F424405

General Info

Members Datasets Scaffolds Average Seq Length
367 183 366 265

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100012027|Ga0307409_1000120274
Length 315
Sequence MGGQRLNVPYTWRHAQILSSFGTGASDRFPLGSRFCLPPRRQPGRLRAAVRRFMKVVAVANQKGGVGKTTTALNLSAALALRGQRVLLIDLDPQANTTSGLGIECDGEGTVYPALLGEANVRDKIIPTGRDNLSIIPSHMDLAGVEIELARGDDHLTRLRIHLQGLKPNDLFDVCILDTPPSLGVLMTSALAAADEILIPLQCEWFGLEGLAKIVHVIDQIRDSGANSDLKLEGIVMTMFDGRTNLAKQVVDEVGNYFPDALYRTVIPRTIRLGEAPSYAKTIFEHDGTGIGANAYMSLADEFLTRHAAVGPVLA

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
143 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
144 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
145 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.27
Nodule 0
Rhizoplane 0.27
Rhizosphere 88.83
Stem 0
Stem Tuber 0
Unclassified 7.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1007595 3300001977 Bacteria 1652
2 JGI24744J21845_10008154 3300002077 Bacteria 2163
3 rootH2_10007279 3300003320 Bacteria 4653
4 rootH2_10024056 3300003320 Bacteria 23701
5 rootH2_10133265 3300003320 Bacteria 2292
6 rootH1_10113090 3300003323 Bacteria 3216
7 Ga0065704_10084242 3300005289 Bacteria 3361
8 Ga0070658_10007443 3300005327 Bacteria 8840
9 Ga0070683_100225454 3300005329 Bacteria 1781
10 Ga0070690_100018363 3300005330 Bacteria 4223
11 Ga0070690_100023151 3300005330 Bacteria 3808
12 Ga0068869_100078425 3300005334 Bacteria 2460
13 Ga0068869_100398203 3300005334 Bacteria 1132
14 Ga0068869_100424106 3300005334 Bacteria 1098
15 Ga0068868_100017129 3300005338 Bacteria 5392
16 Ga0068868_100239755 3300005338 Bacteria 1523
17 Ga0070689_100026164 3300005340 Bacteria 4391
18 Ga0070687_100018221 3300005343 Bacteria 3244
19 Ga0070687_100060927 3300005343 Bacteria 1993
20 Ga0070661_100145360 3300005344 Bacteria 1790
21 Ga0070668_100044825 3300005347 Bacteria 3393
22 Ga0070675_100061628 3300005354 Bacteria 3098
23 Ga0070688_100000170 3300005365 Bacteria 35094
24 Ga0070688_100013211 3300005365 Bacteria 4651
25 Ga0070667_100042747 3300005367 Bacteria 3802
26 Ga0070703_10034764 3300005406 Bacteria 1540
27 Ga0070709_10070084 3300005434 Bacteria 2259
28 Ga0070714_100669244 3300005435 Bacteria 1000
29 Ga0070713_100047504 3300005436 Bacteria 3529
30 Ga0070701_10000995 3300005438 Bacteria 10291
31 Ga0070705_100015652 3300005440 Bacteria 3925
32 Ga0070705_100073801 3300005440 Bacteria 2071
33 Ga0070705_100089708 3300005440 Bacteria 1912
34 Ga0070700_100285974 3300005441 Bacteria 1197
35 Ga0070694_100014464 3300005444 Bacteria 4942
36 Ga0070694_100046538 3300005444 Bacteria 2913
37 Ga0070694_100086028 3300005444 Bacteria 2196
38 Ga0070708_100143371 3300005445 Bacteria 2217
39 Ga0070708_100314207 3300005445 Bacteria 1476
40 Ga0070663_100026669 3300005455 Bacteria 3916
41 Ga0070678_100019795 3300005456 Bacteria 4399
42 Ga0070662_100323169 3300005457 Bacteria 1258
43 Ga0068867_100000055 3300005459 Bacteria 68858
44 Ga0068867_100002796 3300005459 Bacteria 12271
45 Ga0070685_10009314 3300005466 Bacteria 5068
46 Ga0070685_10012488 3300005466 Bacteria 4464
47 Ga0070685_10045637 3300005466 Bacteria 2514
48 Ga0070706_100008481 3300005467 Bacteria 9575
49 Ga0070706_100106276 3300005467 Bacteria 2611
50 Ga0070706_100194243 3300005467 Bacteria 1896
51 Ga0070707_100002280 3300005468 Bacteria 18332
52 Ga0070707_100056283 3300005468 Bacteria 3772
53 Ga0070698_100047929 3300005471 Bacteria 4367
54 Ga0070698_100066628 3300005471 Bacteria 3623
55 Ga0070698_100075597 3300005471 Bacteria 3372
56 Ga0070699_100001510 3300005518 Bacteria 21276
57 Ga0070699_100301723 3300005518 Bacteria 1437
58 Ga0070697_100006529 3300005536 Bacteria 9031
59 Ga0070697_100290758 3300005536 Bacteria 1403
60 Ga0070672_100244542 3300005543 Bacteria 1510
61 Ga0070686_100031347 3300005544 Bacteria 3249
62 Ga0070686_100097676 3300005544 Bacteria 1978
63 Ga0070695_100000145 3300005545 Bacteria 32964
64 Ga0070695_100010536 3300005545 Bacteria 5521
65 Ga0070696_100121550 3300005546 Bacteria 1890
66 Ga0070704_100012115 3300005549 Bacteria 5319
67 Ga0070704_100053173 3300005549 Bacteria 2861
68 Ga0070704_100227724 3300005549 Bacteria 1519
69 Ga0070704_100421981 3300005549 Bacteria 1143
70 Ga0070664_100000836 3300005564 Bacteria 23752
71 Ga0068859_100014026 3300005617 Bacteria 8036
72 Ga0068859_100031901 3300005617 Bacteria 5292
73 Ga0068859_100131166 3300005617 Bacteria 2578
74 Ga0068864_100129647 3300005618 Bacteria 2264
75 Ga0068864_100237570 3300005618 Bacteria 1687
76 Ga0068864_100266362 3300005618 Bacteria 1595
77 Ga0068866_10009692 3300005718 Bacteria 4100
78 Ga0068861_100012964 3300005719 Bacteria 5822
79 Ga0068861_100098391 3300005719 Bacteria 2322
80 Ga0068870_10035650 3300005840 Bacteria 2555
81 Ga0068863_100030528 3300005841 Bacteria 5145
82 Ga0068863_100089034 3300005841 Bacteria 2926
83 Ga0068863_100142507 3300005841 Bacteria 2291
84 Ga0068858_100012014 3300005842 Bacteria 8163
85 Ga0068860_100000206 3300005843 Bacteria 93792
86 Ga0068860_100020903 3300005843 Bacteria 6341
87 Ga0068862_100014040 3300005844 Bacteria 6645
