F424416

General Info

Members Datasets Scaffolds Average Seq Length
367 181 367 330

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0030204|Ga0395898_0030204_140_1222
Length 360
Sequence VDRGELHSGDDDPLARGGQVAGALDEEVDVNRVGVTGAAGFIGSHLCERLLAEDVEVVGVDDLSYGSMANIAHLLEHPGFRFEVLDCTRRRALRAAFAGCDSIAHLAAKKIPRFGGTLSTLEVNVAGVNAACAVALSLDADIIVTSTSDVYGNAKPPFAEDGELVIGPPTTKRWAYAVSKMYDEHVALALAEEKGLRTTILRLFNAYGPRNHPTWWGGPTVTFIESLLDGQSMEIHGDGRQTRTFTYVTDTVDGFVRALERPEARGEVVNVGGTETLTILELAERIQEGLGVPLPLRAGFIPYESFPGRYQDVRHRVPDTSKAVRLLGFEAIVPFAQGLAQTIAWHRERRGVTRQTAARG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 7.08
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10027448 3300003373 Bacteria 1476
2 Ga0070658_10123722 3300005327 Unclassified 2151
3 Ga0070680_100131175 3300005336 Bacteria 2097
4 Ga0068868_100080753 3300005338 Bacteria 2606
5 Ga0070668_100003934 3300005347 Bacteria 10980
6 Ga0070675_100195446 3300005354 Bacteria 1754
7 Ga0070659_100026978 3300005366 Bacteria 4423
8 Ga0070709_10051684 3300005434 Bacteria 2580
9 Ga0070714_100005631 3300005435 Bacteria 9580
10 Ga0070714_100446407 3300005435 Bacteria 1228
11 Ga0070713_100166750 3300005436 Bacteria 1970
12 Ga0070701_10005180 3300005438 Bacteria 5358
13 Ga0070711_100006758 3300005439 Bacteria 6943
14 Ga0070705_100002767 3300005440 Bacteria 8751
15 Ga0070694_100071085 3300005444 Bacteria 2398
16 Ga0070694_100148707 3300005444 Bacteria 1708
17 Ga0070678_100025647 3300005456 Bacteria 3971
18 Ga0070678_100045819 3300005456 Bacteria 3131
19 Ga0070662_100401756 3300005457 Bacteria 1131
20 Ga0070681_10003997 3300005458 Bacteria 13912
21 Ga0070681_10377976 3300005458 Bacteria 1327
22 Ga0070706_100543302 3300005467 Bacteria 1081
23 Ga0070707_100059933 3300005468 Bacteria 3650
24 Ga0070698_100029578 3300005471 Bacteria 5688
25 Ga0070679_100011594 3300005530 Bacteria 8399
26 Ga0068853_100086066 3300005539 Unclassified 2756
27 Ga0070686_100004380 3300005544 Bacteria 7783
28 Ga0070695_100171955 3300005545 Bacteria 1529
29 Ga0070696_100076474 3300005546 Bacteria 2363
30 Ga0070693_100138035 3300005547 Bacteria 1531
31 Ga0070704_100018932 3300005549 Bacteria 4415
32 Ga0070704_100074092 3300005549 Unclassified 2482
33 Ga0068855_100025522 3300005563 Bacteria 7069
34 Ga0068855_100059652 3300005563 Unclassified 4464
35 Ga0068855_100163565 3300005563 Bacteria 2524
36 Ga0068856_100054194 3300005614 Bacteria 3955
37 Ga0068856_100083249 3300005614 Bacteria 3176
38 Ga0070702_100002587 3300005615 Bacteria 7872
39 Ga0070702_100038520 3300005615 Bacteria 2663
40 Ga0068852_100055252 3300005616 Bacteria 3426
41 Ga0068866_10135860 3300005718 Bacteria 1405
42 Ga0068861_100000691 3300005719 Bacteria 20175
43 Ga0081455_10003605 3300005937 Bacteria 17761
44 Ga0081455_10035131 3300005937 Unclassified 4483
45 Ga0081455_10087951 3300005937 Bacteria 2526
46 Ga0081538_10000322 3300005981 Bacteria 54810
47 Ga0081538_10004019 3300005981 Bacteria 13695
48 Ga0081538_10018683 3300005981 Bacteria 5191
49 Ga0081540_1010877 3300005983 Bacteria 6112
50 Ga0081539_10004810 3300005985 Bacteria 14503
51 Ga0081539_10066225 3300005985 Bacteria 1958
52 Ga0075365_10023532 3300006038 Bacteria 3875
53 Ga0075365_10094966 3300006038 Bacteria 2036
54 Ga0075364_10019058 3300006051 Bacteria 4304
55 Ga0075432_10012239 3300006058 Bacteria 2917
56 Ga0070715_10019214 3300006163 Bacteria 2617
57 Ga0070716_100258277 3300006173 Unclassified 1191
58 Ga0070712_100006313 3300006175 Bacteria 7348
59 Ga0075362_10001465 3300006177 Bacteria 7558
60 Ga0075428_100022348 3300006844 Bacteria 7002
61 Ga0075430_100004019 3300006846 Bacteria 12407
62 Ga0075431_100100308 3300006847 Bacteria 2987
63 Ga0075434_100035776 3300006871 Unclassified 4909
64 Ga0075429_100034732 3300006880 Bacteria 4382
65 Ga0068865_100029614 3300006881 Bacteria 3635
66 Ga0068865_100175054 3300006881 Unclassified 1648
67 Ga0075435_100241939 3300007076 Bacteria 1535
68 Ga0111539_10200203 3300009094 Bacteria 2329
69 Ga0111539_10228189 3300009094 Bacteria 2169
70 Ga0111539_10266269 3300009094 Bacteria 1995
71 Ga0105245_10002244 3300009098 Bacteria 17497
72 Ga0105245_10029925 3300009098 Bacteria 4815
73 Ga0105245_10057945 3300009098 Bacteria 3486
74 Ga0105245_10069327 3300009098 Bacteria 3197
75 Ga0105245_10150134 3300009098 Bacteria 2203
76 Ga0105247_10098173 3300009101 Bacteria 1869
77 Ga0114129_10017007 3300009147 Bacteria 10354
78 Ga0114129_10186466 3300009147 Bacteria 2819
79 Ga0114129_10434677 3300009147 Bacteria 1724
80 Ga0105243_10013799 3300009148 Bacteria 6115
81 Ga0105243_10070477 3300009148 Bacteria 2823
82 Ga0105242_10001273 3300009176 Bacteria 19917
83 Ga0105242_10012543 3300009176 Bacteria 6524
84 Ga0105248_10128712 3300009177 Unclassified 2856
85 Ga0105249_10000673 3300009553 Bacteria 31052
86 Ga0105249_10046651 3300009553 Bacteria 3944
87 Ga0105249_10161345 3300009553 Bacteria 2167
88 Ga0105239_10076014 3300010375 Bacteria 3693
89 Ga0105239_10131964 3300010375 Bacteria 2779
90 Ga0105239_10146655 3300010375 Unclassified 2632
91 Ga0105239_10288253 3300010375 Bacteria 1849
92 Ga0157371_10102796 3300013102 Unclassified 2027
93 Ga0163162_10207565 3300013306 Bacteria 2088
94 Ga0163162_10214300 3300013306 Unclassified 2056
95 Ga0157375_10097464 3300013308 Bacteria 3015
96 Ga0157377_10161969 3300014745 Bacteria 1392
97 Ga0157379_10000880 3300014968 Bacteria 24318
98 Ga0207699_10042300 3300025906 Unclassified 2638
99 Ga0207645_10244809 3300025907 Unclassified 1185
