F424506
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 367 | 148 | 734 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0087937|Ga0501067_0087937_106_1161 |
| Length | 351 |
| Sequence | VAAFRFVVADVFTDAPLEGNQLAVFTDAREIPAAQLQPLAREINFSETVFVYPPERDGHARIRIFTPVSELPFAGHPVLGTAFVLAAPLQLPEIRLETAKGLVPVALERDGPRIVFGRMQQPIPSVEPFAAGDDLLAALGVESSELPLELYESGVGNVYVLLPDEEAVAAVEPDLAAVARVMGSVHANVTAGSGKRWKTRMFAPGDGVPEDPATGSAAGPLALHLARHGRIAFGEEIAISQGAEIGRPSTLYARVQASPDRVEAVEVGGSAVIVARGEFRLEPRSGMSGVRPRPCPTRTSVRGSSVRRWLQQAEFACRTARSRRGRAPSTTRPKAACPGSDPGRGRIGRGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 12 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 13 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 15 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 16 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 18 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 19 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 20 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 21 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 22 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 23 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 24 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 25 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 56 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 58 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 59 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 60 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 61 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 62 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 63 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 64 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 65 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 66 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 67 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 68 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 69 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 70 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 71 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 72 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 73 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 74 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 75 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 76 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 77 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 78 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 79 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 80 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 81 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 82 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 83 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 96 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 97 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 98 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 101 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 102 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 103 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 104 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 105 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 147 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.18 |
| Rhizosphere | 94.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501067_0087937 | 3300049583 | Bacteria | 1724 |
| 2 | Ga0070658_10029711 | 3300005327 | Bacteria | 4392 |
| 3 | Ga0070658_10474822 | 3300005327 | Bacteria | 1079 |
| 4 | Ga0070660_100017516 | 3300005339 | Bacteria | 5224 |
| 5 | Ga0070688_100151460 | 3300005365 | Bacteria | 1586 |
| 6 | Ga0070667_100023056 | 3300005367 | Bacteria | 5164 |
| 7 | Ga0070678_100448954 | 3300005456 | Bacteria | 1129 |
| 8 | Ga0070684_100058875 | 3300005535 | Bacteria | 3358 |
| 9 | Ga0070684_100087425 | 3300005535 | Bacteria | 2768 |
| 10 | Ga0070696_100138706 | 3300005546 | Unclassified | 1775 |
| 11 | Ga0070696_100182551 | 3300005546 | Bacteria | 1557 |
| 12 | Ga0070693_100003301 | 3300005547 | Bacteria | 7496 |
| 13 | Ga0070664_100147993 | 3300005564 | Bacteria | 2072 |
| 14 | Ga0068857_100025630 | 3300005577 | Bacteria | 5191 |
| 15 | Ga0068856_100195182 | 3300005614 | Unclassified | 2038 |
| 16 | Ga0070702_100149226 | 3300005615 | Unclassified | 1498 |
| 17 | Ga0068864_100061649 | 3300005618 | Unclassified | 3249 |
| 18 | Ga0068862_100337039 | 3300005844 | Bacteria | 1396 |
| 19 | Ga0081455_10010134 | 3300005937 | Bacteria | 9603 |
| 20 | Ga0081455_10025244 | 3300005937 | Bacteria | 5490 |
| 21 | Ga0081455_10054766 | 3300005937 | Bacteria | 3397 |
| 22 | Ga0081455_10261734 | 3300005937 | Bacteria | 1259 |
| 23 | Ga0081538_10000529 | 3300005981 | Bacteria | 42265 |
| 24 | Ga0081538_10000873 | 3300005981 | Bacteria | 32578 |
