ga0070693_100544587
393 Ga0070693_100912306
394 Ga0070665_100297778
395 Ga0070664_100039607
396 Ga0068857_100077706
397 Ga0068856_100430872
398 Ga0068863_100064143
399 Ga0068860_100284233
400 Ga0081455_10016179
401 Ga0081539_10000040
402 Ga0075363_100126211
403 Ga0075369_10138149
404 Ga0097621_100395420
405 Ga0068871_100194373
406 Ga0068865_100100580
407 Ga0068865_100587592
408 Ga0075435_100266814
409 Ga0099794_10081872
410 Ga0105245_10202833
411 Ga0105248_10215317
412 Ga0105238_10009338
413 Ga0105238_10328138
414 Ga0105238_10658077
415 Ga0105238_10666856
416 Ga0105238_11271245
417 Ga0105239_10053992
418 Ga0105246_10027306
419 Ga0157370_10557550
420 Ga0171462_1009
421 Ga0157374_10139206
422 Ga0157378_10864630
423 Ga0157372_10296035
424 Ga0157372_10743580
425 Ga0157375_10069452
426 Ga0163163_10077532
427 Ga0157379_10106587
428 Ga0157376_10100874
429 Ga0157376_11974003
430 Ga0213872_10059935
431 Ga0213872_10302536
432 Ga0213876_10002427
433 Ga0213876_10164658
434 Ga0209677_100307
435 Ga0209148_1018535
436 Ga0209148_1036942
437 Ga0209233_1004884
438 Ga0209455_1002991
439 Ga0209673_1016942
440 Ga0209675_1000462
441 Ga0209025_1000010
442 Ga0209025_1048992
443 Ga0209564_1000019
444 Ga0209564_1000034
445 Ga0209564_1000687
446 Ga0209758_1016374
447 Ga0209256_1000026
448 Ga0209256_1000232
449 Ga0207697_10196642
450 Ga0207656_10202503
451 Ga0207685_10023643
452 Ga0207699_10100782
453 Ga0207643_10536505
454 Ga0207693_10000613
455 Ga0207663_10000432
456 Ga0207694_10188644
457 Ga0207659_10298684
458 Ga0207687_10149477
459 Ga0207700_10131452
460 Ga0207664_10015540
461 Ga0207644_10231223
462 Ga0207704_10332426
463 Ga0207711_10421408
464 Ga0207661_10283881
465 Ga0207679_10146359
466 Ga0207679_10158262
467 Ga0207677_10040152
468 Ga0207678_10024687
469 Ga0207678_10176423
470 Ga0207678_10401775
471 Ga0207702_11954674
472 Ga0207641_10050522
473 Ga0207676_10111268
474 Ga0207683_10027699
475 Ga0207683_11666097
476 Ga0207698_10236497
477 Ga0268266_10286346
478 Ga0307515_10051370
479 Ga0307515_10397329
480 Ga0265762_1062442
481 Ga0265763_1021966
482 Ga0265760_10317176
483 Ga0265328_10096968
484 Ga0265331_10005804
485 Ga0265327_10017101
486 Ga0265327_10074864
487 Ga0265316_10236638
488 Ga0265316_10336808
489 Ga0307513_10526045
490 Ga0307516_10005674
491 Ga0307516_10025698
492 Ga0307405_10510396
493 Ga0307405_10723532
494 Ga0307410_11160231
495 Ga0307412_10242820
496 Ga0307416_100151735
497 Ga0307411_11232068
498 Ga0307415_100112561
499 Ga0307507_10049267
500 Ga0307507_10385458
501 Ga0307510_10031091
502 Ga0307510_10091986
503 Ga0307510_10277466
504 Ga0373959_0054187
505 Ga0373929_0134157
506 Ga0373936_0025081
507 Ga0373943_0037165
508 Ga0373927_0065606
509 Ga0373927_0174630
510 Ga0373933_0176247
511 Ga0373937_0180458
512 Ga0372808_019382
513 Ga0373925_0265674
514 Ga0395900_0336438
515 Ga0395898_0691332
516 Ga0395898_0703172
517 Ga0436364_1420951
518 Ga0395901_0071715
519 Ga0237816_04727
520 Ga0436365_0616600
521 Ga0436365_1205653