88 Ga0068862_100037331 3300005844 Bacteria 4118
89 Ga0068862_100111608 3300005844 Bacteria 2400
90 Ga0075365_10019804 3300006038 Bacteria 4161
91 Ga0075363_100128563 3300006048 Bacteria 1420
92 Ga0075364_10256012 3300006051 Bacteria 1190
93 Ga0075362_10010144 3300006177 Bacteria 3669
94 Ga0075367_10003485 3300006178 Bacteria 7510
95 Ga0075366_10000140 3300006195 Bacteria 30579
96 Ga0097621_100038624 3300006237 Bacteria 3831
97 Ga0068871_100015781 3300006358 Bacteria 5667
98 Ga0068871_100017185 3300006358 Bacteria 5468
99 Ga0075428_100006689 3300006844 Bacteria 12825
100 Ga0075428_100011282 3300006844 Bacteria 9940
101 Ga0075428_100052379 3300006844 Bacteria 4474
102 Ga0075428_100089611 3300006844 Bacteria 3355
103 Ga0075428_100129416 3300006844 Bacteria 2747
104 Ga0075430_100023983 3300006846 Bacteria 5195
105 Ga0075431_100007738 3300006847 Bacteria 10706
106 Ga0075431_100048528 3300006847 Bacteria 4379
107 Ga0075433_10022842 3300006852 Bacteria 5256
108 Ga0075433_10183473 3300006852 Bacteria 1862
109 Ga0075433_10458359 3300006852 Bacteria 1124
110 Ga0075433_10538437 3300006852 Bacteria 1027
111 Ga0075433_10695567 3300006852 Bacteria 891
112 Ga0075434_100011822 3300006871 Bacteria 8248
113 Ga0075434_100013256 3300006871 Bacteria 7834
114 Ga0075434_100016110 3300006871 Bacteria 7183
115 Ga0075434_100055244 3300006871 Bacteria 3946
116 Ga0075434_100157068 3300006871 Bacteria 2293
117 Ga0075434_100204907 3300006871 Bacteria 1993
118 Ga0075434_100691039 3300006871 Bacteria 1038
119 Ga0075429_100001196 3300006880 Bacteria 21004
120 Ga0075429_100037935 3300006880 Bacteria 4194
121 Ga0075429_100263209 3300006880 Bacteria 1510
122 Ga0075429_100315660 3300006880 Bacteria 1368
123 Ga0068865_100006639 3300006881 Bacteria 7078
124 Ga0097620_100014026 3300006931 Bacteria 8036
125 Ga0097620_100031902 3300006931 Bacteria 5292
126 Ga0097620_100131164 3300006931 Bacteria 2578
127 Ga0075435_100002480 3300007076 Bacteria 12274
128 Ga0075435_100107673 3300007076 Bacteria 2315
129 Ga0111539_10004567 3300009094 Bacteria 18102
130 Ga0111539_10012738 3300009094 Bacteria 10530
131 Ga0111539_10023308 3300009094 Bacteria 7605
132 Ga0111539_10059720 3300009094 Bacteria 4521
133 Ga0111539_10300909 3300009094 Bacteria 1867
134 Ga0105245_10050822 3300009098 Bacteria 3716
135 Ga0114129_10002490 3300009147 Bacteria 25564
136 Ga0114129_10021556 3300009147 Bacteria 9146
137 Ga0114129_10070732 3300009147 Bacteria 4865
138 Ga0114129_10113775 3300009147 Bacteria 3731
139 Ga0114129_10291329 3300009147 Bacteria 2178
140 Ga0114129_10315866 3300009147 Bacteria 2078
141 Ga0105243_10000190 3300009148 Bacteria 71519
142 Ga0105243_10015655 3300009148 Bacteria 5734
143 Ga0105248_10240234 3300009177 Bacteria 2039
144 Ga0105248_10740254 3300009177 Bacteria 1109
145 Ga0105237_10003502 3300009545 Bacteria 18630
146 Ga0105237_10635118 3300009545 Bacteria 1075
147 Ga0105249_10036379 3300009553 Bacteria 4465
148 Ga0105246_10042310 3300011119 Bacteria 3085
149 Ga0105246_10101372 3300011119 Bacteria 2097
150 Ga0157373_10003134 3300013100 Bacteria 12492
151 Ga0157370_10000979 3300013104 Bacteria 36192
152 Ga0157374_10000047 3300013296 Bacteria 137075
153 Ga0163162_10330872 3300013306 Bacteria 1656
154 Ga0157375_10100815 3300013308 Bacteria 2969
155 Ga0157375_10500822 3300013308 Bacteria 1379
156 Ga0157380_10005629 3300014326 Bacteria 8755
157 Ga0157380_10163167 3300014326 Bacteria 1939
158 Ga0157380_10579991 3300014326 Bacteria 1106
159 Ga0157377_10025368 3300014745 Bacteria 3161
160 Ga0157377_10027470 3300014745 Bacteria 3056
161 Ga0157376_10008858 3300014969 Bacteria 7281
162 Ga0157376_10021426 3300014969 Bacteria 5019
163 Ga0163161_10132450 3300017792 Bacteria 1882
164 Ga0213872_10020430 3300021361 Bacteria 3052
165 Ga0213876_10002310 3300021384 Bacteria 11250
166 Ga0213876_10002388 3300021384 Bacteria 11053
167 Ga0213876_10017592 3300021384 Bacteria 3772
168 Ga0213871_10017001 3300021441 Bacteria 1761
169 Ga0207685_10000674 3300025905 Bacteria 6114
170 Ga0207645_10029892 3300025907 Bacteria 3511
171 Ga0207645_10066694 3300025907 Bacteria 2300
172 Ga0207705_10022241 3300025909 Bacteria 4523
173 Ga0207705_10036168 3300025909 Bacteria 3534
174 Ga0207684_10001191 3300025910 Bacteria 29072
175 Ga0207684_10228589 3300025910 Bacteria 1605
176 Ga0207671_10009296 3300025914 Bacteria 8230
177 Ga0207663_10120334 3300025916 Bacteria 1797
178 Ga0207662_10001451 3300025918 Bacteria 11503
179 Ga0207662_10001690 3300025918 Bacteria 10799
180 Ga0207662_10060393 3300025918 Bacteria 2274
181 Ga0207649_10056910 3300025920 Bacteria 2443
182 Ga0207646_10001964 3300025922 Bacteria 24660
183 Ga0207646_10046185 3300025922 Bacteria 3908
184 Ga0207646_10535152 3300025922 Bacteria 1054
185 Ga0207706_10044512 3300025933 Bacteria 3934
186 Ga0207709_10000225 3300025935 Bacteria 71548
187 Ga0207670_10000020 3300025936 Bacteria 156378
188 Ga0207670_10000097 3300025936 Bacteria 60637
189 Ga0207670_10000343 3300025936 Bacteria 27725
190 Ga0207670_10024421 3300025936 Bacteria 3777