| 25 | Ga0081538_10001591 | 3300005981 | Bacteria | 23294 |
| 26 | Ga0081538_10005139 | 3300005981 | Bacteria | 11864 |
| 27 | Ga0075432_10021961 | 3300006058 | Bacteria | 2182 |
| 28 | Ga0068871_100483402 | 3300006358 | Unclassified | 1114 |
| 29 | Ga0075428_100063002 | 3300006844 | Bacteria | 4059 |
| 30 | Ga0075428_100086957 | 3300006844 | Bacteria | 3410 |
| 31 | Ga0075428_100113135 | 3300006844 | Bacteria | 2957 |
| 32 | Ga0075428_100132115 | 3300006844 | Unclassified | 2715 |
| 33 | Ga0075431_100279589 | 3300006847 | Bacteria | 1690 |
| 34 | Ga0075433_10091540 | 3300006852 | Bacteria | 2689 |
| 35 | Ga0075433_10224824 | 3300006852 | Bacteria | 1667 |
| 36 | Ga0075429_100169105 | 3300006880 | Bacteria | 1915 |
| 37 | Ga0068865_100162753 | 3300006881 | Bacteria | 1704 |
| 38 | Ga0111539_10003565 | 3300009094 | Bacteria | 20519 |
| 39 | Ga0111539_10005274 | 3300009094 | Bacteria | 16732 |
| 40 | Ga0111539_10031932 | 3300009094 | Bacteria | 6397 |
| 41 | Ga0111539_10127545 | 3300009094 | Bacteria | 2980 |
| 42 | Ga0111539_10452468 | 3300009094 | Bacteria | 1495 |
| 43 | Ga0105245_10091132 | 3300009098 | Unclassified | 2805 |
| 44 | Ga0114129_10073797 | 3300009147 | Bacteria | 4753 |
| 45 | Ga0114129_10120810 | 3300009147 | Bacteria | 3607 |
| 46 | Ga0114129_10203402 | 3300009147 | Bacteria | 2681 |
| 47 | Ga0114129_10216392 | 3300009147 | Bacteria | 2587 |
| 48 | Ga0114129_10528716 | 3300009147 | Bacteria | 1537 |
| 49 | Ga0105243_10095198 | 3300009148 | Unclassified | 2461 |
| 50 | Ga0105249_10042473 | 3300009553 | Bacteria | 4135 |
| 51 | Ga0105239_10239902 | 3300010375 | Bacteria | 2035 |
| 52 | Ga0157369_10011618 | 3300013105 | Bacteria | 9999 |
| 53 | Ga0157369_10295076 | 3300013105 | Bacteria | 1687 |
| 54 | Ga0163162_10155609 | 3300013306 | Bacteria | 2406 |
| 55 | Ga0163163_10519281 | 3300014325 | Bacteria | 1253 |
| 56 | Ga0157377_10016085 | 3300014745 | Bacteria | 3842 |
| 57 | Ga0157379_10125806 | 3300014968 | Bacteria | 2306 |
| 58 | Ga0207688_10013113 | 3300025901 | Bacteria | 4506 |
| 59 | Ga0207645_10044989 | 3300025907 | Unclassified | 2823 |
| 60 | Ga0207643_10025516 | 3300025908 | Bacteria | 3267 |
| 61 | Ga0207693_10238614 | 3300025915 | Bacteria | 1427 |
| 62 | Ga0207662_10015617 | 3300025918 | Bacteria | 4274 |
| 63 | Ga0207657_10029216 | 3300025919 | Bacteria | 5020 |
| 64 | Ga0207706_10101583 | 3300025933 | Bacteria | 2530 |
| 65 | Ga0207706_10251920 | 3300025933 | Bacteria | 1542 |
| 66 | Ga0207691_10078075 | 3300025940 | Bacteria | 2981 |
| 67 | Ga0207689_10046456 | 3300025942 | Bacteria | 3589 |
| 68 | Ga0207661_10025696 | 3300025944 | Bacteria | 4480 |
| 69 | Ga0207667_10572914 | 3300025949 | Bacteria | 1140 |
| 70 | Ga0207640_10111996 | 3300025981 | Unclassified | 1936 |
| 71 | Ga0207640_10281876 | 3300025981 | Unclassified | 1306 |
| 72 | Ga0207658_10015212 | 3300025986 | Bacteria | 5278 |
| 73 | Ga0207677_10289167 | 3300026023 | Bacteria | 1349 |
| 74 | Ga0207703_10269209 | 3300026035 | Bacteria | 1543 |
| 75 | Ga0207708_10004391 | 3300026075 | Bacteria | 10392 |
| 76 | Ga0207708_10143580 | 3300026075 | Bacteria | 1874 |
| 77 | Ga0207674_10001155 | 3300026116 | Bacteria | 34231 |
| 78 | Ga0207674_10021319 | 3300026116 | Bacteria | 6982 |
| 79 | Ga0207675_100014214 | 3300026118 | Bacteria | 7423 |
| 80 | Ga0207675_100240590 | 3300026118 | Bacteria | 1749 |
| 81 | Ga0207683_10184565 | 3300026121 | Bacteria | 1892 |
| 82 | Ga0207428_10037284 | 3300027907 | Bacteria | 3956 |
| 83 | Ga0268265_10485039 | 3300028380 | Bacteria | 1162 |
| 84 | Ga0307405_10224357 | 3300031731 | Unclassified | 1381 |
| 85 | Ga0307410_10053262 | 3300031852 | Bacteria | 2737 |
| 86 | Ga0307410_10511903 | 3300031852 | Unclassified | 989 |
| 87 | Ga0307406_10016218 | 3300031901 | Bacteria | 4325 |
| 88 | Ga0307407_10005320 | 3300031903 | Bacteria | 5572 |
| 89 | Ga0307412_10116419 | 3300031911 | Unclassified | 1917 |
| 90 | Ga0307409_100040844 | 3300031995 | Unclassified | 3458 |
| 91 | Ga0307416_100001962 | 3300032002 | Bacteria | 11524 |
| 92 | Ga0307416_100006089 | 3300032002 | Bacteria | 7510 |
| 93 | Ga0307414_10144177 | 3300032004 | Unclassified | 1869 |
| 94 | Ga0307415_100021491 | 3300032126 | Bacteria | 3967 |
| 95 | Ga0307415_100178338 | 3300032126 | Bacteria | 1664 |
| 96 | Ga0307415_100332024 | 3300032126 | Bacteria | 1273 |
| 97 | Ga0395899_0151819 | 3300037312 | Bacteria | 1641 |
| 98 | Ga0395900_0012221 | 3300037418 | Bacteria | 8778 |
| 99 | Ga0395900_0039963 | 3300037418 | Bacteria | 4834 |
| 100 | Ga0395900_0113909 | 3300037418 | Bacteria | 2775 |
| 101 | Ga0395900_0127420 | 3300037418 | Bacteria | 2610 |
| 102 | Ga0395900_0318353 | 3300037418 | Bacteria | 1536 |
| 103 | Ga0395900_0419946 | 3300037418 | Bacteria | 1298 |
| 104 | Ga0395900_0435903 | 3300037418 | Unclassified | 1269 |
| 105 | Ga0395900_0606577 | 3300037418 | Bacteria | 1035 |
| 106 | Ga0395898_0005135 | 3300037466 | Bacteria | 14165 |
