F424505

General Info

Members Datasets Scaffolds Average Seq Length
367 179 734 149

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0039998|Ga0501067_0039998_866_1372
Length 168
Sequence MAASGGRRRSELGLRPMNCRFLTPGEIEMARSVFGDAIDYSKVRLFLGKWWPLQPRRSAMAPMGDIWFHPDGGGWSEDFSREPLSRQGFFIHELTHIWQTQKGGRFYLPLMRHPFCRYAYELKPGKSFDRYGLEQQAEIVRHRFLADRGAVVPTPPRDLLQFGQLTIV

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
173 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.81
Rhizosphere 95.64
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0039998 3300049583 Bacteria 2604
2 JGI24736J21556_1012968 3300001904 Bacteria 1347
3 JGI24740J21852_10012575 3300001979 Bacteria 3187
4 JGI24739J22299_10132985 3300001989 Unclassified 739
5 JGI24737J22298_10009947 3300001990 Bacteria 3147
6 JGI24737J22298_10018466 3300001990 Bacteria 2238
7 JGI24737J22298_10018836 3300001990 Bacteria 2211
8 JGI24735J21928_10014776 3300002067 Bacteria 2443
9 JGI24735J21928_10019441 3300002067 Bacteria 2088
10 JGI24750J21931_1051006 3300002070 Bacteria 646
11 JGI24738J21930_10093757 3300002075 Bacteria 637
12 Ga0065712_10210047 3300005290 Bacteria 1076
13 Ga0065715_10879904 3300005293 Bacteria 581
14 Ga0070658_10088712 3300005327 Bacteria 2546
15 Ga0070658_10495108 3300005327 Bacteria 1055
16 Ga0070658_10736074 3300005327 Bacteria 856
17 Ga0070658_10799527 3300005327 Bacteria 819
18 Ga0070658_10827453 3300005327 Bacteria 804
19 Ga0070658_11401678 3300005327 Bacteria 606
20 Ga0070676_10048569 3300005328 Bacteria 2481
21 Ga0070683_100003328 3300005329 Bacteria 12997
22 Ga0070670_100055255 3300005331 Bacteria 3408
23 Ga0070677_10165314 3300005333 Bacteria 1041
24 Ga0070677_10198498 3300005333 Bacteria 966
25 Ga0070666_10254372 3300005335 Bacteria 1244
26 Ga0070666_10663321 3300005335 Bacteria 763
27 Ga0070666_11317207 3300005335 Bacteria 539
28 Ga0070680_100056303 3300005336 Bacteria 3214
29 Ga0070682_100027163 3300005337 Bacteria 3433
30 Ga0070682_100301198 3300005337 Bacteria 1176
31 Ga0070682_100735669 3300005337 Bacteria 795
32 Ga0068868_101774268 3300005338 Bacteria 583
33 Ga0070660_100006360 3300005339 Bacteria 8185
34 Ga0070660_100190868 3300005339 Bacteria 1659
35 Ga0070660_100910984 3300005339 Bacteria 741
36 Ga0070689_100127109 3300005340 Bacteria 2041
37 Ga0070691_10015188 3300005341 Bacteria 3537
38 Ga0070687_100127931 3300005343 Bacteria 1463
39 Ga0070661_100004170 3300005344 Bacteria 9974
40 Ga0070661_100044324 3300005344 Bacteria 3250
41 Ga0070661_100111030 3300005344 Bacteria 2047
42 Ga0070661_100359048 3300005344 Bacteria 1145
43 Ga0070661_100521515 3300005344 Bacteria 953
44 Ga0070661_101057907 3300005344 Bacteria 675
45 Ga0070661_101184773 3300005344 Bacteria 638
46 Ga0070692_10370557 3300005345 Bacteria 895
47 Ga0070692_10415651 3300005345 Bacteria 853
48 Ga0070668_100072391 3300005347 Bacteria 2685
49 Ga0070668_100801898 3300005347 Bacteria 836
50 Ga0070668_100898225 3300005347 Bacteria 792
51 Ga0070669_100451108 3300005353 Bacteria 1060
52 Ga0070669_100554131 3300005353 Bacteria 959
53 Ga0070669_101909271 3300005353 Unclassified 519
54 Ga0070675_100062310 3300005354 Bacteria 3082
55 Ga0070675_100269179 3300005354 Bacteria 1495
56 Ga0070674_100547443 3300005356 Bacteria 970
57 Ga0070673_100845902 3300005364 Bacteria 846
58 Ga0070659_100003152 3300005366 Bacteria 11748
59 Ga0070659_100027443 3300005366 Bacteria 4387
60 Ga0070659_100066137 3300005366 Bacteria 2864
61 Ga0070659_100364969 3300005366 Bacteria 1214
62 Ga0070659_101390301 3300005366 Bacteria 624