191 Ga0207670_10058107 3300025936 Bacteria 2626
192 Ga0207670_10128661 3300025936 Bacteria 1851
193 Ga0207704_10004535 3300025938 Bacteria 6353
194 Ga0207691_10012167 3300025940 Bacteria 8249
195 Ga0207689_10097317 3300025942 Bacteria 2417
196 Ga0207689_10433133 3300025942 Bacteria 1098
197 Ga0207679_10002347 3300025945 Bacteria 11641
198 Ga0207679_10064401 3300025945 Bacteria 2740
199 Ga0207651_10066799 3300025960 Bacteria 2528
200 Ga0207658_10035524 3300025986 Bacteria 3570
201 Ga0207677_10066434 3300026023 Bacteria 2521
202 Ga0207703_10084352 3300026035 Bacteria 2656
203 Ga0207703_10256572 3300026035 Bacteria 1579
204 Ga0207708_10057573 3300026075 Bacteria 2965
205 Ga0207641_10057377 3300026088 Bacteria 3311
206 Ga0207641_10160701 3300026088 Bacteria 2042
207 Ga0207648_10000328 3300026089 Bacteria 52063
208 Ga0207648_10011031 3300026089 Bacteria 8530
209 Ga0207676_10115218 3300026095 Bacteria 2256
210 Ga0207676_10223608 3300026095 Bacteria 1678
211 Ga0207676_10383948 3300026095 Bacteria 1308
212 Ga0207674_10127609 3300026116 Bacteria 2508
213 Ga0207674_10227364 3300026116 Bacteria 1814
214 Ga0207675_100020901 3300026118 Bacteria 6103
215 Ga0207675_100027862 3300026118 Bacteria 5263
216 Ga0207675_100269763 3300026118 Bacteria 1651
217 Ga0207675_100314742 3300026118 Bacteria 1527
218 Ga0207428_10000167 3300027907 Bacteria 91345
219 Ga0207428_10015503 3300027907 Bacteria 6590
220 Ga0268265_10028289 3300028380 Bacteria 4012
221 Ga0268265_10051830 3300028380 Bacteria 3099
222 Ga0268265_10102286 3300028380 Bacteria 2317
223 Ga0268264_10000341 3300028381 Bacteria 71848
224 Ga0268264_10060728 3300028381 Bacteria 3169
225 Ga0307511_10000703 3300030521 Bacteria 35667
226 Ga0265325_10123465 3300031241 Bacteria 1246
227 Ga0265327_10005311 3300031251 Bacteria 10808
228 Ga0307408_100000015 3300031548 Bacteria 360044
229 Ga0307408_100011181 3300031548 Bacteria 5928
230 Ga0316579_10050586 3300031691 Bacteria 1943
231 Ga0316576_10338367 3300031727 Bacteria 1121
232 Ga0316578_10003488 3300031728 Bacteria 7209
233 Ga0316577_10001678 3300031733 Bacteria 10609
234 Ga0307406_10003002 3300031901 Bacteria 9182
235 Ga0307407_10000799 3300031903 Bacteria 10441
236 Ga0307412_10000080 3300031911 Bacteria 94834
237 Ga0307409_100012027 3300031995 Bacteria 5493
238 Ga0307416_100201839 3300032002 Bacteria 1887
239 Ga0307414_10000003 3300032004 Bacteria 519751
240 Ga0307414_10093558 3300032004 Bacteria 2241
241 Ga0373931_0131183 3300035691 Bacteria 1443
242 Ga0373931_0152328 3300035691 Bacteria 1349
243 Ga0373937_0236366 3300036401 Bacteria 1721
244 Ga0316582_0069340 3300036647 Bacteria 2279
245 Ga0316582_0126882 3300036647 Bacteria 1711
246 Ga0316584_0006869 3300036712 Bacteria 7733
247 Ga0316584_0063903 3300036712 Bacteria 2756
248 Ga0436364_0283852 3300037853 Bacteria 3612
249 Ga0436364_0620140 3300037853 Bacteria 959
250 Ga0436364_0928685 3300037853 Bacteria 1318
251 Ga0436364_1071179 3300037853 Bacteria 26836
252 Ga0436365_0008209 3300039437 Bacteria 32258
253 Ga0436365_0375587 3300039437 Bacteria 5741
254 Ga0436365_0684882 3300039437 Bacteria 1478
255 Ga0436365_1863579 3300039437 Bacteria 54364
256 Ga0436360_1163100 3300039438 Bacteria 1866
257 Ga0436361_0192668 3300039447 Bacteria 3112
258 Ga0436361_0299353 3300039447 Bacteria 1318
259 Ga0436361_1150576 3300039447 Bacteria 1432
260 Ga0436363_1130723 3300039450 Bacteria 24549
261 Ga0439453_0016773 3300041408 Bacteria 1280
262 Ga0450890_000007 3300042127 Bacteria 70442
263 Ga0450891_000399 3300042129 Bacteria 4537
264 Ga0439458_0037669 3300042157 Bacteria 1166
265 Ga0451577_0015183 3300042876 Bacteria 7166
266 Ga0451577_0038745 3300042876 Bacteria 4286
267 Ga0451577_0120187 3300042876 Bacteria 2353
268 Ga0451577_0135381 3300042876 Bacteria 2212
269 Ga0451577_0161149 3300042876 Bacteria 2020
270 Ga0453683_0000889 3300044673 Bacteria 28656
271 Ga0453683_0010444 3300044673 Bacteria 6154
272 Ga0453683_0329207 3300044673 Bacteria 980
273 Ga0453684_0013709 3300044712 Bacteria 13123
274 Ga0453684_0039802 3300044712 Bacteria 6396
275 Ga0453684_0075924 3300044712 Bacteria 4221
276 Ga0453684_0117827 3300044712 Bacteria 3213
277 Ga0453684_0123795 3300044712 Bacteria 3116
278 Ga0453684_0233125 3300044712 Bacteria 2124
279 Ga0453684_0234397 3300044712 Bacteria 2117
280 Ga0453684_0663568 3300044712 Bacteria 1137
281 Ga0453684_0693346 3300044712 Bacteria 1107
282 Ga0451576_0018188 3300045051 Bacteria 7709
283 Ga0451576_0031001 3300045051 Bacteria 5704
284 Ga0451576_0187712 3300045051 Bacteria 2158
285 Ga0451576_0197069 3300045051 Bacteria 2104
286 Ga0451576_0202198 3300045051 Bacteria 2075
287 Ga0495672_0000397 3300047320 Bacteria 53007
288 Ga0496117_0006627 3300048920 Bacteria 11621
289 Ga0496118_0018911 3300048921 Bacteria 6180
290 Ga0496119_0000051 3300048922 Bacteria 184158
291 Ga0496119_0014967 3300048922 Bacteria 6021
292 Ga0496120_0000256 3300048923 Bacteria 88873
293 Ga0496120_0005385 3300048923 Bacteria 10226
294 Ga0496120_0006995 3300048923 Bacteria 8486