| 107 | Ga0395898_0014552 | 3300037466 | Bacteria | 8081 |
| 108 | Ga0395898_0047335 | 3300037466 | Bacteria | 4220 |
| 109 | Ga0395898_0106067 | 3300037466 | Bacteria | 2695 |
| 110 | Ga0395898_0124456 | 3300037466 | Bacteria | 2470 |
| 111 | Ga0395898_0125777 | 3300037466 | Bacteria | 2456 |
| 112 | Ga0395905_0063559 | 3300037471 | Bacteria | 3453 |
| 113 | Ga0395905_0066086 | 3300037471 | Bacteria | 3386 |
| 114 | Ga0395905_0182128 | 3300037471 | Bacteria | 1972 |
| 115 | Ga0395905_0207850 | 3300037471 | Bacteria | 1834 |
| 116 | Ga0395905_0224148 | 3300037471 | Bacteria | 1759 |
| 117 | Ga0395905_0265449 | 3300037471 | Bacteria | 1602 |
| 118 | Ga0395901_0000500 | 3300038443 | Bacteria | 45375 |
| 119 | Ga0395901_0022940 | 3300038443 | Bacteria | 6398 |
| 120 | Ga0395901_0029453 | 3300038443 | Bacteria | 5654 |
| 121 | Ga0395901_0119886 | 3300038443 | Bacteria | 2764 |
| 122 | Ga0395901_0133067 | 3300038443 | Bacteria | 2613 |
| 123 | Ga0395901_0214918 | 3300038443 | Bacteria | 2011 |
| 124 | Ga0439439_0000098 | 3300041406 | Bacteria | 11492 |
| 125 | Ga0439446_0017392 | 3300042156 | Bacteria | 2009 |
| 126 | Ga0451577_0006349 | 3300042876 | Bacteria | 11806 |
| 127 | Ga0439440_0055169 | 3300042993 | Bacteria | 1002 |
| 128 | Ga0453683_0012855 | 3300044673 | Bacteria | 5479 |
| 129 | Ga0466966_0037275 | 3300044684 | Bacteria | 3136 |
| 130 | Ga0466963_0034748 | 3300044694 | Bacteria | 3281 |
| 131 | Ga0453684_0000673 | 3300044712 | Bacteria | 122532 |
| 132 | Ga0453684_0020227 | 3300044712 | Bacteria | 10061 |
| 133 | Ga0453684_0251342 | 3300044712 | Bacteria | 2030 |
| 134 | Ga0466959_0047968 | 3300045049 | Bacteria | 3140 |
| 135 | Ga0451576_0025961 | 3300045051 | Bacteria | 6306 |
| 136 | Ga0451576_0213304 | 3300045051 | Bacteria | 2016 |
| 137 | Ga0466958_0010066 | 3300045836 | Bacteria | 5286 |
| 138 | Ga0466967_0148446 | 3300045976 | Bacteria | 2189 |
| 139 | Ga0466967_0200036 | 3300045976 | Bacteria | 1892 |
| 140 | Ga0466967_0243747 | 3300045976 | Bacteria | 1715 |
| 141 | Ga0466967_0334410 | 3300045976 | Bacteria | 1463 |
| 142 | Ga0495582_0167595 | 3300046473 | Unclassified | 1250 |
| 143 | Ga0495584_0143230 | 3300046491 | Bacteria | 1214 |
| 144 | Ga0495584_0158128 | 3300046491 | Bacteria | 1152 |
| 145 | Ga0495644_0041971 | 3300046523 | Bacteria | 1723 |
| 146 | Ga0495663_0016626 | 3300046525 | Bacteria | 2080 |
| 147 | Ga0495642_0031698 | 3300046528 | Bacteria | 2120 |
| 148 | Ga0495586_0094502 | 3300046535 | Unclassified | 1654 |
| 149 | Ga0495668_0230105 | 3300046616 | Unclassified | 1015 |
| 150 | Ga0495647_0027259 | 3300046681 | Bacteria | 2099 |
| 151 | Ga0495636_0021086 | 3300047318 | Bacteria | 2629 |
| 152 | Ga0495676_0032990 | 3300047321 | Bacteria | 4365 |
| 153 | Ga0496100_0158857 | 3300048903 | Bacteria | 1619 |
| 154 | Ga0496101_0463980 | 3300048904 | Unclassified | 999 |
| 155 | Ga0496102_0346042 | 3300048905 | Bacteria | 1400 |
| 156 | Ga0496102_0384265 | 3300048905 | Bacteria | 1321 |
| 157 | Ga0496103_0080582 | 3300048906 | Unclassified | 2047 |
| 158 | Ga0496103_0297203 | 3300048906 | Bacteria | 1039 |
| 159 | Ga0496104_0068532 | 3300048907 | Bacteria | 3371 |
| 160 | Ga0496108_0015793 | 3300048911 | Bacteria | 6155 |
| 161 | Ga0496109_0006271 | 3300048912 | Bacteria | 10004 |
| 162 | Ga0496109_0187079 | 3300048912 | Bacteria | 1946 |
| 163 | Ga0496110_0002882 | 3300048913 | Bacteria | 13000 |
| 164 | Ga0496110_0014681 | 3300048913 | Bacteria | 6510 |
| 165 | Ga0496111_0001978 | 3300048914 | Bacteria | 12176 |
| 166 | Ga0496111_0008042 | 3300048914 | Bacteria | 6958 |
| 167 | Ga0496112_0033029 | 3300048915 | Bacteria | 5026 |
| 168 | Ga0496112_0686394 | 3300048915 | Bacteria | 952 |
| 169 | Ga0496113_0152404 | 3300048916 | Bacteria | 1824 |
| 170 | Ga0496113_0202773 | 3300048916 | Bacteria | 1577 |
| 171 | Ga0496114_0066557 | 3300048917 | Bacteria | 3021 |
| 172 | Ga0501031_0000822 | 3300049568 | Bacteria | 18682 |
| 173 | Ga0501031_0020939 | 3300049568 | Bacteria | 4263 |
| 174 | Ga0501031_0091401 | 3300049568 | Bacteria | 1985 |
| 175 | Ga0501032_0004405 | 3300049569 | Bacteria | 10630 |
| 176 | Ga0501032_0090133 | 3300049569 | Bacteria | 2035 |
| 177 | Ga0501032_0265463 | 3300049569 | Bacteria | 1113 |
| 178 | Ga0501033_0000862 | 3300049570 | Bacteria | 27744 |
| 179 | Ga0501033_0004506 | 3300049570 | Bacteria | 11149 |
| 180 | Ga0501033_0253235 | 3300049570 | Bacteria | 1247 |
| 181 | Ga0501034_0307612 | 3300049571 | Bacteria | 1520 |
| 182 | Ga0501036_0000938 | 3300049572 | Bacteria | 21916 |
| 183 | Ga0501036_0002504 | 3300049572 | Bacteria | 14413 |
| 184 | Ga0501036_0057292 | 3300049572 | Bacteria | 3300 |
| 185 | Ga0501036_0149663 | 3300049572 | Bacteria | 1969 |
| 186 | Ga0501036_0184009 | 3300049572 | Bacteria | 1758 |
| 187 | Ga0501036_0331485 | 3300049572 | Bacteria | 1271 |
| 188 | Ga0501036_0386725 | 3300049572 | Unclassified | 1167 |