100 Ga0207707_10017801 3300025912 Bacteria 6197
101 Ga0207693_10000753 3300025915 Bacteria 29134
102 Ga0207663_10012299 3300025916 Unclassified 4624
103 Ga0207660_10052434 3300025917 Bacteria 2904
104 Ga0207660_10094251 3300025917 Unclassified 2225
105 Ga0207646_10122808 3300025922 Bacteria 2334
106 Ga0207687_10005299 3300025927 Bacteria 8545
107 Ga0207687_10257964 3300025927 Bacteria 1389
108 Ga0207664_10022404 3300025929 Unclassified 4716
109 Ga0207706_10060386 3300025933 Bacteria 3338
110 Ga0207686_10136497 3300025934 Bacteria 1689
111 Ga0207709_10015417 3300025935 Bacteria 4237
112 Ga0207704_10031086 3300025938 Bacteria 3002
113 Ga0207711_10191441 3300025941 Bacteria 1864
114 Ga0207667_10073625 3300025949 Unclassified 3549
115 Ga0207712_10106139 3300025961 Bacteria 2097
116 Ga0207712_10111552 3300025961 Bacteria 2052
117 Ga0207668_10011643 3300025972 Bacteria 5352
118 Ga0207668_10347148 3300025972 Bacteria 1240
119 Ga0207702_10277197 3300026078 Unclassified 1584
120 Ga0207702_10311383 3300026078 Bacteria 1497
121 Ga0207648_10105342 3300026089 Unclassified 2474
122 Ga0207648_10136253 3300026089 Bacteria 2163
123 Ga0207675_100000416 3300026118 Bacteria 41027
124 Ga0207675_100177406 3300026118 Bacteria 2039
125 Ga0207683_10002328 3300026121 Bacteria 16669
126 Ga0207683_10148147 3300026121 Bacteria 2117
127 Ga0207428_10020472 3300027907 Bacteria 5620
128 Ga0265320_10005422 3300031240 Bacteria 8197
129 Ga0307408_100088605 3300031548 Bacteria 2331
130 Ga0265314_10039451 3300031711 Bacteria 3401
131 Ga0307413_10160059 3300031824 Bacteria 1580
132 Ga0307413_10168279 3300031824 Bacteria 1548
133 Ga0307406_10051564 3300031901 Bacteria 2613
134 Ga0307407_10166394 3300031903 Bacteria 1448
135 Ga0307412_10160640 3300031911 Bacteria 1669
136 Ga0307409_100278066 3300031995 Bacteria 1545
137 Ga0307416_100215201 3300032002 Bacteria 1837
138 Ga0307414_10033034 3300032004 Bacteria 3415
139 Ga0307411_10045259 3300032005 Bacteria 2830
140 Ga0395899_0070881 3300037312 Bacteria 2551
141 Ga0395899_0077250 3300037312 Bacteria 2429
142 Ga0395899_0197943 3300037312 Bacteria 1403
143 Ga0395900_0003625 3300037418 Bacteria 16604
144 Ga0395900_0007125 3300037418 Bacteria 11584
145 Ga0395900_0009573 3300037418 Bacteria 9933
146 Ga0395900_0169958 3300037418 Bacteria 2220
147 Ga0395900_0201702 3300037418 Bacteria 2012
148 Ga0395900_0245617 3300037418 Unclassified 1794
149 Ga0395898_0003344 3300037466 Bacteria 17993
150 Ga0395898_0006054 3300037466 Bacteria 12986
151 Ga0395898_0030204 3300037466 Bacteria 5424
152 Ga0395898_0135198 3300037466 Bacteria 2361
153 Ga0395905_0005447 3300037471 Bacteria 12994
154 Ga0395905_0006610 3300037471 Bacteria 11629
155 Ga0395905_0342102 3300037471 Bacteria 1387
156 Ga0395901_0000806 3300038443 Bacteria 34869
157 Ga0395901_0032372 3300038443 Bacteria 5395
158 Ga0395901_0034842 3300038443 Bacteria 5200
159 Ga0395901_0146044 3300038443 Bacteria 2486
160 Ga0395901_0288846 3300038443 Bacteria 1702
161 Ga0395901_0339219 3300038443 Bacteria 1553
162 Ga0466961_0036707 3300044693 Bacteria 3145
163 Ga0466961_0084707 3300044693 Unclassified 2005
164 Ga0466963_0035666 3300044694 Unclassified 3241
165 Ga0466971_0009220 3300044719 Bacteria 4313
166 Ga0466971_0011129 3300044719 Bacteria 3939
167 Ga0466968_0115752 3300044735 Unclassified 1209
168 Ga0466957_0068016 3300044842 Bacteria 2198
169 Ga0466957_0192574 3300044842 Unclassified 1336
170 Ga0451576_0104228 3300045051 Bacteria 2950
171 Ga0466958_0000723 3300045836 Bacteria 14421
172 Ga0466958_0003472 3300045836 Bacteria 8181
173 Ga0466958_0014216 3300045836 Bacteria 4544
174 Ga0466958_0020402 3300045836 Bacteria 3863
175 Ga0466967_0012768 3300045976 Bacteria 6451
176 Ga0495651_0017126 3300046462 Bacteria 5615
177 Ga0495630_0003712 3300046517 Bacteria 10650
178 Ga0495637_0135250 3300046520 Bacteria 939
179 Ga0495640_0004430 3300046533 Bacteria 11209
180 Ga0495645_0156444 3300046543 Bacteria 1579
181 Ga0495667_0041481 3300046559 Bacteria 3052
182 Ga0495613_0056054 3300046689 Bacteria 2894
183 Ga0495674_0002282 3300047319 Bacteria 18823
184 Ga0495680_0005152 3300047322 Bacteria 12335
185 Ga0496100_0006298 3300048903 Bacteria 6464
186 Ga0496100_0083259 3300048903 Bacteria 2165
187 Ga0496101_0005507 3300048904 Bacteria 8075
188 Ga0496101_0005690 3300048904 Bacteria 7953
189 Ga0496101_0103412 3300048904 Unclassified 2135
190 Ga0496101_0133197 3300048904 Bacteria 1889
191 Ga0496102_0027172 3300048905 Bacteria 5111
192 Ga0496102_0042235 3300048905 Bacteria 4132
193 Ga0496104_0013091 3300048907 Bacteria 7474
194 Ga0496105_0055451 3300048908 Bacteria 3272
195 Ga0496106_0005467 3300048909 Bacteria 9403
196 Ga0496107_0003433 3300048910 Bacteria 10591
197 Ga0496107_0025805 3300048910 Bacteria 4163
198 Ga0496107_0148118 3300048910 Bacteria 1736
199 Ga0496108_0093493 3300048911 Bacteria 2558
200 Ga0496109_0067568 3300048912 Bacteria 3275
201 Ga0496109_0261059 3300048912 Bacteria 1631
202 Ga0496110_0061298 3300048913 Bacteria 3319
203 Ga0496111_0012726 3300048914 Bacteria 5703
204 Ga0496113_0065462 3300048916 Bacteria 2751
205 Ga0496114_0058124 3300048917 Bacteria 3229
206 Ga0496114_0509372 3300048917 Bacteria 1065
207 Ga0496115_0022735 3300048918 Bacteria 4861
208 Ga0496115_0176420 3300048918 Bacteria 1767
209 Ga0496115_0232581 3300048918 Unclassified 1520
210 Ga0496115_0435525 3300048918 Bacteria 1061
211 Ga0501031_0001168 3300049568 Bacteria 15965