522 Ga0436360_0064494
523 Ga0436360_0115571
524 Ga0436361_0021389
525 Ga0436361_0737775
526 Ga0436361_1183150
527 Ga0436363_1105639
528 Ga0436363_1372737
529 Ga0451851_0602418
530 Ga0466966_0077430
531 Ga0466966_0400268
532 Ga0466968_0377571
533 Ga0466970_0176294
534 Ga0466970_0235038
535 Ga0466970_0330118
536 Ga0466970_0449348
537 Ga0466970_0640295
538 Ga0466959_0123461
539 Ga0466959_0681434
540 Ga0466967_0029865
541 Ga0495590_0156997
542 Ga0495651_0224335
543 Ga0495650_0048342
544 Ga0495639_0462582
545 Ga0495643_0463647
546 Ga0495648_0005505
547 Ga0495622_0174006
548 Ga0495667_0051696
549 Ga0495625_0097231
550 Ga0495588_0002412
551 Ga0495657_0188176
552 Ga0495657_0810422
553 Ga0495581_0328398
554 Ga0495581_0495187
555 Ga0495672_0055048
556 Ga0495681_0092733
557 Ga0495686_0045739
558 Ga0495615_0055983
559 Ga0495626_0053522
560 Ga0496100_0092234
561 Ga0496100_0192319
562 Ga0496101_0065503
563 Ga0496102_0001495
564 Ga0496102_0893994
565 Ga0496103_0011220
566 Ga0496104_0112521
567 Ga0496104_0307578
568 Ga0496105_0006903
569 Ga0496105_0258296
570 Ga0496106_0058615
571 Ga0496107_0016179
572 Ga0496109_0029074
573 Ga0496109_0373363
574 Ga0496109_1213736
575 Ga0496110_0078847
576 Ga0496110_0166447
577 Ga0496110_1022408
578 Ga0496111_0019920
579 Ga0496111_0484603
580 Ga0496112_0000244
581 Ga0496112_0513957
582 Ga0496113_0031772
583 Ga0496113_0595044
584 Ga0496114_0008602
585 Ga0496116_0120889
586 Ga0496116_0169490
587 Ga0496117_0030357
588 Ga0496117_0146607
589 Ga0496118_0196466
590 Ga0496119_0109913
591 Ga0496121_0000454
592 Ga0496121_0105198
593 Ga0496121_0506868
594 Ga0496122_0038875
595 Ga0496122_0087055
596 Ga0496122_0206962
597 Ga0496123_0056872
598 Ga0496123_0114974
599 Ga0496123_0173103
600 Ga0496124_0407321
601 Ga0496124_0726982
602 Ga0496125_0014779
603 Ga0496125_0217335
604 Ga0496125_0223807
605 Ga0496125_0240700
606 Ga0496126_0006462
607 Ga0496126_0021197
608 Ga0496126_0147241
609 Ga0496126_0220127
610 Ga0496126_0294811
611 Ga0496126_0577522
612 Ga0501031_0000476
613 Ga0501031_0006556
614 Ga0501031_0111407
615 Ga0501032_0003585
616 Ga0501032_0029642
617 Ga0501032_0100403
618 Ga0501033_0000513
619 Ga0501033_0001890
620 Ga0501033_0035609
621 Ga0501033_0107807
622 Ga0501033_1028504
623 Ga0501034_0000181
624 Ga0501034_0193268
625 Ga0501034_0479660
626 Ga0501036_0000671
627 Ga0501036_0029385
628 Ga0501036_0050046
629 Ga0501036_0143686
630 Ga0501036_0395239
631 Ga0501037_0000059
632 Ga0501037_0000635
633 Ga0501037_0058401
634 Ga0501038_0000143
635 Ga0501038_0000377
636 Ga0501038_0022648
637 Ga0501039_0000069
638 Ga0501039_0037108
639 Ga0501039_0039196
640 Ga0501039_0071499
641 Ga0501039_0400127
642 Ga0501040_0191273
643 Ga0501040_0224575
644 Ga0501040_0302723
645 Ga0501041_0012868
646 Ga0501042_0049765
647 Ga0501042_0114640
648 Ga0501042_0296718
649 Ga0501043_0001151
650 Ga0501043_0003652
651 Ga0501043_0169696
652 Ga0501043_0270611
653 Ga0501046_0001007
654 Ga0501046_0019331
655 Ga0501047_0000149
656 Ga0501047_0246767