| 189 | Ga0501037_0003441 | 3300049573 | Bacteria | 11505 |
| 190 | Ga0501037_0055519 | 3300049573 | Bacteria | 2895 |
| 191 | Ga0501037_0066449 | 3300049573 | Bacteria | 2627 |
| 192 | Ga0501037_0107413 | 3300049573 | Bacteria | 2011 |
| 193 | Ga0501038_0000933 | 3300049574 | Bacteria | 26040 |
| 194 | Ga0501038_0011780 | 3300049574 | Bacteria | 7978 |
| 195 | Ga0501038_0161396 | 3300049574 | Bacteria | 1821 |
| 196 | Ga0501038_0288478 | 3300049574 | Bacteria | 1290 |
| 197 | Ga0501039_0001194 | 3300049575 | Bacteria | 19045 |
| 198 | Ga0501039_0003186 | 3300049575 | Bacteria | 12272 |
| 199 | Ga0501039_0029132 | 3300049575 | Bacteria | 4252 |
| 200 | Ga0501039_0065485 | 3300049575 | Bacteria | 2819 |
| 201 | Ga0501039_0134558 | 3300049575 | Bacteria | 1940 |
| 202 | Ga0501040_0003033 | 3300049576 | Bacteria | 10888 |
| 203 | Ga0501040_0007085 | 3300049576 | Bacteria | 7265 |
| 204 | Ga0501040_0007621 | 3300049576 | Bacteria | 7006 |
| 205 | Ga0501040_0020385 | 3300049576 | Bacteria | 4417 |
| 206 | Ga0501040_0116780 | 3300049576 | Unclassified | 1869 |
| 207 | Ga0501040_0129109 | 3300049576 | Bacteria | 1776 |
| 208 | Ga0501040_0150198 | 3300049576 | Bacteria | 1644 |
| 209 | Ga0501041_0000112 | 3300049577 | Bacteria | 34048 |
| 210 | Ga0501041_0001177 | 3300049577 | Bacteria | 14243 |
| 211 | Ga0501041_0018458 | 3300049577 | Bacteria | 4155 |
| 212 | Ga0501041_0155526 | 3300049577 | Bacteria | 1428 |
| 213 | Ga0501042_0000669 | 3300049578 | Bacteria | 18447 |
| 214 | Ga0501042_0000761 | 3300049578 | Bacteria | 17537 |
| 215 | Ga0501042_0007896 | 3300049578 | Bacteria | 6999 |
| 216 | Ga0501042_0057447 | 3300049578 | Bacteria | 2776 |
| 217 | Ga0501042_0080870 | 3300049578 | Bacteria | 2328 |
| 218 | Ga0501042_0099349 | 3300049578 | Bacteria | 2092 |
| 219 | Ga0501042_0137937 | 3300049578 | Bacteria | 1758 |
| 220 | Ga0501042_0245972 | 3300049578 | Bacteria | 1291 |
| 221 | Ga0501043_0096283 | 3300049579 | Bacteria | 2326 |
| 222 | Ga0501043_0522933 | 3300049579 | Bacteria | 884 |
| 223 | Ga0501046_0007241 | 3300049580 | Bacteria | 9754 |
| 224 | Ga0501046_0008844 | 3300049580 | Bacteria | 8746 |
| 225 | Ga0501046_0042414 | 3300049580 | Bacteria | 3628 |
| 226 | Ga0501046_0076236 | 3300049580 | Bacteria | 2598 |
| 227 | Ga0501046_0450829 | 3300049580 | Bacteria | 925 |
| 228 | Ga0501047_0000244 | 3300049581 | Bacteria | 64596 |
| 229 | Ga0501047_0042602 | 3300049581 | Bacteria | 4386 |
| 230 | Ga0501047_0412347 | 3300049581 | Bacteria | 1183 |
| 231 | Ga0501048_0000223 | 3300049582 | Bacteria | 37247 |
| 232 | Ga0501048_0003416 | 3300049582 | Bacteria | 12069 |
| 233 | Ga0501048_0016119 | 3300049582 | Bacteria | 5510 |
| 234 | Ga0501048_0032928 | 3300049582 | Bacteria | 3745 |
| 235 | Ga0501048_0038134 | 3300049582 | Bacteria | 3450 |
| 236 | Ga0501048_0049604 | 3300049582 | Bacteria | 2991 |
| 237 | Ga0501048_0094534 | 3300049582 | Bacteria | 2108 |
| 238 | Ga0501048_0102369 | 3300049582 | Bacteria | 2021 |
| 239 | Ga0501067_0007471 | 3300049583 | Bacteria | 6072 |
| 240 | Ga0501068_0000806 | 3300049584 | Bacteria | 16281 |
| 241 | Ga0501068_0008719 | 3300049584 | Bacteria | 5655 |
| 242 | Ga0501068_0013714 | 3300049584 | Bacteria | 4615 |
| 243 | Ga0501068_0082115 | 3300049584 | Bacteria | 1979 |
| 244 | Ga0501068_0293430 | 3300049584 | Bacteria | 1040 |
| 245 | Ga0501069_0000303 | 3300049585 | Bacteria | 22395 |
| 246 | Ga0501069_0016153 | 3300049585 | Bacteria | 4005 |
| 247 | Ga0501070_0028555 | 3300049586 | Bacteria | 4679 |
| 248 | Ga0501071_0000001 | 3300049587 | Bacteria | 123952 |
| 249 | Ga0501071_0001819 | 3300049587 | Bacteria | 12630 |
| 250 | Ga0501071_0019547 | 3300049587 | Bacteria | 4700 |
| 251 | Ga0501071_0021501 | 3300049587 | Bacteria | 4494 |
| 252 | Ga0501071_0041501 | 3300049587 | Bacteria | 3295 |
| 253 | Ga0501071_0088978 | 3300049587 | Bacteria | 2265 |
| 254 | Ga0501071_0218859 | 3300049587 | Bacteria | 1433 |
| 255 | Ga0501072_0000550 | 3300049588 | Bacteria | 26960 |
| 256 | Ga0501072_0004877 | 3300049588 | Bacteria | 10204 |
| 257 | Ga0501072_0051300 | 3300049588 | Bacteria | 3248 |
| 258 | Ga0501072_0072003 | 3300049588 | Bacteria | 2731 |
| 259 | Ga0501072_0216231 | 3300049588 | Bacteria | 1527 |
| 260 | Ga0501072_0305019 | 3300049588 | Bacteria | 1266 |
| 261 | Ga0501072_0316794 | 3300049588 | Bacteria | 1239 |
| 262 | Ga0501073_0001194 | 3300049589 | Bacteria | 18908 |
| 263 | Ga0501073_0044131 | 3300049589 | Bacteria | 3141 |
| 264 | Ga0501074_0001650 | 3300049590 | Bacteria | 15137 |
| 265 | Ga0501074_0003289 | 3300049590 | Bacteria | 11432 |
| 266 | Ga0501074_0036105 | 3300049590 | Bacteria | 3581 |
| 267 | Ga0501074_0133395 | 3300049590 | Unclassified | 1776 |
| 268 | Ga0501074_0211901 | 3300049590 | Bacteria | 1380 |
| 269 | Ga0501075_0001018 | 3300049591 | Bacteria | 17943 |
| 270 | Ga0501075_0013723 | 3300049591 | Bacteria | 5789 |
