F424506

General Info

Members Datasets Scaffolds Average Seq Length
367 148 734 283

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0087937|Ga0501067_0087937_106_1161
Length 351
Sequence VAAFRFVVADVFTDAPLEGNQLAVFTDAREIPAAQLQPLAREINFSETVFVYPPERDGHARIRIFTPVSELPFAGHPVLGTAFVLAAPLQLPEIRLETAKGLVPVALERDGPRIVFGRMQQPIPSVEPFAAGDDLLAALGVESSELPLELYESGVGNVYVLLPDEEAVAAVEPDLAAVARVMGSVHANVTAGSGKRWKTRMFAPGDGVPEDPATGSAAGPLALHLARHGRIAFGEEIAISQGAEIGRPSTLYARVQASPDRVEAVEVGGSAVIVARGEFRLEPRSGMSGVRPRPCPTRTSVRGSSVRRWLQQAEFACRTARSRRGRAPSTTRPKAACPGSDPGRGRIGRGG

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
72 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
86 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.18
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 7.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0087937 3300049583 Bacteria 1724
2 Ga0070658_10029711 3300005327 Bacteria 4392
3 Ga0070658_10474822 3300005327 Bacteria 1079
4 Ga0070660_100017516 3300005339 Bacteria 5224
5 Ga0070688_100151460 3300005365 Bacteria 1586
6 Ga0070667_100023056 3300005367 Bacteria 5164
7 Ga0070678_100448954 3300005456 Bacteria 1129
8 Ga0070684_100058875 3300005535 Bacteria 3358
9 Ga0070684_100087425 3300005535 Bacteria 2768
10 Ga0070696_100138706 3300005546 Unclassified 1775
11 Ga0070696_100182551 3300005546 Bacteria 1557
12 Ga0070693_100003301 3300005547 Bacteria 7496
13 Ga0070664_100147993 3300005564 Bacteria 2072
14 Ga0068857_100025630 3300005577 Bacteria 5191
15 Ga0068856_100195182 3300005614 Unclassified 2038
16 Ga0070702_100149226 3300005615 Unclassified 1498
17 Ga0068864_100061649 3300005618 Unclassified 3249
18 Ga0068862_100337039 3300005844 Bacteria 1396
19 Ga0081455_10010134 3300005937 Bacteria 9603
20 Ga0081455_10025244 3300005937 Bacteria 5490
21 Ga0081455_10054766 3300005937 Bacteria 3397
22 Ga0081455_10261734 3300005937 Bacteria 1259
23 Ga0081538_10000529 3300005981 Bacteria 42265
24 Ga0081538_10000873 3300005981 Bacteria 32578
25 Ga0081538_10001591 3300005981 Bacteria 23294
26 Ga0081538_10005139 3300005981 Bacteria 11864
27 Ga0075432_10021961 3300006058 Bacteria 2182
28 Ga0068871_100483402 3300006358 Unclassified 1114
29 Ga0075428_100063002 3300006844 Bacteria 4059
30 Ga0075428_100086957 3300006844 Bacteria 3410
31 Ga0075428_100113135 3300006844 Bacteria 2957
32 Ga0075428_100132115 3300006844 Unclassified 2715
33 Ga0075431_100279589 3300006847 Bacteria 1690
34 Ga0075433_10091540 3300006852 Bacteria 2689
35 Ga0075433_10224824 3300006852 Bacteria 1667
36 Ga0075429_100169105 3300006880 Bacteria 1915
37 Ga0068865_100162753 3300006881 Bacteria 1704
38 Ga0111539_10003565 3300009094 Bacteria 20519
39 Ga0111539_10005274 3300009094 Bacteria 16732
40 Ga0111539_10031932 3300009094 Bacteria 6397
41 Ga0111539_10127545 3300009094 Bacteria 2980
42 Ga0111539_10452468 3300009094 Bacteria 1495
43 Ga0105245_10091132 3300009098 Unclassified 2805
44 Ga0114129_10073797 3300009147 Bacteria 4753
45 Ga0114129_10120810 3300009147 Bacteria 3607
46 Ga0114129_10203402 3300009147 Bacteria 2681
47 Ga0114129_10216392 3300009147 Bacteria 2587
48 Ga0114129_10528716 3300009147 Bacteria 1537
49 Ga0105243_10095198 3300009148 Unclassified 2461
50 Ga0105249_10042473 3300009553 Bacteria 4135
51 Ga0105239_10239902 3300010375 Bacteria 2035
52 Ga0157369_10011618 3300013105 Bacteria 9999
53 Ga0157369_10295076 3300013105 Bacteria 1687
54 Ga0163162_10155609 3300013306 Bacteria 2406
55 Ga0163163_10519281 3300014325 Bacteria 1253
56 Ga0157377_10016085 3300014745 Bacteria 3842