63 Ga0070667_100008677 3300005367 Bacteria 8422
64 Ga0070663_100019623 3300005455 Bacteria 4461
65 Ga0070663_100089727 3300005455 Bacteria 2275
66 Ga0070663_100218381 3300005455 Unclassified 1496
67 Ga0070663_100512743 3300005455 Bacteria 997
68 Ga0070663_100565020 3300005455 Bacteria 952
69 Ga0070678_100095667 3300005456 Bacteria 2289
70 Ga0070678_100254909 3300005456 Bacteria 1473
71 Ga0070678_100267798 3300005456 Bacteria 1439
72 Ga0070662_100001109 3300005457 Bacteria 16441
73 Ga0070662_100073621 3300005457 Bacteria 2524
74 Ga0070662_100133603 3300005457 Bacteria 1916
75 Ga0070662_100173189 3300005457 Bacteria 1696
76 Ga0070662_100209523 3300005457 Bacteria 1550
77 Ga0070662_101209872 3300005457 Bacteria 649
78 Ga0070681_10500269 3300005458 Bacteria 1128
79 Ga0068867_100214357 3300005459 Bacteria 1548
80 Ga0068867_100451188 3300005459 Bacteria 1096
81 Ga0068867_100752979 3300005459 Bacteria 865
82 Ga0070679_100149901 3300005530 Bacteria 2309
83 Ga0070679_100803822 3300005530 Bacteria 884
84 Ga0070679_100941477 3300005530 Bacteria 807
85 Ga0070684_100016486 3300005535 Bacteria 6039
86 Ga0070684_100079685 3300005535 Bacteria 2896
87 Ga0070684_100690037 3300005535 Bacteria 952
88 Ga0068853_100054401 3300005539 Bacteria 3449
89 Ga0068853_100224568 3300005539 Bacteria 1716
90 Ga0068853_100363966 3300005539 Bacteria 1348
91 Ga0070672_100021076 3300005543 Bacteria 4765
92 Ga0070672_100326780 3300005543 Bacteria 1304
93 Ga0070672_100443458 3300005543 Bacteria 1117
94 Ga0070686_100095445 3300005544 Bacteria 1998
95 Ga0070686_100161404 3300005544 Bacteria 1579
96 Ga0070665_100010648 3300005548 Bacteria 9310
97 Ga0070665_100064290 3300005548 Bacteria 3679
98 Ga0068855_100118934 3300005563 Bacteria 3025
99 Ga0068855_100895548 3300005563 Bacteria 938
100 Ga0070664_100010325 3300005564 Bacteria 7578
101 Ga0070664_101410759 3300005564 Bacteria 658
102 Ga0068857_100012004 3300005577 Bacteria 7535
103 Ga0068854_100008993 3300005578 Bacteria 6438
104 Ga0068854_100062927 3300005578 Bacteria 2692
105 Ga0068854_100321456 3300005578 Bacteria 1258
106 Ga0068854_100519088 3300005578 Bacteria 1006
107 Ga0068854_101089983 3300005578 Bacteria 711
108 Ga0068856_100268653 3300005614 Bacteria 1721
109 Ga0068852_100353991 3300005616 Bacteria 1434
110 Ga0068852_100510248 3300005616 Bacteria 1198
111 Ga0068852_101005593 3300005616 Bacteria 852
112 Ga0068864_100723892 3300005618 Bacteria 973
113 Ga0068866_10083405 3300005718 Bacteria 1722
114 Ga0068866_10109110 3300005718 Bacteria 1541
115 Ga0068851_10008872 3300005834 Bacteria 4663
116 Ga0068851_10429446 3300005834 Bacteria 781
117 Ga0068858_100685802 3300005842 Bacteria 996
118 Ga0068860_100005377 3300005843 Bacteria 12991
119 Ga0068860_101309727 3300005843 Bacteria 745
120 Ga0068862_100346361 3300005844 Bacteria 1377
121 Ga0070717_10430978 3300006028 Bacteria 1187
122 Ga0075433_10004632 3300006852 Bacteria 10733
123 Ga0075434_101311980 3300006871 Bacteria 734
124 Ga0075435_100033839 3300007076 Bacteria 4044
125 Ga0105240_10022900 3300009093 Bacteria 8275
126 Ga0105243_10397836 3300009148 Bacteria 1279
127 Ga0105241_10050041 3300009174 Bacteria 3184
128 Ga0105241_10053950 3300009174 Bacteria 3076
129 Ga0105242_10565836 3300009176 Bacteria 1092
130 Ga0105242_10680793 3300009176 Bacteria 1004
131 Ga0105242_10980512 3300009176 Bacteria 851
132 Ga0105248_10254204 3300009177 Bacteria 1978
133 Ga0105248_10434862 3300009177 Bacteria 1478
134 Ga0105238_10052671 3300009551 Bacteria 4091
135 Ga0105238_10392862 3300009551 Bacteria 1379