| 271 | Ga0501075_0031578 | 3300049591 | Bacteria | 3932 |
| 272 | Ga0501075_0056478 | 3300049591 | Bacteria | 2955 |
| 273 | Ga0501075_0071168 | 3300049591 | Bacteria | 2628 |
| 274 | Ga0501075_0146509 | 3300049591 | Bacteria | 1799 |
| 275 | Ga0501075_0321360 | 3300049591 | Bacteria | 1179 |
| 276 | Ga0501076_0000523 | 3300049592 | Bacteria | 24385 |
| 277 | Ga0501076_0001338 | 3300049592 | Bacteria | 16485 |
| 278 | Ga0501076_0001844 | 3300049592 | Bacteria | 14412 |
| 279 | Ga0501076_0019579 | 3300049592 | Bacteria | 5174 |
| 280 | Ga0501076_0054888 | 3300049592 | Bacteria | 3158 |
| 281 | Ga0501076_0106387 | 3300049592 | Unclassified | 2264 |
| 282 | Ga0501076_0163436 | 3300049592 | Bacteria | 1814 |
| 283 | Ga0501076_0222914 | 3300049592 | Bacteria | 1541 |
| 284 | Ga0501077_0000028 | 3300049593 | Bacteria | 74757 |
| 285 | Ga0501077_0002492 | 3300049593 | Bacteria | 11025 |
| 286 | Ga0501077_0032382 | 3300049593 | Bacteria | 3327 |
| 287 | Ga0501077_0087483 | 3300049593 | Bacteria | 1975 |
| 288 | Ga0501077_0093894 | 3300049593 | Bacteria | 1901 |
| 289 | Ga0501077_0210679 | 3300049593 | Bacteria | 1235 |
| 290 | Ga0501077_0236564 | 3300049593 | Bacteria | 1161 |
| 291 | Ga0501079_0000387 | 3300049741 | Bacteria | 28343 |
| 292 | Ga0501079_0003107 | 3300049741 | Bacteria | 12165 |
| 293 | Ga0501079_0035845 | 3300049741 | Bacteria | 3819 |
| 294 | Ga0501079_0088254 | 3300049741 | Bacteria | 2401 |
| 295 | Ga0501079_0167471 | 3300049741 | Bacteria | 1713 |
| 296 | Ga0501080_0000196 | 3300049742 | Bacteria | 44194 |
| 297 | Ga0501080_0001311 | 3300049742 | Bacteria | 20737 |
| 298 | Ga0501080_0006550 | 3300049742 | Bacteria | 10467 |
| 299 | Ga0501080_0088597 | 3300049742 | Bacteria | 2875 |
| 300 | Ga0501080_0124254 | 3300049742 | Bacteria | 2390 |
| 301 | Ga0501081_0000043 | 3300049743 | Bacteria | 47758 |
| 302 | Ga0501081_0000474 | 3300049743 | Bacteria | 22314 |
| 303 | Ga0501081_0002900 | 3300049743 | Bacteria | 10874 |
| 304 | Ga0501081_0007399 | 3300049743 | Bacteria | 7127 |
| 305 | Ga0501081_0105858 | 3300049743 | Bacteria | 1993 |
| 306 | Ga0501081_0133753 | 3300049743 | Bacteria | 1773 |
| 307 | Ga0501081_0141298 | 3300049743 | Unclassified | 1725 |
| 308 | Ga0501081_0474387 | 3300049743 | Bacteria | 931 |
| 309 | Ga0501083_0000412 | 3300049744 | Bacteria | 27299 |
| 310 | Ga0501083_0063132 | 3300049744 | Unclassified | 2471 |
| 311 | Ga0501083_0090415 | 3300049744 | Bacteria | 2022 |
| 312 | Ga0501083_0111355 | 3300049744 | Bacteria | 1799 |
| 313 | Ga0501083_0318552 | 3300049744 | Bacteria | 1011 |
| 314 | Ga0501083_0370656 | 3300049744 | Bacteria | 931 |
| 315 | Ga0501035_0001272 | 3300049822 | Bacteria | 26065 |
| 316 | Ga0501035_0010754 | 3300049822 | Bacteria | 8472 |
| 317 | Ga0501044_0031881 | 3300049823 | Bacteria | 5543 |
| 318 | Ga0501044_0425496 | 3300049823 | Bacteria | 1237 |
| 319 | Ga0501045_0000861 | 3300049824 | Bacteria | 19727 |
| 320 | Ga0501045_0002409 | 3300049824 | Bacteria | 12710 |
| 321 | Ga0501045_0028669 | 3300049824 | Bacteria | 4017 |
| 322 | Ga0501045_0069431 | 3300049824 | Bacteria | 2590 |
| 323 | Ga0501045_0215270 | 3300049824 | Bacteria | 1430 |
| 324 | nmdc:mga05p37_20661_c1 | 3300050507 | Bacteria | 7967 |
| 325 | nmdc:mga05p37_593120_c1 | 3300050507 | Bacteria | 1252 |
| 326 | nmdc:mga05p37_90_c1 | 3300050507 | Bacteria | 81115 |
| 327 | nmdc:mga05p37_92967_c1 | 3300050507 | Bacteria | 3716 |
| 328 | nmdc:mga09592_213979_c1 | 3300050508 | Bacteria | 1670 |
| 329 | nmdc:mga09592_40085_c1 | 3300050508 | Bacteria | 3935 |
| 330 | nmdc:mga0qj67_52668_c1 | 3300050509 | Bacteria | 3221 |
| 331 | nmdc:mga06r32_27200_c1 | 3300050510 | Bacteria | 5340 |
| 332 | nmdc:mga08y16_12163_c1 | 3300050511 | Bacteria | 9047 |
| 333 | nmdc:mga08y16_203654_c1 | 3300050511 | Bacteria | 2050 |
| 334 | nmdc:mga08y16_216610_c1 | 3300050511 | Bacteria | 1983 |
| 335 | nmdc:mga08y16_240216_c1 | 3300050511 | Bacteria | 1872 |
| 336 | nmdc:mga08y16_250707_c1 | 3300050511 | Bacteria | 1829 |
| 337 | nmdc:mga0n895_77846_c1 | 3300050512 | Bacteria | 3299 |
| 338 | nmdc:mga0a205_101872_c1 | 3300050515 | Bacteria | 2303 |
| 339 | nmdc:mga0a205_106569_c1 | 3300050515 | Bacteria | 2700 |
| 340 | nmdc:mga0a205_133929_c1 | 3300050515 | Bacteria | 2378 |
| 341 | Ga0495655_0019564 | 3300053083 | Unclassified | 1505 |
| 342 | Ga0501084_0000118 | 3300054114 | Bacteria | 60290 |
| 343 | Ga0501084_0005523 | 3300054114 | Bacteria | 10379 |
| 344 | Ga0501084_0011564 | 3300054114 | Bacteria | 7307 |
| 345 | Ga0501084_0018321 | 3300054114 | Bacteria | 5830 |
| 346 | Ga0501084_0028029 | 3300054114 | Bacteria | 4706 |
| 347 | Ga0501084_0032085 | 3300054114 | Bacteria | 4393 |
| 348 | Ga0501084_0033612 | 3300054114 | Bacteria | 4290 |
| 349 | Ga0501084_0039873 | 3300054114 | Bacteria | 3927 |
| 350 | Ga0501084_0097344 | 3300054114 | Bacteria | 2470 |