57 Ga0157379_10125806 3300014968 Bacteria 2306
58 Ga0207688_10013113 3300025901 Bacteria 4506
59 Ga0207645_10044989 3300025907 Unclassified 2823
60 Ga0207643_10025516 3300025908 Bacteria 3267
61 Ga0207693_10238614 3300025915 Bacteria 1427
62 Ga0207662_10015617 3300025918 Bacteria 4274
63 Ga0207657_10029216 3300025919 Bacteria 5020
64 Ga0207706_10101583 3300025933 Bacteria 2530
65 Ga0207706_10251920 3300025933 Bacteria 1542
66 Ga0207691_10078075 3300025940 Bacteria 2981
67 Ga0207689_10046456 3300025942 Bacteria 3589
68 Ga0207661_10025696 3300025944 Bacteria 4480
69 Ga0207667_10572914 3300025949 Bacteria 1140
70 Ga0207640_10111996 3300025981 Unclassified 1936
71 Ga0207640_10281876 3300025981 Unclassified 1306
72 Ga0207658_10015212 3300025986 Bacteria 5278
73 Ga0207677_10289167 3300026023 Bacteria 1349
74 Ga0207703_10269209 3300026035 Bacteria 1543
75 Ga0207708_10004391 3300026075 Bacteria 10392
76 Ga0207708_10143580 3300026075 Bacteria 1874
77 Ga0207674_10001155 3300026116 Bacteria 34231
78 Ga0207674_10021319 3300026116 Bacteria 6982
79 Ga0207675_100014214 3300026118 Bacteria 7423
80 Ga0207675_100240590 3300026118 Bacteria 1749
81 Ga0207683_10184565 3300026121 Bacteria 1892
82 Ga0207428_10037284 3300027907 Bacteria 3956
83 Ga0268265_10485039 3300028380 Bacteria 1162
84 Ga0307405_10224357 3300031731 Unclassified 1381
85 Ga0307410_10053262 3300031852 Bacteria 2737
86 Ga0307410_10511903 3300031852 Unclassified 989
87 Ga0307406_10016218 3300031901 Bacteria 4325
88 Ga0307407_10005320 3300031903 Bacteria 5572
89 Ga0307412_10116419 3300031911 Unclassified 1917
90 Ga0307409_100040844 3300031995 Unclassified 3458
91 Ga0307416_100001962 3300032002 Bacteria 11524
92 Ga0307416_100006089 3300032002 Bacteria 7510
93 Ga0307414_10144177 3300032004 Unclassified 1869
94 Ga0307415_100021491 3300032126 Bacteria 3967
95 Ga0307415_100178338 3300032126 Bacteria 1664
96 Ga0307415_100332024 3300032126 Bacteria 1273
97 Ga0395899_0151819 3300037312 Bacteria 1641
98 Ga0395900_0012221 3300037418 Bacteria 8778
99 Ga0395900_0039963 3300037418 Bacteria 4834
100 Ga0395900_0113909 3300037418 Bacteria 2775
101 Ga0395900_0127420 3300037418 Bacteria 2610
102 Ga0395900_0318353 3300037418 Bacteria 1536
103 Ga0395900_0419946 3300037418 Bacteria 1298
104 Ga0395900_0435903 3300037418 Unclassified 1269
105 Ga0395900_0606577 3300037418 Bacteria 1035
106 Ga0395898_0005135 3300037466 Bacteria 14165
107 Ga0395898_0014552 3300037466 Bacteria 8081
108 Ga0395898_0047335 3300037466 Bacteria 4220
109 Ga0395898_0106067 3300037466 Bacteria 2695
110 Ga0395898_0124456 3300037466 Bacteria 2470
111 Ga0395898_0125777 3300037466 Bacteria 2456
112 Ga0395905_0063559 3300037471 Bacteria 3453
113 Ga0395905_0066086 3300037471 Bacteria 3386
114 Ga0395905_0182128 3300037471 Bacteria 1972
115 Ga0395905_0207850 3300037471 Bacteria 1834
116 Ga0395905_0224148 3300037471 Bacteria 1759
117 Ga0395905_0265449 3300037471 Bacteria 1602
118 Ga0395901_0000500 3300038443 Bacteria 45375
119 Ga0395901_0022940 3300038443 Bacteria 6398
120 Ga0395901_0029453 3300038443 Bacteria 5654
121 Ga0395901_0119886 3300038443 Bacteria 2764
122 Ga0395901_0133067 3300038443 Bacteria 2613
123 Ga0395901_0214918 3300038443 Bacteria 2011
124 Ga0439439_0000098 3300041406 Bacteria 11492
125 Ga0439446_0017392 3300042156 Bacteria 2009
126 Ga0451577_0006349 3300042876 Bacteria 11806
127 Ga0439440_0055169 3300042993 Bacteria 1002
128 Ga0453683_0012855 3300044673 Bacteria 5479
129 Ga0466966_0037275 3300044684 Bacteria 3136
130 Ga0466963_0034748 3300044694 Bacteria 3281