295 Ga0496122_0000006 3300048925 Bacteria 625811
296 Ga0496126_0000016 3300048929 Bacteria 625843
297 Ga0496126_0001515 3300048929 Bacteria 35876
298 Ga0496126_0002317 3300048929 Bacteria 26110
299 Ga0501031_0025732 3300049568 Bacteria 3839
300 Ga0501041_0071702 3300049577 Bacteria 2127
301 Ga0501041_0168599 3300049577 Bacteria 1370
302 Ga0501042_0271854 3300049578 Bacteria 1224
303 Ga0501048_0048359 3300049582 Bacteria 3034
304 Ga0501072_0119800 3300049588 Bacteria 2097
305 Ga0501072_0173450 3300049588 Bacteria 1721
306 Ga0501072_0588091 3300049588 Bacteria 878
307 Ga0501076_0104260 3300049592 Bacteria 2288
308 Ga0501076_0119444 3300049592 Bacteria 2134
309 Ga0501076_0315677 3300049592 Bacteria 1282
310 Ga0501076_0494238 3300049592 Bacteria 1008
311 Ga0501080_0126485 3300049742 Bacteria 2367
312 Ga0501081_0197440 3300049743 Bacteria 1459
313 Ga0501083_0119662 3300049744 Bacteria 1728
314 Ga0501045_0343974 3300049824 Bacteria 1110
315 nmdc:mga00v17_11515_c1 3300050491 Bacteria 4479
316 nmdc:mga0k408_332_c1 3300050493 Bacteria 25837
317 nmdc:mga06z11_6200_c1 3300050494 Bacteria 4846
318 nmdc:mga07m45_57619_c1 3300050496 Bacteria 2197
319 nmdc:mga05p37_123486_c1 3300050507 Bacteria 3180
320 nmdc:mga05p37_1986_c1 3300050507 Bacteria 23862
321 nmdc:mga05p37_388676_c1 3300050507 Bacteria 1632
322 nmdc:mga05p37_433677_c1 3300050507 Bacteria 1526
323 nmdc:mga05p37_49826_c1 3300050507 Bacteria 5151
324 nmdc:mga05p37_7047_c1 3300050507 Bacteria 13250
325 nmdc:mga05p37_85470_c1 3300050507 Bacteria 3887
326 nmdc:mga09592_141146_c1 3300050508 Bacteria 2077
327 nmdc:mga09592_162135_c1 3300050508 Bacteria 1932
328 nmdc:mga09592_3190_c1 3300050508 Bacteria 13300
329 nmdc:mga09592_717_c1 3300050508 Bacteria 10557
330 nmdc:mga0qj67_25631_c1 3300050509 Bacteria 4557
331 nmdc:mga0qj67_489873_c1 3300050509 Bacteria 989
332 nmdc:mga06r32_163704_c1 3300050510 Bacteria 2207
333 nmdc:mga06r32_361525_c1 3300050510 Bacteria 1435
334 nmdc:mga06r32_5801_c1 3300050510 Bacteria 11128
335 nmdc:mga08y16_180_c1 3300050511 Bacteria 55924
336 nmdc:mga08y16_204341_c1 3300050511 Bacteria 2047
337 nmdc:mga08y16_26927_c1 3300050511 Bacteria 6059
338 nmdc:mga08y16_309198_c1 3300050511 Bacteria 1628
339 nmdc:mga08y16_321545_c1 3300050511 Bacteria 1593
340 nmdc:mga08y16_38391_c1 3300050511 Bacteria 5028
341 nmdc:mga0n895_123523_c1 3300050512 Bacteria 2611
342 nmdc:mga0n895_205704_c1 3300050512 Bacteria 1999
343 nmdc:mga0n895_267934_c1 3300050512 Bacteria 1733
344 nmdc:mga0n895_36049_c1 3300050512 Bacteria 4773
345 nmdc:mga0n895_65865_c1 3300050512 Bacteria 3587
346 nmdc:mga0n895_703741_c1 3300050512 Bacteria 1006
347 nmdc:mga0rr50_124944_c1 3300050513 Bacteria 2053
348 nmdc:mga0rr50_1669_c1 3300050513 Bacteria 12229
349 nmdc:mga0rr50_276984_c1 3300050513 Bacteria 1399
350 nmdc:mga0rr50_305325_c1 3300050513 Bacteria 1332
351 nmdc:mga0a205_136636_c1 3300050515 Bacteria 2352
352 nmdc:mga0a205_146475_c1 3300050515 Bacteria 2261
353 nmdc:mga0a205_18901_c1 3300050515 Bacteria 6492
354 nmdc:mga0a205_241584_c1 3300050515 Bacteria 1687
355 nmdc:mga0a205_355292_c1 3300050515 Bacteria 1332
356 nmdc:mga0a205_524557_c1 3300050515 Bacteria 1041
357 nmdc:mga0a205_7690_c1 3300050515 Bacteria 9779
358 Ga0500555_000066 3300053103 Bacteria 52660
359 Ga0500559_0000424 3300053136 Bacteria 30019
360 Ga0501084_0089699 3300054114 Bacteria 2581
361 Ga0501084_0204887 3300054114 Bacteria 1665
362 Ga0501082_0205677 3300060353 Bacteria 1713
363 Ga0501082_0334642 3300060353 Bacteria 1319
364 Ga0501082_0469620 3300060353 Bacteria 1099
365 Ga0501082_0574597 3300060353 Bacteria 986
366 Ga0530510_0099103 3300061734 Bacteria 2131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0684882 Ga0436365_0684882_31_726 226
2 3300009094 Ga0111539_10059720 Ga0111539_100597202 245
3 3300050507 nmdc:mga05p37_123486_c1 nmdc:mga05p37_123486_c1_2225_2992 245
4 3300050511 nmdc:mga08y16_309198_c1 nmdc:mga08y16_309198_c1_639_1406 245
5 3300005330 Ga0070690_100018363 Ga0070690_1000183632 251
6 3300005343 Ga0070687_100018221 Ga0070687_1000182212 251
7 3300005365 Ga0070688_100000170 Ga0070688_10000017023 251
8 3300005365 Ga0070688_100013211 Ga0070688_1000132113 251
9 3300005440 Ga0070705_100089708 Ga0070705_1000897082 251
10 3300005441 Ga0070700_100285974 Ga0070700_1002859742 251
11 3300005444 Ga0070694_100046538 Ga0070694_1000465383 251
12 3300005444 Ga0070694_100086028 Ga0070694_1000860282 251
13 3300005466 Ga0070685_10009314 Ga0070685_100093141 251
14 3300005466 Ga0070685_10045637 Ga0070685_100456371 251
15 3300005544 Ga0070686_100031347 Ga0070686_1000313472 251
16 3300005545 Ga0070695_100000145 Ga0070695_10000014514 251
17 3300005549 Ga0070704_100053173 Ga0070704_1000531733 251
18 3300005617 Ga0068859_100131166 Ga0068859_1001311662 251
19 3300005618 Ga0068864_100129647 Ga0068864_1001296472 251
20 3300005841 Ga0068863_100089034 Ga0068863_1000890342 251
21 3300006852 Ga0075433_10183473 Ga0075433_101834732 251
22 3300006852 Ga0075433_10538437 Ga0075433_105384372 251