212 Ga0501031_0001943 3300049568 Bacteria 13032
213 Ga0501031_0194312 3300049568 Bacteria 1324
214 Ga0501032_0003841 3300049569 Bacteria 11410
215 Ga0501032_0012686 3300049569 Bacteria 6009
216 Ga0501032_0057296 3300049569 Bacteria 2618
217 Ga0501033_0000173 3300049570 Bacteria 61398
218 Ga0501033_0009843 3300049570 Bacteria 7336
219 Ga0501034_0220495 3300049571 Bacteria 1849
220 Ga0501036_0000500 3300049572 Bacteria 28063
221 Ga0501036_0018677 3300049572 Bacteria 5813
222 Ga0501036_0101631 3300049572 Bacteria 2432
223 Ga0501036_0275824 3300049572 Bacteria 1407
224 Ga0501037_0001551 3300049573 Bacteria 16766
225 Ga0501037_0003057 3300049573 Bacteria 12136
226 Ga0501037_0345284 3300049573 Bacteria 1027
227 Ga0501038_0000121 3300049574 Bacteria 66244
228 Ga0501038_0020903 3300049574 Bacteria 5882
229 Ga0501038_0034711 3300049574 Bacteria 4433
230 Ga0501038_0044413 3300049574 Bacteria 3861
231 Ga0501039_0001771 3300049575 Bacteria 15945
232 Ga0501039_0005444 3300049575 Bacteria 9625
233 Ga0501039_0006497 3300049575 Bacteria 8891
234 Ga0501039_0009406 3300049575 Bacteria 7450
235 Ga0501039_0082004 3300049575 Bacteria 2511
236 Ga0501040_0000137 3300049576 Bacteria 39204
237 Ga0501040_0000415 3300049576 Bacteria 25167
238 Ga0501040_0002671 3300049576 Bacteria 11500
239 Ga0501040_0007850 3300049576 Bacteria 6915
240 Ga0501040_0041302 3300049576 Bacteria 3141
241 Ga0501040_0056245 3300049576 Bacteria 2699
242 Ga0501040_0091865 3300049576 Bacteria 2110
243 Ga0501040_0153128 3300049576 Bacteria 1627
244 Ga0501041_0001105 3300049577 Bacteria 14785
245 Ga0501041_0008560 3300049577 Bacteria 6023
246 Ga0501041_0010895 3300049577 Bacteria 5365
247 Ga0501041_0039477 3300049577 Bacteria 2865
248 Ga0501042_0000143 3300049578 Bacteria 31614
249 Ga0501042_0000250 3300049578 Bacteria 26177
250 Ga0501042_0002628 3300049578 Bacteria 11040
251 Ga0501042_0009485 3300049578 Bacteria 6487
252 Ga0501042_0108530 3300049578 Bacteria 1998
253 Ga0501043_0000191 3300049579 Bacteria 55875
254 Ga0501043_0001063 3300049579 Bacteria 24153
255 Ga0501043_0265384 3300049579 Bacteria 1319
256 Ga0501043_0406776 3300049579 Bacteria 1027
257 Ga0501046_0000515 3300049580 Bacteria 38115
258 Ga0501046_0002836 3300049580 Bacteria 16127
259 Ga0501046_0057201 3300049580 Bacteria 3059
260 Ga0501046_0107176 3300049580 Bacteria 2138
261 Ga0501046_0150973 3300049580 Unclassified 1753
262 Ga0501046_0162064 3300049580 Bacteria 1681
263 Ga0501047_0006028 3300049581 Bacteria 11395
264 Ga0501047_0007820 3300049581 Bacteria 10067
265 Ga0501048_0000317 3300049582 Bacteria 33079
266 Ga0501048_0004767 3300049582 Bacteria 10330
267 Ga0501048_0006687 3300049582 Bacteria 8759
268 Ga0501048_0018743 3300049582 Bacteria 5087
269 Ga0501048_0098017 3300049582 Bacteria 2068
270 Ga0501067_0004655 3300049583 Bacteria 7597
271 Ga0501068_0000739 3300049584 Bacteria 16764
272 Ga0501068_0016237 3300049584 Bacteria 4290
273 Ga0501068_0021443 3300049584 Bacteria 3772
274 Ga0501068_0077020 3300049584 Bacteria 2042
275 Ga0501069_0000258 3300049585 Bacteria 24011
276 Ga0501069_0002213 3300049585 Bacteria 9801
277 Ga0501069_0002684 3300049585 Bacteria 9090
278 Ga0501069_0034486 3300049585 Bacteria 2787
279 Ga0501070_0005038 3300049586 Bacteria 11269
280 Ga0501070_0028845 3300049586 Bacteria 4653
281 Ga0501070_0351271 3300049586 Bacteria 1196
282 Ga0501071_0000099 3300049587 Bacteria 33162
283 Ga0501071_0000300 3300049587 Bacteria 23753
284 Ga0501071_0003720 3300049587 Bacteria 9579
285 Ga0501071_0005791 3300049587 Bacteria 7977
286 Ga0501071_0008906 3300049587 Bacteria 6658
287 Ga0501071_0027174 3300049587 Bacteria 4024
288 Ga0501072_0000259 3300049588 Bacteria 38742
289 Ga0501072_0001122 3300049588 Bacteria 19900
290 Ga0501072_0004031 3300049588 Bacteria 11114
291 Ga0501072_0037472 3300049588 Bacteria 3803
292 Ga0501072_0043286 3300049588 Bacteria 3538
293 Ga0501073_0003030 3300049589 Bacteria 12600
294 Ga0501073_0003214 3300049589 Bacteria 12265
295 Ga0501073_0098321 3300049589 Bacteria 2032
296 Ga0501074_0003928 3300049590 Bacteria 10593
297 Ga0501074_0021620 3300049590 Bacteria 4670
298 Ga0501074_0073097 3300049590 Bacteria 2463
299 Ga0501075_0000197 3300049591 Bacteria 31806
300 Ga0501075_0001782 3300049591 Bacteria 14169
301 Ga0501075_0002374 3300049591 Bacteria 12527
302 Ga0501075_0004559 3300049591 Bacteria 9392
303 Ga0501075_0083634 3300049591 Bacteria 2417
304 Ga0501076_0002603 3300049592 Bacteria 12413
305 Ga0501076_0017810 3300049592 Bacteria 5401
306 Ga0501076_0033475 3300049592 Bacteria 4012
307 Ga0501076_0049683 3300049592 Bacteria 3318
308 Ga0501076_0301465 3300049592 Bacteria 1314
309 Ga0501077_0001453 3300049593 Bacteria 14263
310 Ga0501077_0004307 3300049593 Bacteria 8615
311 Ga0501077_0045519 3300049593 Bacteria 2787
312 Ga0501077_0125134 3300049593 Bacteria 1629
313 Ga0501079_0000877 3300049741 Bacteria 20629
314 Ga0501079_0001089 3300049741 Bacteria 18865
315 Ga0501079_0002940 3300049741 Bacteria 12452
316 Ga0501079_0002978 3300049741 Bacteria 12389
317 Ga0501079_0060288 3300049741 Bacteria 2927
318 Ga0501079_0084152 3300049741 Bacteria 2461
319 Ga0501079_0089698 3300049741 Bacteria 2381
320 Ga0501080_0001005 3300049742 Bacteria 23157
321 Ga0501080_0006306 3300049742 Bacteria 10640
322 Ga0501081_0000041 3300049743 Bacteria 48097
323 Ga0501081_0000082 3300049743 Bacteria 37725
324 Ga0501081_0008412 3300049743 Bacteria 6702