| 351 | Ga0590075_019121 | 3300059424 | Bacteria | 1698 |
| 352 | Ga0501082_0000585 | 3300060353 | Bacteria | 32305 |
| 353 | Ga0501082_0000720 | 3300060353 | Bacteria | 29137 |
| 354 | Ga0501082_0014712 | 3300060353 | Bacteria | 6739 |
| 355 | Ga0501082_0067157 | 3300060353 | Bacteria | 3088 |
| 356 | Ga0501082_0185596 | 3300060353 | Bacteria | 1809 |
| 357 | Ga0501082_0215962 | 3300060353 | Bacteria | 1668 |
| 358 | Ga0501082_0560874 | 3300060353 | Bacteria | 999 |
| 359 | Ga0530510_0000507 | 3300061734 | Bacteria | 24742 |
| 360 | Ga0530510_0000855 | 3300061734 | Bacteria | 20092 |
| 361 | Ga0530510_0007107 | 3300061734 | Bacteria | 7792 |
| 362 | Ga0530510_0029677 | 3300061734 | Bacteria | 3926 |
| 363 | Ga0530510_0050002 | 3300061734 | Bacteria | 3019 |
| 364 | Ga0530510_0074206 | 3300061734 | Bacteria | 2470 |
| 365 | Ga0530510_0083502 | 3300061734 | Bacteria | 2326 |
| 366 | Ga0530510_0091159 | 3300061734 | Bacteria | 2224 |
| 367 | Ga0530510_0098409 | 3300061734 | Bacteria | 2139 |
| 368 | Ga0501067_0087937 | |||
| 369 | Ga0070658_10029711 | |||
| 370 | Ga0070658_10474822 | |||
| 371 | Ga0070660_100017516 | |||
| 372 | Ga0070688_100151460 | |||
| 373 | Ga0070667_100023056 | |||
| 374 | Ga0070678_100448954 | |||
| 375 | Ga0070684_100058875 | |||
| 376 | Ga0070684_100087425 | |||
| 377 | Ga0070696_100138706 | |||
| 378 | Ga0070696_100182551 | |||
| 379 | Ga0070693_100003301 | |||
| 380 | Ga0070664_100147993 | |||
| 381 | Ga0068857_100025630 | |||
| 382 | Ga0068856_100195182 | |||
| 383 | Ga0070702_100149226 | |||
| 384 | Ga0068864_100061649 | |||
| 385 | Ga0068862_100337039 | |||
| 386 | Ga0081455_10010134 | |||
| 387 | Ga0081455_10025244 | |||
| 388 | Ga0081455_10054766 | |||
| 389 | Ga0081455_10261734 | |||
| 390 | Ga0081538_10000529 | |||
| 391 | Ga0081538_10000873 | |||
| 392 | Ga0081538_10001591 | |||
| 393 | Ga0081538_10005139 | |||
| 394 | Ga0075432_10021961 | |||
| 395 | Ga0068871_100483402 | |||
| 396 | Ga0075428_100063002 | |||
| 397 | Ga0075428_100086957 | |||
| 398 | Ga0075428_100113135 | |||
| 399 | Ga0075428_100132115 | |||
| 400 | Ga0075431_100279589 | |||
| 401 | Ga0075433_10091540 | |||
| 402 | Ga0075433_10224824 | |||
| 403 | Ga0075429_100169105 | |||
| 404 | Ga0068865_100162753 | |||
| 405 | Ga0111539_10003565 | |||
| 406 | Ga0111539_10005274 | |||
| 407 | Ga0111539_10031932 | |||
| 408 | Ga0111539_10127545 | |||
| 409 | Ga0111539_10452468 | |||
| 410 | Ga0105245_10091132 | |||
| 411 | Ga0114129_10073797 | |||
| 412 | Ga0114129_10120810 | |||
| 413 | Ga0114129_10203402 | |||
| 414 | Ga0114129_10216392 | |||
| 415 | Ga0114129_10528716 | |||
| 416 | Ga0105243_10095198 | |||
| 417 | Ga0105249_10042473 | |||
| 418 | Ga0105239_10239902 | |||
| 419 | Ga0157369_10011618 | |||
| 420 | Ga0157369_10295076 | |||
| 421 | Ga0163162_10155609 | |||
| 422 | Ga0163163_10519281 | |||
| 423 | Ga0157377_10016085 | |||
| 424 | Ga0157379_10125806 | |||
| 425 | Ga0207688_10013113 | |||
| 426 | Ga0207645_10044989 | |||
| 427 | Ga0207643_10025516 | |||
| 428 | Ga0207693_10238614 | |||
| 429 | Ga0207662_10015617 | |||
| 430 | Ga0207657_10029216 | |||
| 431 | Ga0207706_10101583 | |||
| 432 | Ga0207706_10251920 | |||
| 433 | Ga0207691_10078075 | |||
| 434 | Ga0207689_10046456 | |||
| 435 | Ga0207661_10025696 | |||
| 436 | Ga0207667_10572914 | |||
| 437 | Ga0207640_10111996 | |||
| 438 | Ga0207640_10281876 | |||
| 439 | Ga0207658_10015212 | |||
| 440 | Ga0207677_10289167 | |||
| 441 | Ga0207703_10269209 | |||
| 442 | Ga0207708_10004391 | |||
| 443 | Ga0207708_10143580 | |||
| 444 | Ga0207674_10001155 | |||
| 445 | Ga0207674_10021319 | |||
| 446 | Ga0207675_100014214 | |||
| 447 | Ga0207675_100240590 | |||
| 448 | Ga0207683_10184565 | |||
| 449 | Ga0207428_10037284 | |||
| 450 | Ga0268265_10485039 | |||
| 451 | Ga0307405_10224357 | |||
| 452 | Ga0307410_10053262 | |||
| 453 | Ga0307410_10511903 | |||
| 454 | Ga0307406_10016218 | |||
| 455 | Ga0307407_10005320 | |||
| 456 | Ga0307412_10116419 | |||
| 457 | Ga0307409_100040844 | |||
| 458 | Ga0307416_100001962 | |||
| 459 | Ga0307416_100006089 | |||
| 460 | Ga0307414_10144177 | |||
| 461 | Ga0307415_100021491 | |||
| 462 | Ga0307415_100178338 | |||
| 463 | Ga0307415_100332024 | |||
| 464 | Ga0395899_0151819 | |||
| 465 | Ga0395900_0012221 | |||
| 466 | Ga0395900_0039963 | |||
| 467 | Ga0395900_0113909 | |||
| 468 | Ga0395900_0127420 | |||
| 469 | Ga0395900_0318353 | |||
| 470 | Ga0395900_0419946 | |||
| 471 | Ga0395900_0435903 | |||
| 472 | Ga0395900_0606577 | |||
| 473 | Ga0395898_0005135 | |||
| 474 | Ga0395898_0014552 | |||
| 475 | Ga0395898_0047335 | |||
| 476 | Ga0395898_0106067 | |||
| 477 | Ga0395898_0124456 | |||
| 478 | Ga0395898_0125777 | |||
| 479 | Ga0395905_0063559 | |||
| 480 | Ga0395905_0066086 | |||
| 481 | Ga0395905_0182128 | |||
| 482 | Ga0395905_0207850 | |||
| 483 | Ga0395905_0224148 | |||
| 484 | Ga0395905_0265449 | |||