23 3300006871 Ga0075434_100013256 Ga0075434_1000132565 251
24 3300006871 Ga0075434_100055244 Ga0075434_1000552443 251
25 3300006931 Ga0097620_100131164 Ga0097620_1001311642 251
26 3300007076 Ga0075435_100002480 Ga0075435_10000248012 251
27 3300009094 Ga0111539_10300909 Ga0111539_103009092 251
28 3300009177 Ga0105248_10240234 Ga0105248_102402342 251
29 3300025905 Ga0207685_10000674 Ga0207685_100006745 251
30 3300025918 Ga0207662_10001451 Ga0207662_100014516 251
31 3300025936 Ga0207670_10000020 Ga0207670_1000002053 251
32 3300025936 Ga0207670_10000097 Ga0207670_1000009744 251
33 3300025936 Ga0207670_10000343 Ga0207670_100003432 251
34 3300025936 Ga0207670_10128661 Ga0207670_101286611 251
35 3300026088 Ga0207641_10057377 Ga0207641_100573772 251
36 3300026095 Ga0207676_10115218 Ga0207676_101152182 251
37 3300026118 Ga0207675_100269763 Ga0207675_1002697632 251
38 3300026118 Ga0207675_100314742 Ga0207675_1003147423 251
39 3300028381 Ga0268264_10060728 Ga0268264_100607284 251
40 3300035691 Ga0373931_0131183 Ga0373931_0131183_466_1227 251
41 3300037853 Ga0436364_1071179 Ga0436364_1071179_22684_23442 251
42 3300042876 Ga0451577_0120187 Ga0451577_0120187_1146_1907 251
43 3300042876 Ga0451577_0161149 Ga0451577_0161149_202_963 251
44 3300044712 Ga0453684_0234397 Ga0453684_0234397_272_1033 251
45 3300045051 Ga0451576_0018188 Ga0451576_0018188_1207_1968 251
46 3300045051 Ga0451576_0187712 Ga0451576_0187712_75_836 251
47 3300050508 nmdc:mga09592_3190_c1 nmdc:mga09592_3190_c1_10464_11225 251
48 3300050511 nmdc:mga08y16_204341_c1 nmdc:mga08y16_204341_c1_473_1234 251
49 3300050511 nmdc:mga08y16_321545_c1 nmdc:mga08y16_321545_c1_60_821 251
50 3300050512 nmdc:mga0n895_205704_c1 nmdc:mga0n895_205704_c1_115_876 251
51 3300050512 nmdc:mga0n895_267934_c1 nmdc:mga0n895_267934_c1_406_1167 251
52 3300050512 nmdc:mga0n895_36049_c1 nmdc:mga0n895_36049_c1_1129_1890 251
53 3300050513 nmdc:mga0rr50_124944_c1 nmdc:mga0rr50_124944_c1_595_1356 251
54 3300050515 nmdc:mga0a205_146475_c1 nmdc:mga0a205_146475_c1_398_1159 251
55 3300050515 nmdc:mga0a205_355292_c1 nmdc:mga0a205_355292_c1_54_815 251
56 3300036647 Ga0316582_0126882 Ga0316582_0126882_934_1701 252
57 3300036712 Ga0316584_0063903 Ga0316584_0063903_1195_1962 252
58 3300049592 Ga0501076_0104260 Ga0501076_0104260_516_1292 252
59 3300060353 Ga0501082_0334642 Ga0501082_0334642_454_1230 252
60 iso_pu_bacteria 2786546517 2787436850 252
61 3300028380 Ga0268265_10102286 Ga0268265_101022863 253
62 3300031727 Ga0316576_10338367 Ga0316576_103383671 253
63 3300042876 Ga0451577_0038745 Ga0451577_0038745_3384_4145 253
64 3300042876 Ga0451577_0135381 Ga0451577_0135381_1140_1904 253
65 3300044673 Ga0453683_0000889 Ga0453683_0000889_27529_28377 253
66 3300044673 Ga0453683_0010444 Ga0453683_0010444_249_1097 253
67 3300044712 Ga0453684_0013709 Ga0453684_0013709_3243_4022 253
68 3300044712 Ga0453684_0039802 Ga0453684_0039802_2157_2930 253
69 3300044712 Ga0453684_0075924 Ga0453684_0075924_3323_4171 253
70 3300044712 Ga0453684_0117827 Ga0453684_0117827_886_1650 253
71 3300044712 Ga0453684_0123795 Ga0453684_0123795_1416_2180 253
72 3300045051 Ga0451576_0197069 Ga0451576_0197069_476_1255 253
73 3300048920 Ga0496117_0006627 Ga0496117_0006627_3981_4751 253
74 3300048921 Ga0496118_0018911 Ga0496118_0018911_4353_5123 253
75 3300048922 Ga0496119_0000051 Ga0496119_0000051_155867_156637 253
76 3300048922 Ga0496119_0014967 Ga0496119_0014967_1945_2715 253
77 3300048923 Ga0496120_0000256 Ga0496120_0000256_27522_28292 253
78 3300048923 Ga0496120_0005385 Ga0496120_0005385_7464_8234 253
79 3300048923 Ga0496120_0006995 Ga0496120_0006995_2260_3030 253
80 3300048925 Ga0496122_0000006 Ga0496122_0000006_595392_596162 253
81 3300048929 Ga0496126_0000016 Ga0496126_0000016_595392_596162 253
82 3300048929 Ga0496126_0001515 Ga0496126_0001515_7027_7797 253
83 3300048929 Ga0496126_0002317 Ga0496126_0002317_23369_24148 253
84 3300005440 Ga0070705_100073801 Ga0070705_1000738012 254
85 3300005444 Ga0070694_100014464 Ga0070694_1000144643 254
86 3300005445 Ga0070708_100314207 Ga0070708_1003142072 254
87 3300005545 Ga0070695_100010536 Ga0070695_1000105364 254
88 3300005549 Ga0070704_100012115 Ga0070704_1000121153 254
89 3300005719 Ga0068861_100012964 Ga0068861_1000129642 254
90 3300005844 Ga0068862_100037331 Ga0068862_1000373313 254
91 3300006847 Ga0075431_100048528 Ga0075431_1000485284 254
92 3300006880 Ga0075429_100315660 Ga0075429_1003156602 254
93 3300009094 Ga0111539_10012738 Ga0111539_100127386 254
94 3300009147 Ga0114129_10021556 Ga0114129_100215566 254
95 3300009147 Ga0114129_10291329 Ga0114129_102913293 254
96 3300014326 Ga0157380_10005629 Ga0157380_100056299 254
97 3300025909 Ga0207705_10022241 Ga0207705_100222413 254
98 3300026118 Ga0207675_100027862 Ga0207675_1000278622 254
99 3300027907 Ga0207428_10015503 Ga0207428_100155032 254
100 3300031691 Ga0316579_10050586 Ga0316579_100505862 254
101 3300031728 Ga0316578_10003488 Ga0316578_100034883 254
102 3300031733 Ga0316577_10001678 Ga0316577_100016789 254
103 3300036647 Ga0316582_0069340 Ga0316582_0069340_651_1433 254