325 Ga0501081_0009525 3300049743 Bacteria 6333
326 Ga0501081_0065785 3300049743 Bacteria 2520
327 Ga0501081_0141318 3300049743 Bacteria 1725
328 Ga0501083_0000074 3300049744 Bacteria 66231
329 Ga0501083_0000824 3300049744 Bacteria 20306
330 Ga0501083_0065633 3300049744 Bacteria 2417
331 Ga0501035_0029496 3300049822 Bacteria 5002
332 Ga0501035_0070475 3300049822 Bacteria 3096
333 Ga0501035_0133057 3300049822 Bacteria 2167
334 Ga0501035_0324837 3300049822 Bacteria 1292
335 Ga0501044_0012043 3300049823 Bacteria 9366
336 Ga0501044_0058780 3300049823 Bacteria 3941
337 Ga0501044_0080503 3300049823 Bacteria 3299
338 Ga0501045_0000146 3300049824 Bacteria 37715
339 Ga0501045_0001080 3300049824 Bacteria 18006
340 Ga0501045_0002937 3300049824 Bacteria 11660
341 Ga0501045_0117672 3300049824 Bacteria 1972
342 nmdc:mga03683_28439_c2 3300050489 Bacteria 1810
343 nmdc:mga00v17_40800_c1 3300050491 Bacteria 2786
344 nmdc:mga0yw44_122866_c1 3300050492 Bacteria 1674
345 nmdc:mga05p37_18218_c1 3300050507 Bacteria 8483
346 nmdc:mga05p37_75976_c1 3300050507 Bacteria 4136
347 nmdc:mga09592_98056_c1 3300050508 Bacteria 2509
348 nmdc:mga0qj67_177147_c1 3300050509 Bacteria 1732
349 nmdc:mga06r32_137022_c1 3300050510 Bacteria 2423
350 nmdc:mga08y16_135085_c1 3300050511 Bacteria 2564
351 nmdc:mga08y16_411146_c1 3300050511 Bacteria 1384
352 nmdc:mga0n895_245074_c1 3300050512 Bacteria 1819
353 nmdc:mga0rr50_5813_c1 3300050513 Bacteria 7410
354 Ga0501084_0000188 3300054114 Bacteria 48053
355 Ga0501084_0001222 3300054114 Bacteria 20210
356 Ga0501084_0003029 3300054114 Bacteria 13615
357 Ga0501084_0016242 3300054114 Bacteria 6181
358 Ga0501084_0158340 3300054114 Bacteria 1910
359 Ga0501082_0000216 3300060353 Bacteria 50415
360 Ga0501082_0004091 3300060353 Bacteria 12731
361 Ga0501082_0006644 3300060353 Bacteria 10009
362 Ga0501082_0031224 3300060353 Bacteria 4592
363 Ga0466962_0022939 3300061719 Bacteria 3000
364 Ga0530510_0001277 3300061734 Bacteria 16811
365 Ga0530510_0002117 3300061734 Bacteria 13608
366 Ga0530510_0003369 3300061734 Bacteria 11002
367 Ga0530510_0131665 3300061734 Bacteria 1840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046520 Ga0495637_0135250 Ga0495637_0135250_20_898 291
2 3300049580 Ga0501046_0150973 Ga0501046_0150973_851_1738 294
3 3300005985 Ga0081539_10066225 Ga0081539_100662252 298
4 3300009101 Ga0105247_10098173 Ga0105247_100981732 298
5 3300049592 Ga0501076_0301465 Ga0501076_0301465_334_1257 302
6 3300037418 Ga0395900_0169958 Ga0395900_0169958_857_1798 304
7 3300014968 Ga0157379_10000880 Ga0157379_1000088020 305
8 3300031240 Ga0265320_10005422 Ga0265320_100054228 307
9 3300031711 Ga0265314_10039451 Ga0265314_100394511 307
10 3300048908 Ga0496105_0055451 Ga0496105_0055451_1124_2050 307
11 3300048912 Ga0496109_0067568 Ga0496109_0067568_945_1871 307
12 3300009094 Ga0111539_10200203 Ga0111539_102002032 309
13 3300009147 Ga0114129_10434677 Ga0114129_104346771 309
14 3300005981 Ga0081538_10000322 Ga0081538_1000032234 319
15 3300049568 Ga0501031_0001943 Ga0501031_0001943_3665_4654 320
16 3300049569 Ga0501032_0012686 Ga0501032_0012686_425_1414 320
17 3300049570 Ga0501033_0009843 Ga0501033_0009843_4428_5417 320
18 3300049571 Ga0501034_0220495 Ga0501034_0220495_523_1512 320
19 3300049572 Ga0501036_0018677 Ga0501036_0018677_2321_3310 320
20 3300049573 Ga0501037_0001551 Ga0501037_0001551_2400_3389 320
21 3300049574 Ga0501038_0020903 Ga0501038_0020903_2682_3671 320
22 3300049575 Ga0501039_0001771 Ga0501039_0001771_2494_3483 320
23 3300049576 Ga0501040_0007850 Ga0501040_0007850_3295_4284 320
24 3300049577 Ga0501041_0008560 Ga0501041_0008560_2504_3493 320
25 3300049578 Ga0501042_0009485 Ga0501042_0009485_2353_3342 320
26 3300049579 Ga0501043_0001063 Ga0501043_0001063_16907_17896 320
27 3300049580 Ga0501046_0002836 Ga0501046_0002836_1978_2967 320
28 3300049582 Ga0501048_0018743 Ga0501048_0018743_2528_3517 320
29 3300049584 Ga0501068_0000739 Ga0501068_0000739_2262_3251 320
30 3300049585 Ga0501069_0000258 Ga0501069_0000258_20571_21560 320
31 3300049586 Ga0501070_0005038 Ga0501070_0005038_2123_3112 320
32 3300049587 Ga0501071_0000300 Ga0501071_0000300_4500_5489 320
33 3300049588 Ga0501072_0004031 Ga0501072_0004031_7929_8918 320
34 3300049589 Ga0501073_0003030 Ga0501073_0003030_2456_3445 320
35 3300049590 Ga0501074_0021620 Ga0501074_0021620_2275_3264 320
36 3300049591 Ga0501075_0001782 Ga0501075_0001782_11233_12222 320
37 3300049592 Ga0501076_0033475 Ga0501076_0033475_392_1381 320
38 3300049593 Ga0501077_0001453 Ga0501077_0001453_2564_3553 320
39 3300049741 Ga0501079_0000877 Ga0501079_0000877_2457_3446 320
40 3300049742 Ga0501080_0006306 Ga0501080_0006306_7156_8145 320
41 3300049743 Ga0501081_0009525 Ga0501081_0009525_2713_3702 320
42 3300049744 Ga0501083_0000824 Ga0501083_0000824_16680_17669 320
43 3300049822 Ga0501035_0070475 Ga0501035_0070475_804_1793 320
44 3300049823 Ga0501044_0012043 Ga0501044_0012043_2171_3160 320
45 3300049824 Ga0501045_0002937 Ga0501045_0002937_2617_3606 320
46 3300054114 Ga0501084_0016242 Ga0501084_0016242_2689_3678 320
47 3300060353 Ga0501082_0031224 Ga0501082_0031224_2197_3186 320
48 3300061734 Ga0530510_0003369 Ga0530510_0003369_1762_2751 320
49 3300049568 Ga0501031_0001168 Ga0501031_0001168_13570_14541 322
50 3300049568 Ga0501031_0194312 Ga0501031_0194312_318_1289 322
51 3300049569 Ga0501032_0003841 Ga0501032_0003841_6693_7664 322
52 3300049570 Ga0501033_0000173 Ga0501033_0000173_13608_14579 322