136 Ga0105238_11277415 3300009551 Bacteria 760
137 Ga0105249_10022886 3300009553 Bacteria 5602
138 Ga0105239_10065655 3300010375 Bacteria 3986
139 Ga0105246_10615026 3300011119 Bacteria 941
140 Ga0105246_10745464 3300011119 Bacteria 863
141 Ga0157327_1005241 3300012512 Bacteria 1041
142 Ga0157373_10009302 3300013100 Bacteria 7264
143 Ga0157373_10045587 3300013100 Bacteria 3129
144 Ga0157373_10077840 3300013100 Bacteria 2339
145 Ga0157371_10030148 3300013102 Bacteria 3914
146 Ga0157371_10043383 3300013102 Bacteria 3204
147 Ga0157371_10102739 3300013102 Bacteria 2028
148 Ga0157371_10129329 3300013102 Bacteria 1796
149 Ga0157371_10486450 3300013102 Bacteria 910
150 Ga0157371_10731869 3300013102 Bacteria 742
151 Ga0157371_10988698 3300013102 Bacteria 641
152 Ga0157370_10002107 3300013104 Bacteria 24312
153 Ga0157370_10118568 3300013104 Bacteria 2472
154 Ga0157370_11615962 3300013104 Bacteria 582
155 Ga0157369_10039934 3300013105 Bacteria 5126
156 Ga0157374_10087375 3300013296 Bacteria 2967
157 Ga0157378_10556378 3300013297 Bacteria 1153
158 Ga0157378_11513364 3300013297 Bacteria 716
159 Ga0163162_10004515 3300013306 Bacteria 13403
160 Ga0163162_10058143 3300013306 Bacteria 3895
161 Ga0163162_10480243 3300013306 Bacteria 1374
162 Ga0163162_10991003 3300013306 Bacteria 950
163 Ga0163162_11523519 3300013306 Bacteria 762
164 Ga0157372_11003943 3300013307 Bacteria 967
165 Ga0157372_11147495 3300013307 Bacteria 898
166 Ga0157372_11389607 3300013307 Bacteria 809
167 Ga0157375_10018640 3300013308 Bacteria 6297
168 Ga0157375_10383451 3300013308 Bacteria 1572
169 Ga0157375_10606942 3300013308 Bacteria 1253
170 Ga0163163_10012804 3300014325 Bacteria 7654
171 Ga0157377_10480798 3300014745 Bacteria 864
172 Ga0157379_10286576 3300014968 Bacteria 1499
173 Ga0163161_10234357 3300017792 Bacteria 1425
174 Ga0207697_10092621 3300025315 Bacteria 1281
175 Ga0207656_10645240 3300025321 Unclassified 541
176 Ga0207688_10143471 3300025901 Bacteria 1407
177 Ga0207688_10156844 3300025901 Bacteria 1347
178 Ga0207680_10153505 3300025903 Bacteria 1537
179 Ga0207680_10447338 3300025903 Bacteria 917
180 Ga0207680_11189353 3300025903 Bacteria 544
181 Ga0207647_10000439 3300025904 Bacteria 34042
182 Ga0207647_10005046 3300025904 Bacteria 9734
183 Ga0207647_10047693 3300025904 Bacteria 2663
184 Ga0207647_10078724 3300025904 Bacteria 1980
185 Ga0207705_10002166 3300025909 Bacteria 15203
186 Ga0207705_10006319 3300025909 Bacteria 8795
187 Ga0207705_10012203 3300025909 Bacteria 6209
188 Ga0207705_10053461 3300025909 Bacteria 2909
189 Ga0207705_10174602 3300025909 Bacteria 1619
190 Ga0207695_10141484 3300025913 Bacteria 2354
191 Ga0207660_10054337 3300025917 Bacteria 2858
192 Ga0207662_10069899 3300025918 Bacteria 2122
193 Ga0207657_10001850 3300025919 Bacteria 22857
194 Ga0207657_10009723 3300025919 Bacteria 9643
195 Ga0207657_10014323 3300025919 Bacteria 7746
196 Ga0207657_10022060 3300025919 Bacteria 5976
197 Ga0207657_10165089 3300025919 Bacteria 1797
198 Ga0207657_10232592 3300025919 Bacteria 1473
199 Ga0207649_10056798 3300025920 Bacteria 2445
200 Ga0207649_10150605 3300025920 Bacteria 1602
201 Ga0207649_10179412 3300025920 Bacteria 1481
202 Ga0207649_10180806 3300025920 Bacteria 1476
203 Ga0207649_10377805 3300025920 Bacteria 1055
204 Ga0207649_10596307 3300025920 Bacteria 849
205 Ga0207652_10111789 3300025921 Bacteria 2423
206 Ga0207652_10147512 3300025921 Bacteria 2106
207 Ga0207681_10387573 3300025923 Bacteria 1126
208 Ga0207681_10714928 3300025923 Bacteria 833