657 Ga0501048_0000128
658 Ga0501067_0013724
659 Ga0501067_0444348
660 Ga0501068_0000868
661 Ga0501068_0077303
662 Ga0501069_0260745
663 Ga0501070_0015353
664 Ga0501070_0075733
665 Ga0501070_0249384
666 Ga0501070_0694467
667 Ga0501071_0109357
668 Ga0501072_0001770
669 Ga0501072_0032357
670 Ga0501072_0178184
671 Ga0501072_0386742
672 Ga0501073_0000094
673 Ga0501073_0075981
674 Ga0501073_0464104
675 Ga0501074_0000281
676 Ga0501075_0002322
677 Ga0501075_1386458
678 Ga0501076_0008300
679 Ga0501076_0177152
680 Ga0501077_0018071
681 Ga0501077_0619307
682 Ga0501079_0002423
683 Ga0501079_0056469
684 Ga0501080_0000277
685 Ga0501080_0029470
686 Ga0501080_0209144
687 Ga0501081_0015008
688 Ga0501083_0213532
689 Ga0501035_0006961
690 Ga0501035_0049686
691 Ga0501044_0000443
692 Ga0501044_0023965
693 Ga0501044_0077074
694 Ga0501044_0306540
695 Ga0501045_0013203
696 Ga0501045_0116176
697 Ga0501045_0255084
698 nmdc:mga00v17_225084_c1
699 nmdc:mga0yw44_15037_c1
700 nmdc:mga0sz30_46456_c1
701 Ga0495601_0029339
702 Ga0500643_002443
703 Ga0500583_0018636
704 Ga0500566_0055260
705 Ga0500555_005440
706 Ga0500572_000044
707 Ga0500618_068546
708 Ga0500642_0153544
709 Ga0500559_0000075
710 Ga0500559_0000419
711 Ga0500590_015186
712 Ga0500616_0153704
713 Ga0500616_0181700
714 Ga0500639_020458
715 Ga0500636_0012541
716 Ga0500596_009128
717 Ga0501084_0001874
718 Ga0501084_0002378
719 Ga0501082_0011631
720 Ga0501082_0480738
721 Ga0501082_0951640
722 Ga0530510_0020859
723 2876813996
724 2524465469
725 2644733777
726 2753076208
727 2778125101
728 2819716935
729 2893067933
730 2917701549
731 2941534769
732 2984592100
733 8056681533
734 8056974327

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

1

155

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9746 4 142
1jl2-assembly1.cif.gz_C crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h 0.9708 5 142
7vsa-assembly1.cif.gz_A e. coli ribonuclease hi in complex with two mg2+ 0.9691 4 142
1jl2-assembly1.cif.gz_B crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h 0.9663 5 142
2zqb-assembly1.cif.gz_C crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations 0.9659 5 145
ID Description Score Start End Superfamily
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9708 5 142 3.30.420.10
af_A0A0R0EHL2_85_153_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9637 6 59 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9587 4 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9016 4 146 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8785 5 142 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A381ZS24-F1-model_v4 ribonuclease H (EC 3.1.26.4) 1 4 86 GO:0003676
GO:0004523
GO:0043137
AF-A0A348UQL9-F1-model_v4 Ribonuclease HI 1 6 74 GO:0003676
GO:0004523
AF-A0A3D0XTL9-F1-model_v4 Ribonuclease HI 0.9965 4 66 GO:0003676
GO:0004523
AF-A0A2N3AU90-F1-model_v4 Ribonuclease HI 0.9957 4 85 GO:0003676
GO:0004523
AF-A0A3C2BGT8-F1-model_v4 deleted 0.9938 4 74

Map