53 3300049572 Ga0501036_0000500 Ga0501036_0000500_10927_11898 322
54 3300049573 Ga0501037_0003057 Ga0501037_0003057_3642_4613 322
55 3300049573 Ga0501037_0345284 Ga0501037_0345284_21_992 322
56 3300049574 Ga0501038_0000121 Ga0501038_0000121_11220_12191 322
57 3300049575 Ga0501039_0005444 Ga0501039_0005444_7552_8523 322
58 3300049575 Ga0501039_0009406 Ga0501039_0009406_36_1007 322
59 3300049576 Ga0501040_0000415 Ga0501040_0000415_13816_14787 322
60 3300049577 Ga0501041_0010895 Ga0501041_0010895_1293_2264 322
61 3300049578 Ga0501042_0000143 Ga0501042_0000143_1165_2136 322
62 3300049579 Ga0501043_0000191 Ga0501043_0000191_50914_51885 322
63 3300049579 Ga0501043_0406776 Ga0501043_0406776_21_992 322
64 3300049580 Ga0501046_0000515 Ga0501046_0000515_11220_12191 322
65 3300049581 Ga0501047_0006028 Ga0501047_0006028_7502_8473 322
66 3300049582 Ga0501048_0004767 Ga0501048_0004767_1830_2801 322
67 3300049585 Ga0501069_0002213 Ga0501069_0002213_3789_4760 322
68 3300049586 Ga0501070_0351271 Ga0501070_0351271_190_1161 322
69 3300049587 Ga0501071_0000099 Ga0501071_0000099_28201_29172 322
70 3300049588 Ga0501072_0000259 Ga0501072_0000259_30243_31214 322
71 3300049589 Ga0501073_0003214 Ga0501073_0003214_8483_9454 322
72 3300049590 Ga0501074_0003928 Ga0501074_0003928_8198_9169 322
73 3300049591 Ga0501075_0000197 Ga0501075_0000197_23282_24253 322
74 3300049592 Ga0501076_0002603 Ga0501076_0002603_11220_12191 322
75 3300049593 Ga0501077_0004307 Ga0501077_0004307_7552_8523 322
76 3300049741 Ga0501079_0002978 Ga0501079_0002978_3863_4834 322
77 3300049742 Ga0501080_0001005 Ga0501080_0001005_10488_11459 322
78 3300049743 Ga0501081_0000082 Ga0501081_0000082_7541_8512 322
79 3300049744 Ga0501083_0000074 Ga0501083_0000074_57709_58680 322
80 3300049823 Ga0501044_0080503 Ga0501044_0080503_1524_2495 322
81 3300049824 Ga0501045_0000146 Ga0501045_0000146_7531_8502 322
82 3300054114 Ga0501084_0003029 Ga0501084_0003029_11220_12191 322
83 3300060353 Ga0501082_0004091 Ga0501082_0004091_541_1512 322
84 3300061734 Ga0530510_0002117 Ga0530510_0002117_11220_12191 322
85 3300010375 Ga0105239_10146655 Ga0105239_101466551 323
86 3300009094 Ga0111539_10266269 Ga0111539_102662692 324
87 3300031824 Ga0307413_10168279 Ga0307413_101682792 324
88 3300031903 Ga0307407_10166394 Ga0307407_101663942 324
89 3300032002 Ga0307416_100215201 Ga0307416_1002152013 324
90 3300037312 Ga0395899_0077250 Ga0395899_0077250_776_1762 324
91 3300037312 Ga0395899_0197943 Ga0395899_0197943_137_1117 324
92 3300037418 Ga0395900_0003625 Ga0395900_0003625_11178_12164 324
93 3300037466 Ga0395898_0006054 Ga0395898_0006054_10291_11277 324
94 3300037471 Ga0395905_0005447 Ga0395905_0005447_6687_7673 324
95 3300050489 nmdc:mga03683_28439_c2 nmdc:mga03683_28439_c2_329_1306 324
96 3300050491 nmdc:mga00v17_40800_c1 nmdc:mga00v17_40800_c1_729_1706 324
97 3300050492 nmdc:mga0yw44_122866_c1 nmdc:mga0yw44_122866_c1_685_1662 324
98 3300050508 nmdc:mga09592_98056_c1 nmdc:mga09592_98056_c1_749_1726 324
99 3300050509 nmdc:mga0qj67_177147_c1 nmdc:mga0qj67_177147_c1_313_1290 324
100 3300050510 nmdc:mga06r32_137022_c1 nmdc:mga06r32_137022_c1_784_1761 324
101 3300050511 nmdc:mga08y16_135085_c1 nmdc:mga08y16_135085_c1_1151_2128 324
102 3300005458 Ga0070681_10377976 Ga0070681_103779761 327
103 3300037418 Ga0395900_0007125 Ga0395900_0007125_5517_6503 327
104 3300037418 Ga0395900_0245617 Ga0395900_0245617_142_1143 327
105 3300037466 Ga0395898_0003344 Ga0395898_0003344_12130_13116 327
106 3300037471 Ga0395905_0006610 Ga0395905_0006610_5897_6883 327
107 3300038443 Ga0395901_0000806 Ga0395901_0000806_28917_29903 327
108 3300038443 Ga0395901_0146044 Ga0395901_0146044_819_1805 327
109 3300044693 Ga0466961_0036707 Ga0466961_0036707_1878_2864 327
110 3300044693 Ga0466961_0084707 Ga0466961_0084707_27_1013 327
111 3300044719 Ga0466971_0009220 Ga0466971_0009220_267_1253 327
112 3300044735 Ga0466968_0115752 Ga0466968_0115752_89_1075 327
113 3300044842 Ga0466957_0068016 Ga0466957_0068016_902_1888 327
114 3300045836 Ga0466958_0003472 Ga0466958_0003472_1002_1988 327
115 3300045836 Ga0466958_0014216 Ga0466958_0014216_836_1822 327
116 3300049569 Ga0501032_0057296 Ga0501032_0057296_21_1055 327
117 3300049574 Ga0501038_0034711 Ga0501038_0034711_1436_2470 327
118 3300049576 Ga0501040_0000137 Ga0501040_0000137_37982_39016 327
119 3300049576 Ga0501040_0002671 Ga0501040_0002671_4910_5893 327
120 3300049577 Ga0501041_0001105 Ga0501041_0001105_10927_11910 327
121 3300049578 Ga0501042_0000250 Ga0501042_0000250_11246_12280 327
122 3300049578 Ga0501042_0002628 Ga0501042_0002628_6876_7859 327
123 3300049579 Ga0501043_0265384 Ga0501043_0265384_287_1270 327
124 3300049580 Ga0501046_0057201 Ga0501046_0057201_2005_3039 327
125 3300049581 Ga0501047_0007820 Ga0501047_0007820_2590_3624 327
126 3300049582 Ga0501048_0000317 Ga0501048_0000317_29456_30490 327
127 3300049582 Ga0501048_0006687 Ga0501048_0006687_5210_6193 327
128 3300049584 Ga0501068_0021443 Ga0501068_0021443_149_1183 327
129 3300049584 Ga0501068_0077020 Ga0501068_0077020_543_1526 327
130 3300049585 Ga0501069_0034486 Ga0501069_0034486_318_1352 327
131 3300049587 Ga0501071_0005791 Ga0501071_0005791_2590_3624 327
132 3300049588 Ga0501072_0001122 Ga0501072_0001122_16277_17311 327
133 3300049589 Ga0501073_0098321 Ga0501073_0098321_21_1055 327
134 3300049591 Ga0501075_0002374 Ga0501075_0002374_8063_9097 327
135 3300049591 Ga0501075_0004559 Ga0501075_0004559_4625_5608 327