209 Ga0207694_10419542 3300025924 Bacteria 1114
210 Ga0207650_10026007 3300025925 Bacteria 4172
211 Ga0207650_10084344 3300025925 Bacteria 2415
212 Ga0207650_10177308 3300025925 Bacteria 1697
213 Ga0207659_10022806 3300025926 Bacteria 4172
214 Ga0207659_10210461 3300025926 Bacteria 1558
215 Ga0207687_10018799 3300025927 Bacteria 4568
216 Ga0207700_10038154 3300025928 Bacteria 3485
217 Ga0207664_10023835 3300025929 Bacteria 4592
218 Ga0207644_10218693 3300025931 Bacteria 1509
219 Ga0207644_11114450 3300025931 Bacteria 663
220 Ga0207690_10006308 3300025932 Bacteria 7025
221 Ga0207690_10131500 3300025932 Bacteria 1832
222 Ga0207690_10141308 3300025932 Bacteria 1774
223 Ga0207706_10060725 3300025933 Bacteria 3329
224 Ga0207706_10080130 3300025933 Bacteria 2871
225 Ga0207706_10087974 3300025933 Bacteria 2732
226 Ga0207706_10474146 3300025933 Bacteria 1081
227 Ga0207706_10659262 3300025933 Bacteria 896
228 Ga0207669_10021385 3300025937 Bacteria 3415
229 Ga0207669_10487990 3300025937 Bacteria 983
230 Ga0207691_10012814 3300025940 Bacteria 8026
231 Ga0207691_10049576 3300025940 Bacteria 3847
232 Ga0207691_10079751 3300025940 Bacteria 2946
233 Ga0207711_10013893 3300025941 Bacteria 6687
234 Ga0207711_10459289 3300025941 Bacteria 1186
235 Ga0207689_10005893 3300025942 Bacteria 10855
236 Ga0207679_10059715 3300025945 Bacteria 2830
237 Ga0207679_10098947 3300025945 Bacteria 2276
238 Ga0207667_10008016 3300025949 Bacteria 12599
239 Ga0207667_10014965 3300025949 Bacteria 8823
240 Ga0207667_10355916 3300025949 Bacteria 1493
241 Ga0207651_10036981 3300025960 Bacteria 3193
242 Ga0207712_10000474 3300025961 Bacteria 33783
243 Ga0207640_10301499 3300025981 Bacteria 1268
244 Ga0207658_10040806 3300025986 Bacteria 3357
245 Ga0207703_11303243 3300026035 Bacteria 698
246 Ga0207639_10243230 3300026041 Bacteria 1566
247 Ga0207639_10308185 3300026041 Bacteria 1402
248 Ga0207678_10005331 3300026067 Bacteria 11514
249 Ga0207678_10015941 3300026067 Bacteria 6600
250 Ga0207678_10122048 3300026067 Bacteria 2223
251 Ga0207678_10516014 3300026067 Bacteria 1043
252 Ga0207678_10530123 3300026067 Bacteria 1028
253 Ga0207702_10005305 3300026078 Bacteria 11307
254 Ga0207641_10027326 3300026088 Bacteria 4713
255 Ga0207676_10951843 3300026095 Bacteria 844
256 Ga0207674_10012577 3300026116 Bacteria 9457
257 Ga0207683_10135707 3300026121 Bacteria 2215
258 Ga0207683_10141182 3300026121 Bacteria 2170
259 Ga0207683_10263015 3300026121 Bacteria 1575
260 Ga0207683_10396895 3300026121 Bacteria 1269
261 Ga0207698_10004251 3300026142 Bacteria 8712
262 Ga0207698_10110153 3300026142 Bacteria 2306
263 Ga0207698_10680812 3300026142 Bacteria 1022
264 Ga0268266_10000318 3300028379 Bacteria 76400
265 Ga0268266_10031646 3300028379 Bacteria 4493
266 Ga0268266_11039667 3300028379 Bacteria 792
267 Ga0268265_10339374 3300028380 Bacteria 1367
268 Ga0268264_10003173 3300028381 Bacteria 14239
269 Ga0307408_100289759 3300031548 Bacteria 1367
270 Ga0307405_10006113 3300031731 Bacteria 5892
271 Ga0307405_10099645 3300031731 Bacteria 1945
272 Ga0307413_10005558 3300031824 Bacteria 5643
273 Ga0307410_10003822 3300031852 Bacteria 7651
274 Ga0307406_10002502 3300031901 Bacteria 10015
275 Ga0307407_10120760 3300031903 Bacteria 1661
276 Ga0307407_10233671 3300031903 Bacteria 1250
277 Ga0307412_10154669 3300031911 Bacteria 1696
278 Ga0307412_10342457 3300031911 Bacteria 1197
279 Ga0307409_100010125 3300031995 Bacteria 5838
280 Ga0307409_100010457 3300031995 Bacteria 5773
281 Ga0307409_101193270 3300031995 Bacteria 784