104 3300036712 Ga0316584_0006869 Ga0316584_0006869_5658_6440 254
105 3300044712 Ga0453684_0233125 Ga0453684_0233125_930_1712 254
106 3300044712 Ga0453684_0663568 Ga0453684_0663568_269_1051 254
107 3300045051 Ga0451576_0031001 Ga0451576_0031001_3019_3783 254
108 3300049568 Ga0501031_0025732 Ga0501031_0025732_2599_3381 254
109 3300049577 Ga0501041_0071702 Ga0501041_0071702_148_930 254
110 3300049578 Ga0501042_0271854 Ga0501042_0271854_52_834 254
111 3300049582 Ga0501048_0048359 Ga0501048_0048359_95_877 254
112 3300049588 Ga0501072_0588091 Ga0501072_0588091_15_797 254
113 3300049592 Ga0501076_0119444 Ga0501076_0119444_731_1513 254
114 3300049743 Ga0501081_0197440 Ga0501081_0197440_619_1401 254
115 3300049744 Ga0501083_0119662 Ga0501083_0119662_855_1637 254
116 3300050507 nmdc:mga05p37_388676_c1 nmdc:mga05p37_388676_c1_543_1325 254
117 3300050507 nmdc:mga05p37_7047_c1 nmdc:mga05p37_7047_c1_6764_7561 254
118 3300050509 nmdc:mga0qj67_489873_c1 nmdc:mga0qj67_489873_c1_53_835 254
119 3300050510 nmdc:mga06r32_163704_c1 nmdc:mga06r32_163704_c1_407_1189 254
120 3300050511 nmdc:mga08y16_26927_c1 nmdc:mga08y16_26927_c1_2328_3110 254
121 3300050515 nmdc:mga0a205_241584_c1 nmdc:mga0a205_241584_c1_620_1402 254
122 3300050515 nmdc:mga0a205_524557_c1 nmdc:mga0a205_524557_c1_136_918 254
123 3300060353 Ga0501082_0469620 Ga0501082_0469620_10_792 254
124 3300061734 Ga0530510_0099103 Ga0530510_0099103_625_1407 254
125 3300003320 rootH2_10133265 rootH2_101332653 255
126 3300005334 Ga0068869_100398203 Ga0068869_1003982032 255
127 3300005467 Ga0070706_100008481 Ga0070706_1000084813 255
128 3300005468 Ga0070707_100056283 Ga0070707_1000562833 255
129 3300005549 Ga0070704_100421981 Ga0070704_1004219811 255
130 3300005617 Ga0068859_100031901 Ga0068859_1000319013 255
131 3300005618 Ga0068864_100266362 Ga0068864_1002663622 255
132 3300005844 Ga0068862_100014040 Ga0068862_1000140404 255
133 3300006852 Ga0075433_10022842 Ga0075433_100228424 255
134 3300006871 Ga0075434_100016110 Ga0075434_1000161104 255
135 3300006931 Ga0097620_100031902 Ga0097620_1000319023 255
136 3300009094 Ga0111539_10023308 Ga0111539_100233084 255
137 3300009177 Ga0105248_10740254 Ga0105248_107402542 255
138 3300009545 Ga0105237_10003502 Ga0105237_1000350215 255
139 3300021384 Ga0213876_10017592 Ga0213876_100175923 255
140 3300025914 Ga0207671_10009296 Ga0207671_1000929610 255
141 3300025918 Ga0207662_10060393 Ga0207662_100603932 255
142 3300025936 Ga0207670_10058107 Ga0207670_100581071 255
143 3300026095 Ga0207676_10223608 Ga0207676_102236082 255
144 3300026095 Ga0207676_10383948 Ga0207676_103839482 255
145 3300028380 Ga0268265_10028289 Ga0268265_100282891 255
146 3300030521 Ga0307511_10000703 Ga0307511_1000070319 255
147 3300039437 Ga0436365_0375587 Ga0436365_0375587_2864_3631 255
148 3300045051 Ga0451576_0202198 Ga0451576_0202198_325_1122 255
149 3300050509 nmdc:mga0qj67_25631_c1 nmdc:mga0qj67_25631_c1_2496_3293 255
150 3300050511 nmdc:mga08y16_38391_c1 nmdc:mga08y16_38391_c1_3339_4136 255
151 3300050512 nmdc:mga0n895_65865_c1 nmdc:mga0n895_65865_c1_1416_2213 255
152 3300050513 nmdc:mga0rr50_305325_c1 nmdc:mga0rr50_305325_c1_222_1019 255
153 3300050515 nmdc:mga0a205_7690_c1 nmdc:mga0a205_7690_c1_4434_5231 255
154 3300053103 Ga0500555_000066 Ga0500555_000066_18008_18775 255
155 3300003320 rootH2_10024056 rootH2_1002405622 256
156 3300005841 Ga0068863_100142507 Ga0068863_1001425072 256
157 3300026088 Ga0207641_10160701 Ga0207641_101607012 256
158 3300036401 Ga0373937_0236366 Ga0373937_0236366_66_842 256
159 3300044673 Ga0453683_0329207 Ga0453683_0329207_131_913 256
160 3300050513 nmdc:mga0rr50_276984_c1 nmdc:mga0rr50_276984_c1_243_1310 256
161 3300005330 Ga0070690_100023151 Ga0070690_1000231512 257
162 3300005334 Ga0068869_100078425 Ga0068869_1000784252 257
163 3300005338 Ga0068868_100017129 Ga0068868_1000171296 257
164 3300005340 Ga0070689_100026164 Ga0070689_1000261645 257
165 3300005343 Ga0070687_100060927 Ga0070687_1000609272 257
166 3300005347 Ga0070668_100044825 Ga0070668_1000448254 257
167 3300005354 Ga0070675_100061628 Ga0070675_1000616283 257
168 3300005367 Ga0070667_100042747 Ga0070667_1000427474 257
169 3300005406 Ga0070703_10034764 Ga0070703_100347642 257
170 3300005438 Ga0070701_10000995 Ga0070701_100009959 257
171 3300005440 Ga0070705_100015652 Ga0070705_1000156524 257
172 3300005445 Ga0070708_100143371 Ga0070708_1001433713 257
173 3300005455 Ga0070663_100026669 Ga0070663_1000266695 257
174 3300005456 Ga0070678_100019795 Ga0070678_1000197954 257
175 3300005457 Ga0070662_100323169 Ga0070662_1003231692 257
176 3300005459 Ga0068867_100002796 Ga0068867_1000027967 257
177 3300005466 Ga0070685_10012488 Ga0070685_100124883 257
178 3300005467 Ga0070706_100106276 Ga0070706_1001062761 257
179 3300005467 Ga0070706_100194243 Ga0070706_1001942433 257
180 3300005468 Ga0070707_100002280 Ga0070707_1000022801 257
181 3300005471 Ga0070698_100047929 Ga0070698_1000479295 257
182 3300005471 Ga0070698_100066628 Ga0070698_1000666284 257