136 3300049592 Ga0501076_0017810 Ga0501076_0017810_2771_3754 327
137 3300049593 Ga0501077_0045519 Ga0501077_0045519_318_1352 327
138 3300049593 Ga0501077_0125134 Ga0501077_0125134_390_1373 327
139 3300049741 Ga0501079_0001089 Ga0501079_0001089_8948_9931 327
140 3300049741 Ga0501079_0002940 Ga0501079_0002940_7988_9022 327
141 3300049743 Ga0501081_0000041 Ga0501081_0000041_44474_45508 327
142 3300049743 Ga0501081_0141318 Ga0501081_0141318_556_1539 327
143 3300049744 Ga0501083_0065633 Ga0501083_0065633_406_1440 327
144 3300049822 Ga0501035_0029496 Ga0501035_0029496_2005_3039 327
145 3300049823 Ga0501044_0058780 Ga0501044_0058780_2590_3624 327
146 3300049824 Ga0501045_0001080 Ga0501045_0001080_5662_6645 327
147 3300054114 Ga0501084_0000188 Ga0501084_0000188_44430_45464 327
148 3300054114 Ga0501084_0001222 Ga0501084_0001222_9014_9997 327
149 3300060353 Ga0501082_0000216 Ga0501082_0000216_46792_47826 327
150 3300060353 Ga0501082_0006644 Ga0501082_0006644_5193_6176 327
151 3300061719 Ga0466962_0022939 Ga0466962_0022939_1323_2309 327
152 3300061734 Ga0530510_0001277 Ga0530510_0001277_10154_11137 327
153 3300005327 Ga0070658_10123722 Ga0070658_101237222 328
154 3300005336 Ga0070680_100131175 Ga0070680_1001311752 328
155 3300005444 Ga0070694_100071085 Ga0070694_1000710852 328
156 3300005458 Ga0070681_10003997 Ga0070681_100039973 328
157 3300005530 Ga0070679_100011594 Ga0070679_1000115942 328
158 3300005563 Ga0068855_100025522 Ga0068855_1000255222 328
159 3300005563 Ga0068855_100163565 Ga0068855_1001635652 328
160 3300005981 Ga0081538_10018683 Ga0081538_100186834 328
161 3300006038 Ga0075365_10094966 Ga0075365_100949661 328
162 3300006173 Ga0070716_100258277 Ga0070716_1002582771 328
163 3300006871 Ga0075434_100035776 Ga0075434_1000357762 328
164 3300007076 Ga0075435_100241939 Ga0075435_1002419392 328
165 3300009147 Ga0114129_10017007 Ga0114129_100170075 328
166 3300009176 Ga0105242_10001273 Ga0105242_100012734 328
167 3300009177 Ga0105248_10128712 Ga0105248_101287122 328
168 3300009553 Ga0105249_10046651 Ga0105249_100466512 328
169 3300010375 Ga0105239_10131964 Ga0105239_101319642 328
170 3300025912 Ga0207707_10017801 Ga0207707_100178012 328
171 3300025941 Ga0207711_10191441 Ga0207711_101914412 328
172 3300025949 Ga0207667_10073625 Ga0207667_100736253 328
173 3300025961 Ga0207712_10106139 Ga0207712_101061392 328
174 3300026078 Ga0207702_10277197 Ga0207702_102771972 328
175 3300038443 Ga0395901_0034842 Ga0395901_0034842_369_1358 328
176 3300038443 Ga0395901_0339219 Ga0395901_0339219_352_1341 328
177 3300044719 Ga0466971_0011129 Ga0466971_0011129_1615_2610 328
178 3300045836 Ga0466958_0000723 Ga0466958_0000723_13062_14057 328
179 3300045836 Ga0466958_0020402 Ga0466958_0020402_2187_3179 328
180 3300046462 Ga0495651_0017126 Ga0495651_0017126_4128_5117 328
181 3300046517 Ga0495630_0003712 Ga0495630_0003712_8253_9242 328
182 3300046533 Ga0495640_0004430 Ga0495640_0004430_1312_2301 328
183 3300046543 Ga0495645_0156444 Ga0495645_0156444_433_1422 328
184 3300046559 Ga0495667_0041481 Ga0495667_0041481_1030_2019 328
185 3300046689 Ga0495613_0056054 Ga0495613_0056054_1135_2124 328
186 3300047319 Ga0495674_0002282 Ga0495674_0002282_14210_15199 328
187 3300047322 Ga0495680_0005152 Ga0495680_0005152_775_1764 328
188 3300048903 Ga0496100_0006298 Ga0496100_0006298_1505_2494 328
189 3300048903 Ga0496100_0083259 Ga0496100_0083259_981_1970 328
190 3300048904 Ga0496101_0005507 Ga0496101_0005507_5739_6746 328
191 3300048904 Ga0496101_0005690 Ga0496101_0005690_5106_6095 328
192 3300048905 Ga0496102_0042235 Ga0496102_0042235_1893_2882 328
193 3300048909 Ga0496106_0005467 Ga0496106_0005467_6372_7361 328
194 3300048910 Ga0496107_0003433 Ga0496107_0003433_9371_10360 328
195 3300048910 Ga0496107_0025805 Ga0496107_0025805_2434_3423 328
196 3300048917 Ga0496114_0058124 Ga0496114_0058124_2144_3133 328
197 3300048917 Ga0496114_0509372 Ga0496114_0509372_37_1044 328
198 3300048918 Ga0496115_0435525 Ga0496115_0435525_34_1023 328
199 3300049583 Ga0501067_0004655 Ga0501067_0004655_509_1498 328
200 3300049584 Ga0501068_0016237 Ga0501068_0016237_743_1732 328
201 3300049585 Ga0501069_0002684 Ga0501069_0002684_4329_5318 328
202 3300049586 Ga0501070_0028845 Ga0501070_0028845_3309_4298 328
203 3300049587 Ga0501071_0008906 Ga0501071_0008906_1338_2327 328
204 3300050507 nmdc:mga05p37_18218_c1 nmdc:mga05p37_18218_c1_5329_6315 328
205 3300050512 nmdc:mga0n895_245074_c1 nmdc:mga0n895_245074_c1_152_1159 328
206 3300050513 nmdc:mga0rr50_5813_c1 nmdc:mga0rr50_5813_c1_3042_4049 328
207 3300003373 JGI25407J50210_10027448 JGI25407J50210_100274482 329
208 3300005338 Ga0068868_100080753 Ga0068868_1000807531 329
209 3300005347 Ga0070668_100003934 Ga0070668_1000039344 329
210 3300005354 Ga0070675_100195446 Ga0070675_1001954462 329
211 3300005366 Ga0070659_100026978 Ga0070659_1000269783 329
212 3300005434 Ga0070709_10051684 Ga0070709_100516842 329
213 3300005435 Ga0070714_100005631 Ga0070714_1000056313 329
214 3300005435 Ga0070714_100446407 Ga0070714_1004464072 329
215 3300005436 Ga0070713_100166750 Ga0070713_1001667502 329
216 3300005438 Ga0070701_10005180 Ga0070701_100051803 329
217 3300005439 Ga0070711_100006758 Ga0070711_1000067582 329
218 3300005440 Ga0070705_100002767 Ga0070705_1000027674 329
219 3300005444 Ga0070694_100148707 Ga0070694_1001487072 329
220 3300005456 Ga0070678_100025647 Ga0070678_1000256472 329