282 Ga0307416_100020644 3300032002 Bacteria 4706
283 Ga0307416_100047290 3300032002 Bacteria 3404
284 Ga0307416_100756660 3300032002 Bacteria 1064
285 Ga0307414_10123538 3300032004 Bacteria 1995
286 Ga0307411_10008797 3300032005 Bacteria 5255
287 Ga0307411_10149615 3300032005 Bacteria 1733
288 Ga0307411_10259412 3300032005 Bacteria 1371
289 Ga0307415_100067193 3300032126 Bacteria 2504
290 Ga0307415_100101447 3300032126 Bacteria 2112
291 Ga0373941_0101902 3300035115 Bacteria 1001
292 Ga0395899_0002935 3300037312 Bacteria 13677
293 Ga0395899_0019879 3300037312 Bacteria 5095
294 Ga0395899_0070171 3300037312 Bacteria 2564
295 Ga0395899_0077235 3300037312 Bacteria 2429
296 Ga0395900_0000432 3300037418 Bacteria 60134
297 Ga0395900_0026705 3300037418 Bacteria 5910
298 Ga0395900_0061087 3300037418 Bacteria 3876
299 Ga0395900_0077414 3300037418 Bacteria 3416
300 Ga0395900_0122340 3300037418 Bacteria 2669
301 Ga0395900_0376780 3300037418 Bacteria 1388
302 Ga0395900_0675815 3300037418 Bacteria 967
303 Ga0395900_0988763 3300037418 Bacteria 762
304 Ga0395900_1019172 3300037418 Bacteria 747
305 Ga0395898_0000021 3300037466 Bacteria 393971
306 Ga0395898_0082041 3300037466 Bacteria 3108
307 Ga0395898_0087989 3300037466 Bacteria 2991
308 Ga0395898_0165772 3300037466 Bacteria 2113
309 Ga0395905_0000413 3300037471 Bacteria 60132
310 Ga0395905_0015198 3300037471 Bacteria 7321
311 Ga0395905_0019058 3300037471 Bacteria 6508
312 Ga0395905_0034459 3300037471 Bacteria 4753
313 Ga0395905_0174247 3300037471 Bacteria 2020
314 Ga0395905_0198827 3300037471 Bacteria 1879
315 Ga0395905_0256761 3300037471 Bacteria 1632
316 Ga0395905_0752389 3300037471 Bacteria 877
317 Ga0395901_0000476 3300038443 Bacteria 46589
318 Ga0395901_0091926 3300038443 Bacteria 3176
319 Ga0395901_0116507 3300038443 Bacteria 2806
320 Ga0395901_0166107 3300038443 Bacteria 2317
321 Ga0395901_0259573 3300038443 Bacteria 1808
322 Ga0395901_0290073 3300038443 Bacteria 1698
323 Ga0395901_0373010 3300038443 Bacteria 1469
324 Ga0395901_0448095 3300038443 Bacteria 1320
325 Ga0395901_1400997 3300038443 Bacteria 657
326 Ga0451802_0056686 3300041460 Bacteria 715
327 Ga0451851_0523475 3300041507 Bacteria 795
328 Ga0439432_030800 3300042006 Bacteria 1738
329 Ga0439449_0061419 3300042007 Bacteria 1386
330 Ga0466966_0025739 3300044684 Bacteria 3843
331 Ga0466961_0160845 3300044693 Bacteria 1399
332 Ga0466963_0010269 3300044694 Bacteria 5665
333 Ga0466971_0024193 3300044719 Bacteria 2709
334 Ga0466970_0063304 3300044765 Bacteria 1983
335 Ga0466970_0315887 3300044765 Bacteria 883
336 Ga0466957_0020012 3300044842 Bacteria 3939
337 Ga0466959_0136044 3300045049 Bacteria 1739
338 Ga0466959_0151102 3300045049 Bacteria 1637
339 Ga0466967_0192325 3300045976 Bacteria 1929
340 Ga0495642_0044155 3300046528 Bacteria 1819
341 Ga0495669_0016376 3300046684 Bacteria 3174
342 Ga0495677_0001481 3300047445 Bacteria 9425
343 Ga0495685_096712 3300047447 Bacteria 976
344 Ga0496100_0545935 3300048903 Bacteria 896
345 Ga0496107_0669782 3300048910 Bacteria 764
346 Ga0496108_0164456 3300048911 Bacteria 1918
347 Ga0496108_0378522 3300048911 Bacteria 1236
348 Ga0496109_0002175 3300048912 Bacteria 16290
349 Ga0496109_0208340 3300048912 Bacteria 1838
350 Ga0496110_0552266 3300048913 Bacteria 1047
351 Ga0496111_0033556 3300048914 Bacteria 3662
352 Ga0496111_0127610 3300048914 Bacteria 1881
353 Ga0496111_0614248 3300048914 Bacteria 795
354 Ga0496112_0004603 3300048915 Bacteria 11731
355 Ga0496113_0002011 3300048916 Bacteria 11667