131 Ga0453684_0000673 3300044712 Bacteria 122532
132 Ga0453684_0020227 3300044712 Bacteria 10061
133 Ga0453684_0251342 3300044712 Bacteria 2030
134 Ga0466959_0047968 3300045049 Bacteria 3140
135 Ga0451576_0025961 3300045051 Bacteria 6306
136 Ga0451576_0213304 3300045051 Bacteria 2016
137 Ga0466958_0010066 3300045836 Bacteria 5286
138 Ga0466967_0148446 3300045976 Bacteria 2189
139 Ga0466967_0200036 3300045976 Bacteria 1892
140 Ga0466967_0243747 3300045976 Bacteria 1715
141 Ga0466967_0334410 3300045976 Bacteria 1463
142 Ga0495582_0167595 3300046473 Unclassified 1250
143 Ga0495584_0143230 3300046491 Bacteria 1214
144 Ga0495584_0158128 3300046491 Bacteria 1152
145 Ga0495644_0041971 3300046523 Bacteria 1723
146 Ga0495663_0016626 3300046525 Bacteria 2080
147 Ga0495642_0031698 3300046528 Bacteria 2120
148 Ga0495586_0094502 3300046535 Unclassified 1654
149 Ga0495668_0230105 3300046616 Unclassified 1015
150 Ga0495647_0027259 3300046681 Bacteria 2099
151 Ga0495636_0021086 3300047318 Bacteria 2629
152 Ga0495676_0032990 3300047321 Bacteria 4365
153 Ga0496100_0158857 3300048903 Bacteria 1619
154 Ga0496101_0463980 3300048904 Unclassified 999
155 Ga0496102_0346042 3300048905 Bacteria 1400
156 Ga0496102_0384265 3300048905 Bacteria 1321
157 Ga0496103_0080582 3300048906 Unclassified 2047
158 Ga0496103_0297203 3300048906 Bacteria 1039
159 Ga0496104_0068532 3300048907 Bacteria 3371
160 Ga0496108_0015793 3300048911 Bacteria 6155
161 Ga0496109_0006271 3300048912 Bacteria 10004
162 Ga0496109_0187079 3300048912 Bacteria 1946
163 Ga0496110_0002882 3300048913 Bacteria 13000
164 Ga0496110_0014681 3300048913 Bacteria 6510
165 Ga0496111_0001978 3300048914 Bacteria 12176
166 Ga0496111_0008042 3300048914 Bacteria 6958
167 Ga0496112_0033029 3300048915 Bacteria 5026
168 Ga0496112_0686394 3300048915 Bacteria 952
169 Ga0496113_0152404 3300048916 Bacteria 1824
170 Ga0496113_0202773 3300048916 Bacteria 1577
171 Ga0496114_0066557 3300048917 Bacteria 3021
172 Ga0501031_0000822 3300049568 Bacteria 18682
173 Ga0501031_0020939 3300049568 Bacteria 4263
174 Ga0501031_0091401 3300049568 Bacteria 1985
175 Ga0501032_0004405 3300049569 Bacteria 10630
176 Ga0501032_0090133 3300049569 Bacteria 2035
177 Ga0501032_0265463 3300049569 Bacteria 1113
178 Ga0501033_0000862 3300049570 Bacteria 27744
179 Ga0501033_0004506 3300049570 Bacteria 11149
180 Ga0501033_0253235 3300049570 Bacteria 1247
181 Ga0501034_0307612 3300049571 Bacteria 1520
182 Ga0501036_0000938 3300049572 Bacteria 21916
183 Ga0501036_0002504 3300049572 Bacteria 14413
184 Ga0501036_0057292 3300049572 Bacteria 3300
185 Ga0501036_0149663 3300049572 Bacteria 1969
186 Ga0501036_0184009 3300049572 Bacteria 1758
187 Ga0501036_0331485 3300049572 Bacteria 1271
188 Ga0501036_0386725 3300049572 Unclassified 1167
189 Ga0501037_0003441 3300049573 Bacteria 11505
190 Ga0501037_0055519 3300049573 Bacteria 2895
191 Ga0501037_0066449 3300049573 Bacteria 2627
192 Ga0501037_0107413 3300049573 Bacteria 2011
193 Ga0501038_0000933 3300049574 Bacteria 26040
194 Ga0501038_0011780 3300049574 Bacteria 7978
195 Ga0501038_0161396 3300049574 Bacteria 1821
196 Ga0501038_0288478 3300049574 Bacteria 1290
197 Ga0501039_0001194 3300049575 Bacteria 19045
198 Ga0501039_0003186 3300049575 Bacteria 12272
199 Ga0501039_0029132 3300049575 Bacteria 4252
200 Ga0501039_0065485 3300049575 Bacteria 2819
201 Ga0501039_0134558 3300049575 Bacteria 1940
202 Ga0501040_0003033 3300049576 Bacteria 10888
203 Ga0501040_0007085 3300049576 Bacteria 7265