221 3300005456 Ga0070678_100045819 Ga0070678_1000458193 329
222 3300005457 Ga0070662_100401756 Ga0070662_1004017561 329
223 3300005467 Ga0070706_100543302 Ga0070706_1005433021 329
224 3300005468 Ga0070707_100059933 Ga0070707_1000599332 329
225 3300005471 Ga0070698_100029578 Ga0070698_1000295784 329
226 3300005539 Ga0068853_100086066 Ga0068853_1000860662 329
227 3300005544 Ga0070686_100004380 Ga0070686_1000043804 329
228 3300005545 Ga0070695_100171955 Ga0070695_1001719551 329
229 3300005546 Ga0070696_100076474 Ga0070696_1000764742 329
230 3300005547 Ga0070693_100138035 Ga0070693_1001380351 329
231 3300005549 Ga0070704_100018932 Ga0070704_1000189323 329
232 3300005549 Ga0070704_100074092 Ga0070704_1000740922 329
233 3300005563 Ga0068855_100059652 Ga0068855_1000596522 329
234 3300005614 Ga0068856_100054194 Ga0068856_1000541942 329
235 3300005614 Ga0068856_100083249 Ga0068856_1000832492 329
236 3300005615 Ga0070702_100002587 Ga0070702_1000025873 329
237 3300005615 Ga0070702_100038520 Ga0070702_1000385202 329
238 3300005616 Ga0068852_100055252 Ga0068852_1000552523 329
239 3300005718 Ga0068866_10135860 Ga0068866_101358602 329
240 3300005719 Ga0068861_100000691 Ga0068861_1000006912 329
241 3300005937 Ga0081455_10003605 Ga0081455_1000360513 329
242 3300005937 Ga0081455_10035131 Ga0081455_100351312 329
243 3300005937 Ga0081455_10087951 Ga0081455_100879512 329
244 3300005981 Ga0081538_10004019 Ga0081538_100040196 329
245 3300005983 Ga0081540_1010877 Ga0081540_10108775 329
246 3300005985 Ga0081539_10004810 Ga0081539_100048104 329
247 3300006038 Ga0075365_10023532 Ga0075365_100235322 329
248 3300006051 Ga0075364_10019058 Ga0075364_100190584 329
249 3300006058 Ga0075432_10012239 Ga0075432_100122393 329
250 3300006163 Ga0070715_10019214 Ga0070715_100192142 329
251 3300006175 Ga0070712_100006313 Ga0070712_1000063133 329
252 3300006177 Ga0075362_10001465 Ga0075362_100014654 329
253 3300006844 Ga0075428_100022348 Ga0075428_1000223482 329
254 3300006846 Ga0075430_100004019 Ga0075430_10000401910 329
255 3300006847 Ga0075431_100100308 Ga0075431_1001003082 329
256 3300006880 Ga0075429_100034732 Ga0075429_1000347323 329
257 3300006881 Ga0068865_100029614 Ga0068865_1000296142 329
258 3300006881 Ga0068865_100175054 Ga0068865_1001750542 329
259 3300009094 Ga0111539_10228189 Ga0111539_102281892 329
260 3300009098 Ga0105245_10002244 Ga0105245_100022446 329
261 3300009098 Ga0105245_10029925 Ga0105245_100299253 329
262 3300009098 Ga0105245_10057945 Ga0105245_100579452 329
263 3300009098 Ga0105245_10069327 Ga0105245_100693273 329
264 3300009098 Ga0105245_10150134 Ga0105245_101501342 329
265 3300009147 Ga0114129_10186466 Ga0114129_101864663 329
266 3300009148 Ga0105243_10013799 Ga0105243_100137994 329
267 3300009148 Ga0105243_10070477 Ga0105243_100704773 329
268 3300009176 Ga0105242_10012543 Ga0105242_100125432 329
269 3300009553 Ga0105249_10000673 Ga0105249_1000067318 329
270 3300009553 Ga0105249_10161345 Ga0105249_101613452 329
271 3300010375 Ga0105239_10076014 Ga0105239_100760142 329
272 3300010375 Ga0105239_10288253 Ga0105239_102882532 329
273 3300013102 Ga0157371_10102796 Ga0157371_101027962 329
274 3300013306 Ga0163162_10207565 Ga0163162_102075652 329
275 3300013306 Ga0163162_10214300 Ga0163162_102143002 329
276 3300013308 Ga0157375_10097464 Ga0157375_100974643 329
277 3300014745 Ga0157377_10161969 Ga0157377_101619692 329
278 3300025906 Ga0207699_10042300 Ga0207699_100423002 329
279 3300025907 Ga0207645_10244809 Ga0207645_102448092 329
280 3300025915 Ga0207693_10000753 Ga0207693_100007536 329
281 3300025916 Ga0207663_10012299 Ga0207663_100122993 329
282 3300025917 Ga0207660_10052434 Ga0207660_100524342 329
283 3300025917 Ga0207660_10094251 Ga0207660_100942512 329
284 3300025922 Ga0207646_10122808 Ga0207646_101228082 329
285 3300025927 Ga0207687_10005299 Ga0207687_100052996 329
286 3300025927 Ga0207687_10257964 Ga0207687_102579642 329
287 3300025929 Ga0207664_10022404 Ga0207664_100224041 329
288 3300025933 Ga0207706_10060386 Ga0207706_100603863 329
289 3300025934 Ga0207686_10136497 Ga0207686_101364972 329
290 3300025935 Ga0207709_10015417 Ga0207709_100154174 329
291 3300025938 Ga0207704_10031086 Ga0207704_100310861 329
292 3300025961 Ga0207712_10111552 Ga0207712_101115522 329
293 3300025972 Ga0207668_10011643 Ga0207668_100116432 329
294 3300025972 Ga0207668_10347148 Ga0207668_103471481 329
295 3300026078 Ga0207702_10311383 Ga0207702_103113832 329
296 3300026089 Ga0207648_10105342 Ga0207648_101053422 329
297 3300026089 Ga0207648_10136253 Ga0207648_101362532 329
298 3300026118 Ga0207675_100000416 Ga0207675_10000041610 329
299 3300026118 Ga0207675_100177406 Ga0207675_1001774061 329
300 3300026121 Ga0207683_10002328 Ga0207683_100023282 329
301 3300026121 Ga0207683_10148147 Ga0207683_101481472 329
302 3300027907 Ga0207428_10020472 Ga0207428_100204725 329
303 3300031548 Ga0307408_100088605 Ga0307408_1000886052 329
304 3300031824 Ga0307413_10160059 Ga0307413_101600591 329
305 3300031901 Ga0307406_10051564 Ga0307406_100515642 329
306 3300031911 Ga0307412_10160640 Ga0307412_101606402 329
307 3300031995 Ga0307409_100278066 Ga0307409_1002780662 329
308 3300032004 Ga0307414_10033034 Ga0307414_100330343 329
309 3300032005 Ga0307411_10045259 Ga0307411_100452593 329
310 3300037312 Ga0395899_0070881 Ga0395899_0070881_1172_2167 329
311 3300037418 Ga0395900_0009573 Ga0395900_0009573_7616_8620 329
312 3300037418 Ga0395900_0201702 Ga0395900_0201702_192_1193 329