356 Ga0496114_0000023 3300048917 Bacteria 219092
357 Ga0501069_0241226 3300049585 Bacteria 1053
358 Ga0501223_009215 3300049663 Bacteria 2003
359 Ga0501233_024676 3300049668 Bacteria 1316
360 Ga0501272_009882 3300049769 Bacteria 1060
361 nmdc:mga0n895_886149_c1 3300050512 Bacteria 878
362 nmdc:mga0rr50_131571_c1 3300050513 Bacteria 2004
363 nmdc:mga08x19_434397_c1 3300050514 Bacteria 923
364 nmdc:mga0a205_1162302_c1 3300050515 Bacteria 619
365 Ga0466962_0018044 3300061719 Bacteria 3394
366 Ga0466962_0019709 3300061719 Bacteria 3241
367 2848299861 2848297114 Bacteria 3608511
368 Ga0501067_0039998
369 JGI24736J21556_1012968
370 JGI24740J21852_10012575
371 JGI24739J22299_10132985
372 JGI24737J22298_10009947
373 JGI24737J22298_10018466
374 JGI24737J22298_10018836
375 JGI24735J21928_10014776
376 JGI24735J21928_10019441
377 JGI24750J21931_1051006
378 JGI24738J21930_10093757
379 Ga0065712_10210047
380 Ga0065715_10879904
381 Ga0070658_10088712
382 Ga0070658_10495108
383 Ga0070658_10736074
384 Ga0070658_10799527
385 Ga0070658_10827453
386 Ga0070658_11401678
387 Ga0070676_10048569
388 Ga0070683_100003328
389 Ga0070670_100055255
390 Ga0070677_10165314
391 Ga0070677_10198498
392 Ga0070666_10254372
393 Ga0070666_10663321
394 Ga0070666_11317207
395 Ga0070680_100056303
396 Ga0070682_100027163
397 Ga0070682_100301198
398 Ga0070682_100735669
399 Ga0068868_101774268
400 Ga0070660_100006360
401 Ga0070660_100190868
402 Ga0070660_100910984
403 Ga0070689_100127109
404 Ga0070691_10015188
405 Ga0070687_100127931
406 Ga0070661_100004170
407 Ga0070661_100044324
408 Ga0070661_100111030
409 Ga0070661_100359048
410 Ga0070661_100521515
411 Ga0070661_101057907
412 Ga0070661_101184773
413 Ga0070692_10370557
414 Ga0070692_10415651
415 Ga0070668_100072391
416 Ga0070668_100801898
417 Ga0070668_100898225
418 Ga0070669_100451108
419 Ga0070669_100554131
420 Ga0070669_101909271
421 Ga0070675_100062310
422 Ga0070675_100269179
423 Ga0070674_100547443
424 Ga0070673_100845902
425 Ga0070659_100003152
426 Ga0070659_100027443
427 Ga0070659_100066137
428 Ga0070659_100364969
429 Ga0070659_101390301
430 Ga0070667_100008677
431 Ga0070663_100019623
432 Ga0070663_100089727
433 Ga0070663_100218381
434 Ga0070663_100512743
435 Ga0070663_100565020
436 Ga0070678_100095667
437 Ga0070678_100254909
438 Ga0070678_100267798
439 Ga0070662_100001109
440 Ga0070662_100073621
441 Ga0070662_100133603
442 Ga0070662_100173189
443 Ga0070662_100209523
444 Ga0070662_101209872
445 Ga0070681_10500269
446 Ga0068867_100214357
447 Ga0068867_100451188
448 Ga0068867_100752979
449 Ga0070679_100149901
450 Ga0070679_100803822
451 Ga0070679_100941477
452 Ga0070684_100016486
453 Ga0070684_100079685
454 Ga0070684_100690037
455 Ga0068853_100054401
456 Ga0068853_100224568
457 Ga0068853_100363966
458 Ga0070672_100021076
459 Ga0070672_100326780
460 Ga0070672_100443458
461 Ga0070686_100095445
462 Ga0070686_100161404
463 Ga0070665_100010648
464 Ga0070665_100064290
465 Ga0068855_100118934
466 Ga0068855_100895548
467 Ga0070664_100010325
468 Ga0070664_101410759
469 Ga0068857_100012004
470 Ga0068854_100008993
471 Ga0068854_100062927
472 Ga0068854_100321456
473 Ga0068854_100519088
474 Ga0068854_101089983
475 Ga0068856_100268653
476 Ga0068852_100353991
477 Ga0068852_100510248
478 Ga0068852_101005593
479 Ga0068864_100723892
480 Ga0068866_10083405
481 Ga0068866_10109110
482 Ga0068851_10008872
483 Ga0068851_10429446
484 Ga0068858_100685802
485 Ga0068860_100005377
486 Ga0068860_101309727
487 Ga0068862_100346361
488 Ga0070717_10430978
489 Ga0075433_10004632