183 3300005471 Ga0070698_100075597 Ga0070698_1000755973 257
184 3300005518 Ga0070699_100001510 Ga0070699_10000151014 257
185 3300005518 Ga0070699_100301723 Ga0070699_1003017232 257
186 3300005536 Ga0070697_100006529 Ga0070697_10000652910 257
187 3300005536 Ga0070697_100290758 Ga0070697_1002907582 257
188 3300005543 Ga0070672_100244542 Ga0070672_1002445422 257
189 3300005544 Ga0070686_100097676 Ga0070686_1000976762 257
190 3300005546 Ga0070696_100121550 Ga0070696_1001215503 257
191 3300005549 Ga0070704_100227724 Ga0070704_1002277241 257
192 3300005617 Ga0068859_100014026 Ga0068859_1000140267 257
193 3300005618 Ga0068864_100237570 Ga0068864_1002375702 257
194 3300005718 Ga0068866_10009692 Ga0068866_100096925 257
195 3300005719 Ga0068861_100098391 Ga0068861_1000983912 257
196 3300005840 Ga0068870_10035650 Ga0068870_100356502 257
197 3300005841 Ga0068863_100030528 Ga0068863_1000305284 257
198 3300005842 Ga0068858_100012014 Ga0068858_1000120145 257
199 3300005843 Ga0068860_100020903 Ga0068860_1000209032 257
200 3300005844 Ga0068862_100111608 Ga0068862_1001116083 257
201 3300006038 Ga0075365_10019804 Ga0075365_100198045 257
202 3300006048 Ga0075363_100128563 Ga0075363_1001285632 257
203 3300006051 Ga0075364_10256012 Ga0075364_102560122 257
204 3300006177 Ga0075362_10010144 Ga0075362_100101444 257
205 3300006178 Ga0075367_10003485 Ga0075367_100034856 257
206 3300006195 Ga0075366_10000140 Ga0075366_100001408 257
207 3300006358 Ga0068871_100015781 Ga0068871_1000157816 257
208 3300006844 Ga0075428_100006689 Ga0075428_10000668911 257
209 3300006844 Ga0075428_100011282 Ga0075428_1000112826 257
210 3300006844 Ga0075428_100052379 Ga0075428_1000523794 257
211 3300006844 Ga0075428_100089611 Ga0075428_1000896113 257
212 3300006844 Ga0075428_100129416 Ga0075428_1001294163 257
213 3300006846 Ga0075430_100023983 Ga0075430_1000239834 257
214 3300006847 Ga0075431_100007738 Ga0075431_10000773811 257
215 3300006852 Ga0075433_10458359 Ga0075433_104583592 257
216 3300006852 Ga0075433_10695567 Ga0075433_106955671 257
217 3300006871 Ga0075434_100011822 Ga0075434_1000118223 257
218 3300006871 Ga0075434_100157068 Ga0075434_1001570682 257
219 3300006871 Ga0075434_100204907 Ga0075434_1002049072 257
220 3300006871 Ga0075434_100691039 Ga0075434_1006910392 257
221 3300006880 Ga0075429_100001196 Ga0075429_1000011963 257
222 3300006880 Ga0075429_100037935 Ga0075429_1000379354 257
223 3300006880 Ga0075429_100263209 Ga0075429_1002632092 257
224 3300006881 Ga0068865_100006639 Ga0068865_1000066394 257
225 3300006931 Ga0097620_100014026 Ga0097620_1000140264 257
226 3300007076 Ga0075435_100107673 Ga0075435_1001076733 257
227 3300009094 Ga0111539_10004567 Ga0111539_100045676 257
228 3300009098 Ga0105245_10050822 Ga0105245_100508224 257
229 3300009147 Ga0114129_10002490 Ga0114129_100024909 257
230 3300009147 Ga0114129_10070732 Ga0114129_100707322 257
231 3300009147 Ga0114129_10113775 Ga0114129_101137754 257
232 3300009147 Ga0114129_10315866 Ga0114129_103158662 257
233 3300009148 Ga0105243_10015655 Ga0105243_100156555 257
234 3300009545 Ga0105237_10635118 Ga0105237_106351182 257
235 3300009553 Ga0105249_10036379 Ga0105249_100363792 257
236 3300011119 Ga0105246_10101372 Ga0105246_101013722 257
237 3300013306 Ga0163162_10330872 Ga0163162_103308722 257
238 3300013308 Ga0157375_10100815 Ga0157375_101008153 257
239 3300014326 Ga0157380_10163167 Ga0157380_101631672 257
240 3300014326 Ga0157380_10579991 Ga0157380_105799912 257
241 3300014745 Ga0157377_10025368 Ga0157377_100253682 257
242 3300017792 Ga0163161_10132450 Ga0163161_101324503 257
243 3300025907 Ga0207645_10029892 Ga0207645_100298923 257
244 3300025910 Ga0207684_10001191 Ga0207684_100011914 257
245 3300025910 Ga0207684_10228589 Ga0207684_102285892 257
246 3300025918 Ga0207662_10001690 Ga0207662_100016908 257
247 3300025922 Ga0207646_10001964 Ga0207646_1000196414 257
248 3300025922 Ga0207646_10046185 Ga0207646_100461853 257
249 3300025922 Ga0207646_10535152 Ga0207646_105351521 257
250 3300025933 Ga0207706_10044512 Ga0207706_100445122 257
251 3300025936 Ga0207670_10024421 Ga0207670_100244213 257
252 3300025938 Ga0207704_10004535 Ga0207704_100045356 257
253 3300025940 Ga0207691_10012167 Ga0207691_100121679 257
254 3300025942 Ga0207689_10097317 Ga0207689_100973172 257
255 3300025945 Ga0207679_10064401 Ga0207679_100644012 257
256 3300025960 Ga0207651_10066799 Ga0207651_100667992 257
257 3300025986 Ga0207658_10035524 Ga0207658_100355244 257
258 3300026023 Ga0207677_10066434 Ga0207677_100664343 257
259 3300026035 Ga0207703_10084352 Ga0207703_100843524 257
260 3300026075 Ga0207708_10057573 Ga0207708_100575734 257
261 3300026089 Ga0207648_10011031 Ga0207648_100110313 257
262 3300026116 Ga0207674_10227364 Ga0207674_102273642 257
263 3300026118 Ga0207675_100020901 Ga0207675_1000209016 257
264 3300027907 Ga0207428_10000167 Ga0207428_1000016745 257
265 3300028380 Ga0268265_10051830 Ga0268265_100518303 257
266 3300031241 Ga0265325_10123465 Ga0265325_101234652 257
267 3300035691 Ga0373931_0152328 Ga0373931_0152328_462_1268 257