313 3300037466 Ga0395898_0030204 Ga0395898_0030204_140_1222 329
314 3300037466 Ga0395898_0135198 Ga0395898_0135198_48_1052 329
315 3300037471 Ga0395905_0342102 Ga0395905_0342102_270_1298 329
316 3300038443 Ga0395901_0032372 Ga0395901_0032372_3031_4113 329
317 3300038443 Ga0395901_0288846 Ga0395901_0288846_66_1094 329
318 3300044694 Ga0466963_0035666 Ga0466963_0035666_1425_2429 329
319 3300044842 Ga0466957_0192574 Ga0466957_0192574_171_1175 329
320 3300045051 Ga0451576_0104228 Ga0451576_0104228_663_1655 329
321 3300045976 Ga0466967_0012768 Ga0466967_0012768_387_1391 329
322 3300048904 Ga0496101_0103412 Ga0496101_0103412_986_1978 329
323 3300048904 Ga0496101_0133197 Ga0496101_0133197_223_1215 329
324 3300048905 Ga0496102_0027172 Ga0496102_0027172_1654_2646 329
325 3300048907 Ga0496104_0013091 Ga0496104_0013091_2759_3781 329
326 3300048910 Ga0496107_0148118 Ga0496107_0148118_96_1118 329
327 3300048911 Ga0496108_0093493 Ga0496108_0093493_907_1929 329
328 3300048912 Ga0496109_0261059 Ga0496109_0261059_403_1425 329
329 3300048913 Ga0496110_0061298 Ga0496110_0061298_653_1675 329
330 3300048914 Ga0496111_0012726 Ga0496111_0012726_1059_2081 329
331 3300048916 Ga0496113_0065462 Ga0496113_0065462_964_1986 329
332 3300048918 Ga0496115_0022735 Ga0496115_0022735_3271_4329 329
333 3300048918 Ga0496115_0176420 Ga0496115_0176420_231_1253 329
334 3300048918 Ga0496115_0232581 Ga0496115_0232581_403_1473 329
335 3300049572 Ga0501036_0101631 Ga0501036_0101631_864_1853 329
336 3300049572 Ga0501036_0275824 Ga0501036_0275824_129_1121 329
337 3300049574 Ga0501038_0044413 Ga0501038_0044413_1568_2581 329
338 3300049575 Ga0501039_0006497 Ga0501039_0006497_4292_5281 329
339 3300049575 Ga0501039_0082004 Ga0501039_0082004_225_1238 329
340 3300049576 Ga0501040_0041302 Ga0501040_0041302_766_1758 329
341 3300049576 Ga0501040_0056245 Ga0501040_0056245_1355_2344 329
342 3300049576 Ga0501040_0091865 Ga0501040_0091865_513_1505 329
343 3300049576 Ga0501040_0153128 Ga0501040_0153128_319_1314 329
344 3300049577 Ga0501041_0039477 Ga0501041_0039477_94_1083 329
345 3300049578 Ga0501042_0108530 Ga0501042_0108530_781_1773 329
346 3300049580 Ga0501046_0107176 Ga0501046_0107176_453_1445 329
347 3300049580 Ga0501046_0162064 Ga0501046_0162064_383_1396 329
348 3300049582 Ga0501048_0098017 Ga0501048_0098017_1005_1994 329
349 3300049587 Ga0501071_0003720 Ga0501071_0003720_619_1608 329
350 3300049587 Ga0501071_0027174 Ga0501071_0027174_1852_2844 329
351 3300049588 Ga0501072_0037472 Ga0501072_0037472_738_1751 329
352 3300049588 Ga0501072_0043286 Ga0501072_0043286_1242_2231 329
353 3300049590 Ga0501074_0073097 Ga0501074_0073097_218_1207 329
354 3300049591 Ga0501075_0083634 Ga0501075_0083634_1326_2315 329
355 3300049592 Ga0501076_0049683 Ga0501076_0049683_724_1713 329
356 3300049741 Ga0501079_0060288 Ga0501079_0060288_1918_2910 329
357 3300049741 Ga0501079_0084152 Ga0501079_0084152_404_1399 329
358 3300049741 Ga0501079_0089698 Ga0501079_0089698_979_1968 329
359 3300049743 Ga0501081_0008412 Ga0501081_0008412_136_1128 329
360 3300049743 Ga0501081_0065785 Ga0501081_0065785_610_1599 329
361 3300049822 Ga0501035_0133057 Ga0501035_0133057_819_1811 329
362 3300049822 Ga0501035_0324837 Ga0501035_0324837_14_1003 329
363 3300049824 Ga0501045_0117672 Ga0501045_0117672_234_1247 329
364 3300050507 nmdc:mga05p37_75976_c1 nmdc:mga05p37_75976_c1_1389_2381 329
365 3300050511 nmdc:mga08y16_411146_c1 nmdc:mga08y16_411146_c1_141_1139 329
366 3300054114 Ga0501084_0158340 Ga0501084_0158340_528_1517 329
367 3300061734 Ga0530510_0131665 Ga0530510_0131665_338_1327 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

272

0.91

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

35

342

0.89

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

33

155

0.88

PF04321

RmlD_sub_bind

RmlD substrate binding domain

31

347

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

34

274

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.934 1 321
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9318 1 319
4lk3-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236a substitution 0.926 1 321
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9259 1 321
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9249 1 319
ID Description Score Start End Superfamily
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 91 321 3.40.50.720
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9386 2 33 3.50.50.60
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9341 125 320 3.40.50.720
af_Q5QMG5_99_194_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9307 2 82 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.919 2 321 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A401FVF7-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9772 1 323 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A401FVF7-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9625 1 323 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A7V4B043-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9596 1 318 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A7W1J1X5-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9557 3 314 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A2A5FNG0-F1-model_v4 Nucleoside-diphosphate sugar epimerase 0.9551 3 319

Feature Viewer

pLDDT pTM Quality
92.84 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map