204 Ga0501040_0007621 3300049576 Bacteria 7006
205 Ga0501040_0020385 3300049576 Bacteria 4417
206 Ga0501040_0116780 3300049576 Unclassified 1869
207 Ga0501040_0129109 3300049576 Bacteria 1776
208 Ga0501040_0150198 3300049576 Bacteria 1644
209 Ga0501041_0000112 3300049577 Bacteria 34048
210 Ga0501041_0001177 3300049577 Bacteria 14243
211 Ga0501041_0018458 3300049577 Bacteria 4155
212 Ga0501041_0155526 3300049577 Bacteria 1428
213 Ga0501042_0000669 3300049578 Bacteria 18447
214 Ga0501042_0000761 3300049578 Bacteria 17537
215 Ga0501042_0007896 3300049578 Bacteria 6999
216 Ga0501042_0057447 3300049578 Bacteria 2776
217 Ga0501042_0080870 3300049578 Bacteria 2328
218 Ga0501042_0099349 3300049578 Bacteria 2092
219 Ga0501042_0137937 3300049578 Bacteria 1758
220 Ga0501042_0245972 3300049578 Bacteria 1291
221 Ga0501043_0096283 3300049579 Bacteria 2326
222 Ga0501043_0522933 3300049579 Bacteria 884
223 Ga0501046_0007241 3300049580 Bacteria 9754
224 Ga0501046_0008844 3300049580 Bacteria 8746
225 Ga0501046_0042414 3300049580 Bacteria 3628
226 Ga0501046_0076236 3300049580 Bacteria 2598
227 Ga0501046_0450829 3300049580 Bacteria 925
228 Ga0501047_0000244 3300049581 Bacteria 64596
229 Ga0501047_0042602 3300049581 Bacteria 4386
230 Ga0501047_0412347 3300049581 Bacteria 1183
231 Ga0501048_0000223 3300049582 Bacteria 37247
232 Ga0501048_0003416 3300049582 Bacteria 12069
233 Ga0501048_0016119 3300049582 Bacteria 5510
234 Ga0501048_0032928 3300049582 Bacteria 3745
235 Ga0501048_0038134 3300049582 Bacteria 3450
236 Ga0501048_0049604 3300049582 Bacteria 2991
237 Ga0501048_0094534 3300049582 Bacteria 2108
238 Ga0501048_0102369 3300049582 Bacteria 2021
239 Ga0501067_0007471 3300049583 Bacteria 6072
240 Ga0501068_0000806 3300049584 Bacteria 16281
241 Ga0501068_0008719 3300049584 Bacteria 5655
242 Ga0501068_0013714 3300049584 Bacteria 4615
243 Ga0501068_0082115 3300049584 Bacteria 1979
244 Ga0501068_0293430 3300049584 Bacteria 1040
245 Ga0501069_0000303 3300049585 Bacteria 22395
246 Ga0501069_0016153 3300049585 Bacteria 4005
247 Ga0501070_0028555 3300049586 Bacteria 4679
248 Ga0501071_0000001 3300049587 Bacteria 123952
249 Ga0501071_0001819 3300049587 Bacteria 12630
250 Ga0501071_0019547 3300049587 Bacteria 4700
251 Ga0501071_0021501 3300049587 Bacteria 4494
252 Ga0501071_0041501 3300049587 Bacteria 3295
253 Ga0501071_0088978 3300049587 Bacteria 2265
254 Ga0501071_0218859 3300049587 Bacteria 1433
255 Ga0501072_0000550 3300049588 Bacteria 26960
256 Ga0501072_0004877 3300049588 Bacteria 10204
257 Ga0501072_0051300 3300049588 Bacteria 3248
258 Ga0501072_0072003 3300049588 Bacteria 2731
259 Ga0501072_0216231 3300049588 Bacteria 1527
260 Ga0501072_0305019 3300049588 Bacteria 1266
261 Ga0501072_0316794 3300049588 Bacteria 1239
262 Ga0501073_0001194 3300049589 Bacteria 18908
263 Ga0501073_0044131 3300049589 Bacteria 3141
264 Ga0501074_0001650 3300049590 Bacteria 15137
265 Ga0501074_0003289 3300049590 Bacteria 11432
266 Ga0501074_0036105 3300049590 Bacteria 3581
267 Ga0501074_0133395 3300049590 Unclassified 1776
268 Ga0501074_0211901 3300049590 Bacteria 1380
269 Ga0501075_0001018 3300049591 Bacteria 17943
270 Ga0501075_0013723 3300049591 Bacteria 5789
271 Ga0501075_0031578 3300049591 Bacteria 3932
272 Ga0501075_0056478 3300049591 Bacteria 2955
273 Ga0501075_0071168 3300049591 Bacteria 2628
274 Ga0501075_0146509 3300049591 Bacteria 1799
275 Ga0501075_0321360 3300049591 Bacteria 1179
276 Ga0501076_0000523 3300049592 Bacteria 24385
277 Ga0501076_0001338 3300049592 Bacteria 16485