| 485 | Ga0395901_0000500 | |||
| 486 | Ga0395901_0022940 | |||
| 487 | Ga0395901_0029453 | |||
| 488 | Ga0395901_0119886 | |||
| 489 | Ga0395901_0133067 | |||
| 490 | Ga0395901_0214918 | |||
| 491 | Ga0439439_0000098 | |||
| 492 | Ga0439446_0017392 | |||
| 493 | Ga0451577_0006349 | |||
| 494 | Ga0439440_0055169 | |||
| 495 | Ga0453683_0012855 | |||
| 496 | Ga0466966_0037275 | |||
| 497 | Ga0466963_0034748 | |||
| 498 | Ga0453684_0000673 | |||
| 499 | Ga0453684_0020227 | |||
| 500 | Ga0453684_0251342 | |||
| 501 | Ga0466959_0047968 | |||
| 502 | Ga0451576_0025961 | |||
| 503 | Ga0451576_0213304 | |||
| 504 | Ga0466958_0010066 | |||
| 505 | Ga0466967_0148446 | |||
| 506 | Ga0466967_0200036 | |||
| 507 | Ga0466967_0243747 | |||
| 508 | Ga0466967_0334410 | |||
| 509 | Ga0495582_0167595 | |||
| 510 | Ga0495584_0143230 | |||
| 511 | Ga0495584_0158128 | |||
| 512 | Ga0495644_0041971 | |||
| 513 | Ga0495663_0016626 | |||
| 514 | Ga0495642_0031698 | |||
| 515 | Ga0495586_0094502 | |||
| 516 | Ga0495668_0230105 | |||
| 517 | Ga0495647_0027259 | |||
| 518 | Ga0495636_0021086 | |||
| 519 | Ga0495676_0032990 | |||
| 520 | Ga0496100_0158857 | |||
| 521 | Ga0496101_0463980 | |||
| 522 | Ga0496102_0346042 | |||
| 523 | Ga0496102_0384265 | |||
| 524 | Ga0496103_0080582 | |||
| 525 | Ga0496103_0297203 | |||
| 526 | Ga0496104_0068532 | |||
| 527 | Ga0496108_0015793 | |||
| 528 | Ga0496109_0006271 | |||
| 529 | Ga0496109_0187079 | |||
| 530 | Ga0496110_0002882 | |||
| 531 | Ga0496110_0014681 | |||
| 532 | Ga0496111_0001978 | |||
| 533 | Ga0496111_0008042 | |||
| 534 | Ga0496112_0033029 | |||
| 535 | Ga0496112_0686394 | |||
| 536 | Ga0496113_0152404 | |||
| 537 | Ga0496113_0202773 | |||
| 538 | Ga0496114_0066557 | |||
| 539 | Ga0501031_0000822 | |||
| 540 | Ga0501031_0020939 | |||
| 541 | Ga0501031_0091401 | |||
| 542 | Ga0501032_0004405 | |||
| 543 | Ga0501032_0090133 | |||
| 544 | Ga0501032_0265463 | |||
| 545 | Ga0501033_0000862 | |||
| 546 | Ga0501033_0004506 | |||
| 547 | Ga0501033_0253235 | |||
| 548 | Ga0501034_0307612 | |||
| 549 | Ga0501036_0000938 | |||
| 550 | Ga0501036_0002504 | |||
| 551 | Ga0501036_0057292 | |||
| 552 | Ga0501036_0149663 | |||
| 553 | Ga0501036_0184009 | |||
| 554 | Ga0501036_0331485 | |||
| 555 | Ga0501036_0386725 | |||
| 556 | Ga0501037_0003441 | |||
| 557 | Ga0501037_0055519 | |||
| 558 | Ga0501037_0066449 | |||
| 559 | Ga0501037_0107413 | |||
| 560 | Ga0501038_0000933 | |||
| 561 | Ga0501038_0011780 | |||
| 562 | Ga0501038_0161396 | |||
| 563 | Ga0501038_0288478 | |||
| 564 | Ga0501039_0001194 | |||
| 565 | Ga0501039_0003186 | |||
| 566 | Ga0501039_0029132 | |||
| 567 | Ga0501039_0065485 | |||
| 568 | Ga0501039_0134558 | |||
| 569 | Ga0501040_0003033 | |||
| 570 | Ga0501040_0007085 | |||
| 571 | Ga0501040_0007621 | |||
| 572 | Ga0501040_0020385 | |||
| 573 | Ga0501040_0116780 | |||
| 574 | Ga0501040_0129109 | |||
| 575 | Ga0501040_0150198 | |||
| 576 | Ga0501041_0000112 | |||
| 577 | Ga0501041_0001177 | |||
| 578 | Ga0501041_0018458 | |||
| 579 | Ga0501041_0155526 | |||
| 580 | Ga0501042_0000669 | |||
| 581 | Ga0501042_0000761 | |||
| 582 | Ga0501042_0007896 | |||
| 583 | Ga0501042_0057447 | |||
| 584 | Ga0501042_0080870 | |||
| 585 | Ga0501042_0099349 | |||
| 586 | Ga0501042_0137937 | |||
| 587 | Ga0501042_0245972 | |||
| 588 | Ga0501043_0096283 | |||
| 589 | Ga0501043_0522933 | |||
| 590 | Ga0501046_0007241 | |||
| 591 | Ga0501046_0008844 | |||
| 592 | Ga0501046_0042414 | |||
| 593 | Ga0501046_0076236 | |||
| 594 | Ga0501046_0450829 | |||
| 595 | Ga0501047_0000244 | |||
| 596 | Ga0501047_0042602 | |||
| 597 | Ga0501047_0412347 | |||
| 598 | Ga0501048_0000223 | |||
| 599 | Ga0501048_0003416 | |||
| 600 | Ga0501048_0016119 | |||
| 601 | Ga0501048_0032928 | |||
| 602 | Ga0501048_0038134 | |||
| 603 | Ga0501048_0049604 | |||
| 604 | Ga0501048_0094534 | |||
| 605 | Ga0501048_0102369 | |||
| 606 | Ga0501067_0007471 | |||
| 607 | Ga0501068_0000806 | |||
| 608 | Ga0501068_0008719 | |||
| 609 | Ga0501068_0013714 | |||
| 610 | Ga0501068_0082115 | |||
| 611 | Ga0501068_0293430 | |||
| 612 | Ga0501069_0000303 | |||
| 613 | Ga0501069_0016153 | |||
| 614 | Ga0501070_0028555 | |||
| 615 | Ga0501071_0000001 | |||
| 616 | Ga0501071_0001819 | |||
| 617 | Ga0501071_0019547 | |||
| 618 | Ga0501071_0021501 | |||
| 619 | Ga0501071_0041501 | |||
| 620 | Ga0501071_0088978 | |||
| 621 | Ga0501071_0218859 | |||
| 622 | Ga0501072_0000550 | |||
| 623 | Ga0501072_0004877 | |||
| 624 | Ga0501072_0051300 | |||
| 625 | Ga0501072_0072003 | |||
| 626 | Ga0501072_0216231 | |||
| 627 | Ga0501072_0305019 | |||
| 628 | Ga0501072_0316794 | |||
| 629 | Ga0501073_0001194 | |||
| 630 | Ga0501073_0044131 | |||
| 631 | Ga0501074_0001650 | |||
| 632 | Ga0501074_0003289 | |||
| 633 | Ga0501074_0036105 | |||
| 634 | Ga0501074_0133395 | |||
| 635 | Ga0501074_0211901 | |||
| 636 | Ga0501075_0001018 | |||
| 637 | Ga0501075_0013723 | |||