490 Ga0075434_101311980
491 Ga0075435_100033839
492 Ga0105240_10022900
493 Ga0105243_10397836
494 Ga0105241_10050041
495 Ga0105241_10053950
496 Ga0105242_10565836
497 Ga0105242_10680793
498 Ga0105242_10980512
499 Ga0105248_10254204
500 Ga0105248_10434862
501 Ga0105238_10052671
502 Ga0105238_10392862
503 Ga0105238_11277415
504 Ga0105249_10022886
505 Ga0105239_10065655
506 Ga0105246_10615026
507 Ga0105246_10745464
508 Ga0157327_1005241
509 Ga0157373_10009302
510 Ga0157373_10045587
511 Ga0157373_10077840
512 Ga0157371_10030148
513 Ga0157371_10043383
514 Ga0157371_10102739
515 Ga0157371_10129329
516 Ga0157371_10486450
517 Ga0157371_10731869
518 Ga0157371_10988698
519 Ga0157370_10002107
520 Ga0157370_10118568
521 Ga0157370_11615962
522 Ga0157369_10039934
523 Ga0157374_10087375
524 Ga0157378_10556378
525 Ga0157378_11513364
526 Ga0163162_10004515
527 Ga0163162_10058143
528 Ga0163162_10480243
529 Ga0163162_10991003
530 Ga0163162_11523519
531 Ga0157372_11003943
532 Ga0157372_11147495
533 Ga0157372_11389607
534 Ga0157375_10018640
535 Ga0157375_10383451
536 Ga0157375_10606942
537 Ga0163163_10012804
538 Ga0157377_10480798
539 Ga0157379_10286576
540 Ga0163161_10234357
541 Ga0207697_10092621
542 Ga0207656_10645240
543 Ga0207688_10143471
544 Ga0207688_10156844
545 Ga0207680_10153505
546 Ga0207680_10447338
547 Ga0207680_11189353
548 Ga0207647_10000439
549 Ga0207647_10005046
550 Ga0207647_10047693
551 Ga0207647_10078724
552 Ga0207705_10002166
553 Ga0207705_10006319
554 Ga0207705_10012203
555 Ga0207705_10053461
556 Ga0207705_10174602
557 Ga0207695_10141484
558 Ga0207660_10054337
559 Ga0207662_10069899
560 Ga0207657_10001850
561 Ga0207657_10009723
562 Ga0207657_10014323
563 Ga0207657_10022060
564 Ga0207657_10165089
565 Ga0207657_10232592
566 Ga0207649_10056798
567 Ga0207649_10150605
568 Ga0207649_10179412
569 Ga0207649_10180806
570 Ga0207649_10377805
571 Ga0207649_10596307
572 Ga0207652_10111789
573 Ga0207652_10147512
574 Ga0207681_10387573
575 Ga0207681_10714928
576 Ga0207694_10419542
577 Ga0207650_10026007
578 Ga0207650_10084344
579 Ga0207650_10177308
580 Ga0207659_10022806
581 Ga0207659_10210461
582 Ga0207687_10018799
583 Ga0207700_10038154
584 Ga0207664_10023835
585 Ga0207644_10218693
586 Ga0207644_11114450
587 Ga0207690_10006308
588 Ga0207690_10131500
589 Ga0207690_10141308
590 Ga0207706_10060725
591 Ga0207706_10080130
592 Ga0207706_10087974
593 Ga0207706_10474146
594 Ga0207706_10659262
595 Ga0207669_10021385
596 Ga0207669_10487990
597 Ga0207691_10012814
598 Ga0207691_10049576
599 Ga0207691_10079751
600 Ga0207711_10013893
601 Ga0207711_10459289
602 Ga0207689_10005893
603 Ga0207679_10059715
604 Ga0207679_10098947
605 Ga0207667_10008016
606 Ga0207667_10014965
607 Ga0207667_10355916
608 Ga0207651_10036981
609 Ga0207712_10000474
610 Ga0207640_10301499
611 Ga0207658_10040806
612 Ga0207703_11303243
613 Ga0207639_10243230
614 Ga0207639_10308185
615 Ga0207678_10005331
616 Ga0207678_10015941
617 Ga0207678_10122048
618 Ga0207678_10516014
619 Ga0207678_10530123
620 Ga0207702_10005305
621 Ga0207641_10027326
622 Ga0207676_10951843
623 Ga0207674_10012577
624 Ga0207683_10135707
625 Ga0207683_10141182
626 Ga0207683_10263015
627 Ga0207683_10396895
628 Ga0207698_10004251
629 Ga0207698_10110153
630 Ga0207698_10680812
631 Ga0268266_10000318
632 Ga0268266_10031646
633 Ga0268266_11039667
634 Ga0268265_10339374
635 Ga0268264_10003173
636 Ga0307408_100289759
637 Ga0307405_10006113
638 Ga0307405_10099645
639 Ga0307413_10005558
640 Ga0307410_10003822
641 Ga0307406_10002502
642 Ga0307407_10120760