278 Ga0501076_0001844 3300049592 Bacteria 14412
279 Ga0501076_0019579 3300049592 Bacteria 5174
280 Ga0501076_0054888 3300049592 Bacteria 3158
281 Ga0501076_0106387 3300049592 Unclassified 2264
282 Ga0501076_0163436 3300049592 Bacteria 1814
283 Ga0501076_0222914 3300049592 Bacteria 1541
284 Ga0501077_0000028 3300049593 Bacteria 74757
285 Ga0501077_0002492 3300049593 Bacteria 11025
286 Ga0501077_0032382 3300049593 Bacteria 3327
287 Ga0501077_0087483 3300049593 Bacteria 1975
288 Ga0501077_0093894 3300049593 Bacteria 1901
289 Ga0501077_0210679 3300049593 Bacteria 1235
290 Ga0501077_0236564 3300049593 Bacteria 1161
291 Ga0501079_0000387 3300049741 Bacteria 28343
292 Ga0501079_0003107 3300049741 Bacteria 12165
293 Ga0501079_0035845 3300049741 Bacteria 3819
294 Ga0501079_0088254 3300049741 Bacteria 2401
295 Ga0501079_0167471 3300049741 Bacteria 1713
296 Ga0501080_0000196 3300049742 Bacteria 44194
297 Ga0501080_0001311 3300049742 Bacteria 20737
298 Ga0501080_0006550 3300049742 Bacteria 10467
299 Ga0501080_0088597 3300049742 Bacteria 2875
300 Ga0501080_0124254 3300049742 Bacteria 2390
301 Ga0501081_0000043 3300049743 Bacteria 47758
302 Ga0501081_0000474 3300049743 Bacteria 22314
303 Ga0501081_0002900 3300049743 Bacteria 10874
304 Ga0501081_0007399 3300049743 Bacteria 7127
305 Ga0501081_0105858 3300049743 Bacteria 1993
306 Ga0501081_0133753 3300049743 Bacteria 1773
307 Ga0501081_0141298 3300049743 Unclassified 1725
308 Ga0501081_0474387 3300049743 Bacteria 931
309 Ga0501083_0000412 3300049744 Bacteria 27299
310 Ga0501083_0063132 3300049744 Unclassified 2471
311 Ga0501083_0090415 3300049744 Bacteria 2022
312 Ga0501083_0111355 3300049744 Bacteria 1799
313 Ga0501083_0318552 3300049744 Bacteria 1011
314 Ga0501083_0370656 3300049744 Bacteria 931
315 Ga0501035_0001272 3300049822 Bacteria 26065
316 Ga0501035_0010754 3300049822 Bacteria 8472
317 Ga0501044_0031881 3300049823 Bacteria 5543
318 Ga0501044_0425496 3300049823 Bacteria 1237
319 Ga0501045_0000861 3300049824 Bacteria 19727
320 Ga0501045_0002409 3300049824 Bacteria 12710
321 Ga0501045_0028669 3300049824 Bacteria 4017
322 Ga0501045_0069431 3300049824 Bacteria 2590
323 Ga0501045_0215270 3300049824 Bacteria 1430
324 nmdc:mga05p37_20661_c1 3300050507 Bacteria 7967
325 nmdc:mga05p37_593120_c1 3300050507 Bacteria 1252
326 nmdc:mga05p37_90_c1 3300050507 Bacteria 81115
327 nmdc:mga05p37_92967_c1 3300050507 Bacteria 3716
328 nmdc:mga09592_213979_c1 3300050508 Bacteria 1670
329 nmdc:mga09592_40085_c1 3300050508 Bacteria 3935
330 nmdc:mga0qj67_52668_c1 3300050509 Bacteria 3221
331 nmdc:mga06r32_27200_c1 3300050510 Bacteria 5340
332 nmdc:mga08y16_12163_c1 3300050511 Bacteria 9047
333 nmdc:mga08y16_203654_c1 3300050511 Bacteria 2050
334 nmdc:mga08y16_216610_c1 3300050511 Bacteria 1983
335 nmdc:mga08y16_240216_c1 3300050511 Bacteria 1872
336 nmdc:mga08y16_250707_c1 3300050511 Bacteria 1829
337 nmdc:mga0n895_77846_c1 3300050512 Bacteria 3299
338 nmdc:mga0a205_101872_c1 3300050515 Bacteria 2303
339 nmdc:mga0a205_106569_c1 3300050515 Bacteria 2700
340 nmdc:mga0a205_133929_c1 3300050515 Bacteria 2378
341 Ga0495655_0019564 3300053083 Unclassified 1505
342 Ga0501084_0000118 3300054114 Bacteria 60290
343 Ga0501084_0005523 3300054114 Bacteria 10379
344 Ga0501084_0011564 3300054114 Bacteria 7307
345 Ga0501084_0018321 3300054114 Bacteria 5830
346 Ga0501084_0028029 3300054114 Bacteria 4706
347 Ga0501084_0032085 3300054114 Bacteria 4393
348 Ga0501084_0033612 3300054114 Bacteria 4290
349 Ga0501084_0039873 3300054114 Bacteria 3927