| 638 | Ga0501075_0031578 | |||
| 639 | Ga0501075_0056478 | |||
| 640 | Ga0501075_0071168 | |||
| 641 | Ga0501075_0146509 | |||
| 642 | Ga0501075_0321360 | |||
| 643 | Ga0501076_0000523 | |||
| 644 | Ga0501076_0001338 | |||
| 645 | Ga0501076_0001844 | |||
| 646 | Ga0501076_0019579 | |||
| 647 | Ga0501076_0054888 | |||
| 648 | Ga0501076_0106387 | |||
| 649 | Ga0501076_0163436 | |||
| 650 | Ga0501076_0222914 | |||
| 651 | Ga0501077_0000028 | |||
| 652 | Ga0501077_0002492 | |||
| 653 | Ga0501077_0032382 | |||
| 654 | Ga0501077_0087483 | |||
| 655 | Ga0501077_0093894 | |||
| 656 | Ga0501077_0210679 | |||
| 657 | Ga0501077_0236564 | |||
| 658 | Ga0501079_0000387 | |||
| 659 | Ga0501079_0003107 | |||
| 660 | Ga0501079_0035845 | |||
| 661 | Ga0501079_0088254 | |||
| 662 | Ga0501079_0167471 | |||
| 663 | Ga0501080_0000196 | |||
| 664 | Ga0501080_0001311 | |||
| 665 | Ga0501080_0006550 | |||
| 666 | Ga0501080_0088597 | |||
| 667 | Ga0501080_0124254 | |||
| 668 | Ga0501081_0000043 | |||
| 669 | Ga0501081_0000474 | |||
| 670 | Ga0501081_0002900 | |||
| 671 | Ga0501081_0007399 | |||
| 672 | Ga0501081_0105858 | |||
| 673 | Ga0501081_0133753 | |||
| 674 | Ga0501081_0141298 | |||
| 675 | Ga0501081_0474387 | |||
| 676 | Ga0501083_0000412 | |||
| 677 | Ga0501083_0063132 | |||
| 678 | Ga0501083_0090415 | |||
| 679 | Ga0501083_0111355 | |||
| 680 | Ga0501083_0318552 | |||
| 681 | Ga0501083_0370656 | |||
| 682 | Ga0501035_0001272 | |||
| 683 | Ga0501035_0010754 | |||
| 684 | Ga0501044_0031881 | |||
| 685 | Ga0501044_0425496 | |||
| 686 | Ga0501045_0000861 | |||
| 687 | Ga0501045_0002409 | |||
| 688 | Ga0501045_0028669 | |||
| 689 | Ga0501045_0069431 | |||
| 690 | Ga0501045_0215270 | |||
| 691 | nmdc:mga05p37_20661_c1 | |||
| 692 | nmdc:mga05p37_593120_c1 | |||
| 693 | nmdc:mga05p37_90_c1 | |||
| 694 | nmdc:mga05p37_92967_c1 | |||
| 695 | nmdc:mga09592_213979_c1 | |||
| 696 | nmdc:mga09592_40085_c1 | |||
| 697 | nmdc:mga0qj67_52668_c1 | |||
| 698 | nmdc:mga06r32_27200_c1 | |||
| 699 | nmdc:mga08y16_12163_c1 | |||
| 700 | nmdc:mga08y16_203654_c1 | |||
| 701 | nmdc:mga08y16_216610_c1 | |||
| 702 | nmdc:mga08y16_240216_c1 | |||
| 703 | nmdc:mga08y16_250707_c1 | |||
| 704 | nmdc:mga0n895_77846_c1 | |||
| 705 | nmdc:mga0a205_101872_c1 | |||
| 706 | nmdc:mga0a205_106569_c1 | |||
| 707 | nmdc:mga0a205_133929_c1 | |||
| 708 | Ga0495655_0019564 | |||
| 709 | Ga0501084_0000118 | |||
| 710 | Ga0501084_0005523 | |||
| 711 | Ga0501084_0011564 | |||
| 712 | Ga0501084_0018321 | |||
| 713 | Ga0501084_0028029 | |||
| 714 | Ga0501084_0032085 | |||
| 715 | Ga0501084_0033612 | |||
| 716 | Ga0501084_0039873 | |||
| 717 | Ga0501084_0097344 | |||
| 718 | Ga0590075_019121 | |||
| 719 | Ga0501082_0000585 | |||
| 720 | Ga0501082_0000720 | |||
| 721 | Ga0501082_0014712 | |||
| 722 | Ga0501082_0067157 | |||
| 723 | Ga0501082_0185596 | |||
| 724 | Ga0501082_0215962 | |||
| 725 | Ga0501082_0560874 | |||
| 726 | Ga0530510_0000507 | |||
| 727 | Ga0530510_0000855 | |||
| 728 | Ga0530510_0007107 | |||
| 729 | Ga0530510_0029677 | |||
| 730 | Ga0530510_0050002 | |||
| 731 | Ga0530510_0074206 | |||
| 732 | Ga0530510_0083502 | |||
| 733 | Ga0530510_0091159 | |||
| 734 | Ga0530510_0098409 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iwe-assembly1.cif.gz_A-2 | e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate | 0.9704 | 2 | 276 |
| 1xub-assembly1.cif.gz_A-2 | structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens | 0.9704 | 4 | 276 |
| 1u1x-assembly1.cif.gz_B | structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 | 0.9698 | 2 | 276 |
| 5iwe-assembly1.cif.gz_A-2 | e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate | 0.9636 | 2 | 276 |
| 1u1x-assembly1.cif.gz_B | structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 | 0.9629 | 2 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1u1vA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9519 | 5 | 117 | 3.10.310.10 |
| af_A0A1D8PQ54_137_280_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9137 | 122 | 251 | 3.10.310.10 |
| af_Q8NIL3_2_111_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9063 | 1 | 104 | 3.10.310.10 |
| 1u1vA02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9057 | 122 | 270 | 3.10.310.10 |
| 1u1vA02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8935 | 122 | 270 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0ZBI4-F1-model_v4 | PhzF family phenazine biosynthesis protein | 0.9888 | 1 | 125 |
GO:0005737
GO:0009058 GO:0016853 |
| AF-A0A7V9CUU8-F1-model_v4 | PhzF family phenazine biosynthesis protein | 0.9858 | 96 | 276 |
GO:0005737
GO:0009058 GO:0016853 |
| AF-A0A3G7BRD2-F1-model_v4 | deleted | 0.9831 | 4 | 276 |
|
| AF-A0A7W0T0A8-F1-model_v4 | PhzF family phenazine biosynthesis protein | 0.983 | 1 | 241 |
GO:0005737
GO:0009058 GO:0016853 |
| AF-A0A6B1QN50-F1-model_v4 | deleted | 0.979 | 4 | 276 |
|