643 Ga0307407_10233671
644 Ga0307412_10154669
645 Ga0307412_10342457
646 Ga0307409_100010125
647 Ga0307409_100010457
648 Ga0307409_101193270
649 Ga0307416_100020644
650 Ga0307416_100047290
651 Ga0307416_100756660
652 Ga0307414_10123538
653 Ga0307411_10008797
654 Ga0307411_10149615
655 Ga0307411_10259412
656 Ga0307415_100067193
657 Ga0307415_100101447
658 Ga0373941_0101902
659 Ga0395899_0002935
660 Ga0395899_0019879
661 Ga0395899_0070171
662 Ga0395899_0077235
663 Ga0395900_0000432
664 Ga0395900_0026705
665 Ga0395900_0061087
666 Ga0395900_0077414
667 Ga0395900_0122340
668 Ga0395900_0376780
669 Ga0395900_0675815
670 Ga0395900_0988763
671 Ga0395900_1019172
672 Ga0395898_0000021
673 Ga0395898_0082041
674 Ga0395898_0087989
675 Ga0395898_0165772
676 Ga0395905_0000413
677 Ga0395905_0015198
678 Ga0395905_0019058
679 Ga0395905_0034459
680 Ga0395905_0174247
681 Ga0395905_0198827
682 Ga0395905_0256761
683 Ga0395905_0752389
684 Ga0395901_0000476
685 Ga0395901_0091926
686 Ga0395901_0116507
687 Ga0395901_0166107
688 Ga0395901_0259573
689 Ga0395901_0290073
690 Ga0395901_0373010
691 Ga0395901_0448095
692 Ga0395901_1400997
693 Ga0451802_0056686
694 Ga0451851_0523475
695 Ga0439432_030800
696 Ga0439449_0061419
697 Ga0466966_0025739
698 Ga0466961_0160845
699 Ga0466963_0010269
700 Ga0466971_0024193
701 Ga0466970_0063304
702 Ga0466970_0315887
703 Ga0466957_0020012
704 Ga0466959_0136044
705 Ga0466959_0151102
706 Ga0466967_0192325
707 Ga0495642_0044155
708 Ga0495669_0016376
709 Ga0495677_0001481
710 Ga0495685_096712
711 Ga0496100_0545935
712 Ga0496107_0669782
713 Ga0496108_0164456
714 Ga0496108_0378522
715 Ga0496109_0002175
716 Ga0496109_0208340
717 Ga0496110_0552266
718 Ga0496111_0033556
719 Ga0496111_0127610
720 Ga0496111_0614248
721 Ga0496112_0004603
722 Ga0496113_0002011
723 Ga0496114_0000023
724 Ga0501069_0241226
725 Ga0501223_009215
726 Ga0501233_024676
727 Ga0501272_009882
728 nmdc:mga0n895_886149_c1
729 nmdc:mga0rr50_131571_c1
730 nmdc:mga08x19_434397_c1
731 nmdc:mga0a205_1162302_c1
732 Ga0466962_0018044
733 Ga0466962_0019709
734 2848299861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h56-assembly1.cif.gz_B effector domain of pseudomonas aeruginosa vgrg2b 0.8514 1 128
6h56-assembly1.cif.gz_B effector domain of pseudomonas aeruginosa vgrg2b 0.7587 1 128
1bqb-assembly1.cif.gz_A aureolysin, staphylococcus aureus metalloproteinase 0.5124 4 126
1rm8-assembly1.cif.gz_A crystal structure of the catalytic domain of mmp-16/mt3-mmp: characterization of mt-mmp specific features 0.505 1 76
6zxl-assembly1.cif.gz_I fully-loaded anthrax lethal toxin in its heptameric pre-pore state and pa7lf(2+1a) arrangement 0.4833 32 127
ID Description Score Start End Superfamily
af_A0A1D6I433_58_177_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6384 2 81 3.30.2010.10
af_P0C7Q8_321_527_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.609 44 87 1.10.390.10
af_P40462_237_491_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.5982 6 128 1.10.390.10
af_Q9VD87_240_494_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.583 5 77 1.10.390.10
af_A0A0P0Y966_34_214_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5581 2 79 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A4V1SSY2-F1-model_v4 Vgr related protein 0.9809 7 60
AF-A0A5D9CB16-F1-model_v4 Uncharacterized protein 0.9592 1 74
AF-A0A4V1SSY2-F1-model_v4 Vgr related protein 0.9467 7 60
AF-A0A255MRM0-F1-model_v4 deleted 0.9386 1 82
AF-A0A4S5BPQ4-F1-model_v4 DUF4157 domain-containing protein 0.9348 1 83

Map