350 Ga0501084_0097344 3300054114 Bacteria 2470
351 Ga0590075_019121 3300059424 Bacteria 1698
352 Ga0501082_0000585 3300060353 Bacteria 32305
353 Ga0501082_0000720 3300060353 Bacteria 29137
354 Ga0501082_0014712 3300060353 Bacteria 6739
355 Ga0501082_0067157 3300060353 Bacteria 3088
356 Ga0501082_0185596 3300060353 Bacteria 1809
357 Ga0501082_0215962 3300060353 Bacteria 1668
358 Ga0501082_0560874 3300060353 Bacteria 999
359 Ga0530510_0000507 3300061734 Bacteria 24742
360 Ga0530510_0000855 3300061734 Bacteria 20092
361 Ga0530510_0007107 3300061734 Bacteria 7792
362 Ga0530510_0029677 3300061734 Bacteria 3926
363 Ga0530510_0050002 3300061734 Bacteria 3019
364 Ga0530510_0074206 3300061734 Bacteria 2470
365 Ga0530510_0083502 3300061734 Bacteria 2326
366 Ga0530510_0091159 3300061734 Bacteria 2224
367 Ga0530510_0098409 3300061734 Bacteria 2139
368 Ga0501067_0087937
369 Ga0070658_10029711
370 Ga0070658_10474822
371 Ga0070660_100017516
372 Ga0070688_100151460
373 Ga0070667_100023056
374 Ga0070678_100448954
375 Ga0070684_100058875
376 Ga0070684_100087425
377 Ga0070696_100138706
378 Ga0070696_100182551
379 Ga0070693_100003301
380 Ga0070664_100147993
381 Ga0068857_100025630
382 Ga0068856_100195182
383 Ga0070702_100149226
384 Ga0068864_100061649
385 Ga0068862_100337039
386 Ga0081455_10010134
387 Ga0081455_10025244
388 Ga0081455_10054766
389 Ga0081455_10261734
390 Ga0081538_10000529
391 Ga0081538_10000873
392 Ga0081538_10001591
393 Ga0081538_10005139
394 Ga0075432_10021961
395 Ga0068871_100483402
396 Ga0075428_100063002
397 Ga0075428_100086957
398 Ga0075428_100113135
399 Ga0075428_100132115
400 Ga0075431_100279589
401 Ga0075433_10091540
402 Ga0075433_10224824
403 Ga0075429_100169105
404 Ga0068865_100162753
405 Ga0111539_10003565
406 Ga0111539_10005274
407 Ga0111539_10031932
408 Ga0111539_10127545
409 Ga0111539_10452468
410 Ga0105245_10091132
411 Ga0114129_10073797
412 Ga0114129_10120810
413 Ga0114129_10203402
414 Ga0114129_10216392
415 Ga0114129_10528716
416 Ga0105243_10095198
417 Ga0105249_10042473
418 Ga0105239_10239902
419 Ga0157369_10011618
420 Ga0157369_10295076
421 Ga0163162_10155609
422 Ga0163163_10519281
423 Ga0157377_10016085
424 Ga0157379_10125806
425 Ga0207688_10013113
426 Ga0207645_10044989
427 Ga0207643_10025516
428 Ga0207693_10238614
429 Ga0207662_10015617
430 Ga0207657_10029216
431 Ga0207706_10101583
432 Ga0207706_10251920
433 Ga0207691_10078075
434 Ga0207689_10046456
435 Ga0207661_10025696
436 Ga0207667_10572914
437 Ga0207640_10111996
438 Ga0207640_10281876
439 Ga0207658_10015212
440 Ga0207677_10289167
441 Ga0207703_10269209
442 Ga0207708_10004391
443 Ga0207708_10143580
444 Ga0207674_10001155
445 Ga0207674_10021319
446 Ga0207675_100014214
447 Ga0207675_100240590
448 Ga0207683_10184565
449 Ga0207428_10037284
450 Ga0268265_10485039
451 Ga0307405_10224357
452 Ga0307410_10053262
453 Ga0307410_10511903
454 Ga0307406_10016218
455 Ga0307407_10005320
456 Ga0307412_10116419
457 Ga0307409_100040844
458 Ga0307416_100001962
459 Ga0307416_100006089
460 Ga0307414_10144177
461 Ga0307415_100021491
462 Ga0307415_100178338
463 Ga0307415_100332024
464 Ga0395899_0151819
465 Ga0395900_0012221
466 Ga0395900_0039963
467 Ga0395900_0113909
468 Ga0395900_0127420
469 Ga0395900_0318353
470 Ga0395900_0419946
471 Ga0395900_0435903
472 Ga0395900_0606577
473 Ga0395898_0005135
474 Ga0395898_0014552
475 Ga0395898_0047335
476 Ga0395898_0106067
477 Ga0395898_0124456
478 Ga0395898_0125777
479 Ga0395905_0063559
480 Ga0395905_0066086
481 Ga0395905_0182128
482 Ga0395905_0207850
483 Ga0395905_0224148
484 Ga0395905_0265449
485 Ga0395901_0000500
486 Ga0395901_0022940
487 Ga0395901_0029453
488 Ga0395901_0119886
489 Ga0395901_0133067
490 Ga0395901_0214918
491 Ga0439439_0000098
492 Ga0439446_0017392
493 Ga0451577_0006349
494 Ga0439440_0055169
495 Ga0453683_0012855
496 Ga0466966_0037275
497 Ga0466963_0034748
498 Ga0453684_0000673
499 Ga0453684_0020227
500 Ga0453684_0251342
501 Ga0466959_0047968
502 Ga0451576_0025961
503 Ga0451576_0213304
504 Ga0466958_0010066
505 Ga0466967_0148446
506 Ga0466967_0200036
507 Ga0466967_0243747
508 Ga0466967_0334410
509 Ga0495582_0167595
510 Ga0495584_0143230
511 Ga0495584_0158128
512 Ga0495644_0041971
513 Ga0495663_0016626
514 Ga0495642_0031698
515 Ga0495586_0094502
516 Ga0495668_0230105
517 Ga0495647_0027259
518 Ga0495636_0021086
519 Ga0495676_0032990
520 Ga0496100_0158857
521 Ga0496101_0463980
522 Ga0496102_0346042
523 Ga0496102_0384265
524 Ga0496103_0080582
525 Ga0496103_0297203
526 Ga0496104_0068532
527 Ga0496108_0015793
528 Ga0496109_0006271
529 Ga0496109_0187079
530 Ga0496110_0002882
531 Ga0496110_0014681
532 Ga0496111_0001978
533 Ga0496111_0008042
534 Ga0496112_0033029
535 Ga0496112_0686394
536 Ga0496113_0152404
537 Ga0496113_0202773
538 Ga0496114_0066557
539 Ga0501031_0000822
540 Ga0501031_0020939
541 Ga0501031_0091401
542 Ga0501032_0004405
543 Ga0501032_0090133
544 Ga0501032_0265463
545 Ga0501033_0000862
546 Ga0501033_0004506
547 Ga0501033_0253235
548 Ga0501034_0307612
549 Ga0501036_0000938
550 Ga0501036_0002504
551 Ga0501036_0057292
552 Ga0501036_0149663
553 Ga0501036_0184009
554 Ga0501036_0331485
555 Ga0501036_0386725
556 Ga0501037_0003441
557 Ga0501037_0055519
558 Ga0501037_0066449
559 Ga0501037_0107413
560 Ga0501038_0000933
561 Ga0501038_0011780
562 Ga0501038_0161396
563 Ga0501038_0288478
564 Ga0501039_0001194
565 Ga0501039_0003186
566 Ga0501039_0029132
567 Ga0501039_0065485
568 Ga0501039_0134558
569 Ga0501040_0003033
570 Ga0501040_0007085
571 Ga0501040_0007621
572 Ga0501040_0020385
573 Ga0501040_0116780
574 Ga0501040_0129109
575 Ga0501040_0150198
576 Ga0501041_0000112
577 Ga0501041_0001177
578 Ga0501041_0018458
579 Ga0501041_0155526
580 Ga0501042_0000669
581 Ga0501042_0000761
582 Ga0501042_0007896
583 Ga0501042_0057447
584 Ga0501042_0080870
585 Ga0501042_0099349
586 Ga0501042_0137937
587 Ga0501042_0245972
588 Ga0501043_0096283
589 Ga0501043_0522933
590 Ga0501046_0007241
591 Ga0501046_0008844
592 Ga0501046_0042414
593 Ga0501046_0076236
594 Ga0501046_0450829
595 Ga0501047_0000244
596 Ga0501047_0042602
597 Ga0501047_0412347
598 Ga0501048_0000223
599 Ga0501048_0003416
600 Ga0501048_0016119
601 Ga0501048_0032928
602 Ga0501048_0038134
603 Ga0501048_0049604
604 Ga0501048_0094534
605 Ga0501048_0102369
606 Ga0501067_0007471
607 Ga0501068_0000806
608 Ga0501068_0008719
609 Ga0501068_0013714
610 Ga0501068_0082115
611 Ga0501068_0293430
612 Ga0501069_0000303
613 Ga0501069_0016153
614 Ga0501070_0028555
615 Ga0501071_0000001
616 Ga0501071_0001819
617 Ga0501071_0019547
618 Ga0501071_0021501
619 Ga0501071_0041501
620 Ga0501071_0088978
621 Ga0501071_0218859
622 Ga0501072_0000550
623 Ga0501072_0004877
624 Ga0501072_0051300
625 Ga0501072_0072003
626 Ga0501072_0216231
627 Ga0501072_0305019
628 Ga0501072_0316794
629 Ga0501073_0001194
630 Ga0501073_0044131
631 Ga0501074_0001650
632 Ga0501074_0003289
633 Ga0501074_0036105
634 Ga0501074_0133395
635 Ga0501074_0211901
636 Ga0501075_0001018
637 Ga0501075_0013723
638 Ga0501075_0031578
639 Ga0501075_0056478
640 Ga0501075_0071168
641 Ga0501075_0146509
642 Ga0501075_0321360
643 Ga0501076_0000523
644 Ga0501076_0001338
645 Ga0501076_0001844
646 Ga0501076_0019579
647 Ga0501076_0054888
648 Ga0501076_0106387
649 Ga0501076_0163436
650 Ga0501076_0222914
651 Ga0501077_0000028
652 Ga0501077_0002492
653 Ga0501077_0032382
654 Ga0501077_0087483
655 Ga0501077_0093894
656 Ga0501077_0210679
657 Ga0501077_0236564
658 Ga0501079_0000387
659 Ga0501079_0003107
660 Ga0501079_0035845
661 Ga0501079_0088254
662 Ga0501079_0167471
663 Ga0501080_0000196
664 Ga0501080_0001311
665 Ga0501080_0006550
666 Ga0501080_0088597
667 Ga0501080_0124254
668 Ga0501081_0000043
669 Ga0501081_0000474
670 Ga0501081_0002900
671 Ga0501081_0007399
672 Ga0501081_0105858
673 Ga0501081_0133753
674 Ga0501081_0141298
675 Ga0501081_0474387
676 Ga0501083_0000412
677 Ga0501083_0063132
678 Ga0501083_0090415
679 Ga0501083_0111355
680 Ga0501083_0318552
681 Ga0501083_0370656
682 Ga0501035_0001272
683 Ga0501035_0010754
684 Ga0501044_0031881
685 Ga0501044_0425496
686 Ga0501045_0000861
687 Ga0501045_0002409
688 Ga0501045_0028669
689 Ga0501045_0069431
690 Ga0501045_0215270
691 nmdc:mga05p37_20661_c1
692 nmdc:mga05p37_593120_c1
693 nmdc:mga05p37_90_c1
694 nmdc:mga05p37_92967_c1
695 nmdc:mga09592_213979_c1
696 nmdc:mga09592_40085_c1
697 nmdc:mga0qj67_52668_c1
698 nmdc:mga06r32_27200_c1
699 nmdc:mga08y16_12163_c1
700 nmdc:mga08y16_203654_c1
701 nmdc:mga08y16_216610_c1
702 nmdc:mga08y16_240216_c1
703 nmdc:mga08y16_250707_c1
704 nmdc:mga0n895_77846_c1
705 nmdc:mga0a205_101872_c1
706 nmdc:mga0a205_106569_c1
707 nmdc:mga0a205_133929_c1
708 Ga0495655_0019564
709 Ga0501084_0000118
710 Ga0501084_0005523
711 Ga0501084_0011564
712 Ga0501084_0018321
713 Ga0501084_0028029
714 Ga0501084_0032085
715 Ga0501084_0033612
716 Ga0501084_0039873
717 Ga0501084_0097344
718 Ga0590075_019121
719 Ga0501082_0000585
720 Ga0501082_0000720
721 Ga0501082_0014712
722 Ga0501082_0067157
723 Ga0501082_0185596
724 Ga0501082_0215962
725 Ga0501082_0560874
726 Ga0530510_0000507
727 Ga0530510_0000855
728 Ga0530510_0007107
729 Ga0530510_0029677
730 Ga0530510_0050002
731 Ga0530510_0074206
732 Ga0530510_0083502
733 Ga0530510_0091159
734 Ga0530510_0098409

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

9

277

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.9704 2 276
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.9704 4 276
1u1x-assembly1.cif.gz_B structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 0.9698 2 276
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.9636 2 276
1u1x-assembly1.cif.gz_B structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 0.9629 2 276
ID Description Score Start End Superfamily
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9519 5 117 3.10.310.10
af_A0A1D8PQ54_137_280_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9137 122 251 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9063 1 104 3.10.310.10
1u1vA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9057 122 270 3.10.310.10
1u1vA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8935 122 270 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7W0ZBI4-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9888 1 125 GO:0005737
GO:0009058
GO:0016853
AF-A0A7V9CUU8-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9858 96 276 GO:0005737
GO:0009058
GO:0016853
AF-A0A3G7BRD2-F1-model_v4 deleted 0.9831 4 276
AF-A0A7W0T0A8-F1-model_v4 PhzF family phenazine biosynthesis protein 0.983 1 241 GO:0005737
GO:0009058
GO:0016853
AF-A0A6B1QN50-F1-model_v4 deleted 0.979 4 276

Map