268 3300042157 Ga0439458_0037669 Ga0439458_0037669_291_1097 257
269 3300044712 Ga0453684_0693346 Ga0453684_0693346_151_960 257
270 3300047320 Ga0495672_0000397 Ga0495672_0000397_4327_5133 257
271 3300049577 Ga0501041_0168599 Ga0501041_0168599_43_849 257
272 3300049588 Ga0501072_0119800 Ga0501072_0119800_1165_1971 257
273 3300049588 Ga0501072_0173450 Ga0501072_0173450_404_1210 257
274 3300049592 Ga0501076_0315677 Ga0501076_0315677_444_1250 257
275 3300049592 Ga0501076_0494238 Ga0501076_0494238_129_935 257
276 3300049824 Ga0501045_0343974 Ga0501045_0343974_56_862 257
277 3300050491 nmdc:mga00v17_11515_c1 nmdc:mga00v17_11515_c1_3508_4314 257
278 3300050493 nmdc:mga0k408_332_c1 nmdc:mga0k408_332_c1_5479_6285 257
279 3300050494 nmdc:mga06z11_6200_c1 nmdc:mga06z11_6200_c1_2580_3386 257
280 3300050496 nmdc:mga07m45_57619_c1 nmdc:mga07m45_57619_c1_14_820 257
281 3300050507 nmdc:mga05p37_1986_c1 nmdc:mga05p37_1986_c1_7937_8743 257
282 3300050507 nmdc:mga05p37_433677_c1 nmdc:mga05p37_433677_c1_296_1102 257
283 3300050507 nmdc:mga05p37_49826_c1 nmdc:mga05p37_49826_c1_2488_3294 257
284 3300050507 nmdc:mga05p37_85470_c1 nmdc:mga05p37_85470_c1_917_1723 257
285 3300050508 nmdc:mga09592_141146_c1 nmdc:mga09592_141146_c1_1258_2064 257
286 3300050508 nmdc:mga09592_162135_c1 nmdc:mga09592_162135_c1_311_1201 257
287 3300050508 nmdc:mga09592_717_c1 nmdc:mga09592_717_c1_6820_7626 257
288 3300050510 nmdc:mga06r32_361525_c1 nmdc:mga06r32_361525_c1_553_1359 257
289 3300050510 nmdc:mga06r32_5801_c1 nmdc:mga06r32_5801_c1_1373_2179 257
290 3300050511 nmdc:mga08y16_180_c1 nmdc:mga08y16_180_c1_33295_34101 257
291 3300050512 nmdc:mga0n895_123523_c1 nmdc:mga0n895_123523_c1_967_1773 257
292 3300050512 nmdc:mga0n895_703741_c1 nmdc:mga0n895_703741_c1_178_984 257
293 3300050513 nmdc:mga0rr50_1669_c1 nmdc:mga0rr50_1669_c1_5185_5991 257
294 3300050515 nmdc:mga0a205_136636_c1 nmdc:mga0a205_136636_c1_1052_1858 257
295 3300050515 nmdc:mga0a205_18901_c1 nmdc:mga0a205_18901_c1_1700_2680 257
296 3300054114 Ga0501084_0089699 Ga0501084_0089699_588_1394 257
297 3300054114 Ga0501084_0204887 Ga0501084_0204887_337_1143 257
298 3300060353 Ga0501082_0205677 Ga0501082_0205677_871_1677 257
299 3300060353 Ga0501082_0574597 Ga0501082_0574597_135_941 257
300 3300005434 Ga0070709_10070084 Ga0070709_100700841 258
301 3300005435 Ga0070714_100669244 Ga0070714_1006692441 258
302 3300005436 Ga0070713_100047504 Ga0070713_1000475043 258
303 3300021361 Ga0213872_10020430 Ga0213872_100204302 258
304 3300021384 Ga0213876_10002310 Ga0213876_100023104 258
305 3300021384 Ga0213876_10002388 Ga0213876_100023884 258
306 3300021441 Ga0213871_10017001 Ga0213871_100170012 258
307 3300025916 Ga0207663_10120334 Ga0207663_101203342 258
308 3300037853 Ga0436364_0283852 Ga0436364_0283852_1674_2465 258
309 3300037853 Ga0436364_0620140 Ga0436364_0620140_63_854 258
310 3300037853 Ga0436364_0928685 Ga0436364_0928685_237_1040 258
311 3300039437 Ga0436365_0008209 Ga0436365_0008209_29037_29828 258
312 3300039437 Ga0436365_1863579 Ga0436365_1863579_42109_42912 258
313 3300039438 Ga0436360_1163100 Ga0436360_1163100_67_870 258
314 3300039447 Ga0436361_0192668 Ga0436361_0192668_2101_2904 258
315 3300039447 Ga0436361_0299353 Ga0436361_0299353_149_952 258
316 3300039447 Ga0436361_1150576 Ga0436361_1150576_435_1238 258
317 3300039450 Ga0436363_1130723 Ga0436363_1130723_6112_6909 258
318 3300042876 Ga0451577_0015183 Ga0451577_0015183_2488_3282 259
319 3300049742 Ga0501080_0126485 Ga0501080_0126485_1386_2180 259
320 3300001977 JGI24746J21847_1007595 JGI24746J21847_10075952 260
321 3300002077 JGI24744J21845_10008154 JGI24744J21845_100081542 260
322 3300003320 rootH2_10007279 rootH2_100072792 260
323 3300003323 rootH1_10113090 rootH1_101130902 260
324 3300005289 Ga0065704_10084242 Ga0065704_100842421 260
325 3300005327 Ga0070658_10007443 Ga0070658_100074433 260
326 3300005329 Ga0070683_100225454 Ga0070683_1002254542 260
327 3300005334 Ga0068869_100424106 Ga0068869_1004241061 260
328 3300005338 Ga0068868_100239755 Ga0068868_1002397552 260
329 3300005344 Ga0070661_100145360 Ga0070661_1001453602 260
330 3300005459 Ga0068867_100000055 Ga0068867_10000005528 260
331 3300005564 Ga0070664_100000836 Ga0070664_10000083617 260
332 3300005843 Ga0068860_100000206 Ga0068860_10000020664 260
333 3300006237 Ga0097621_100038624 Ga0097621_1000386244 260
334 3300006358 Ga0068871_100017185 Ga0068871_1000171854 260
335 3300009148 Ga0105243_10000190 Ga0105243_1000019028 260
336 3300011119 Ga0105246_10042310 Ga0105246_100423102 260
337 3300013100 Ga0157373_10003134 Ga0157373_100031347 260
338 3300013104 Ga0157370_10000979 Ga0157370_1000097910 260
339 3300013296 Ga0157374_10000047 Ga0157374_1000004730 260
340 3300013308 Ga0157375_10500822 Ga0157375_105008222 260
341 3300014745 Ga0157377_10027470 Ga0157377_100274702 260
342 3300014969 Ga0157376_10008858 Ga0157376_100088583 260
343 3300014969 Ga0157376_10021426 Ga0157376_100214264 260
344 3300025907 Ga0207645_10066694 Ga0207645_100666941 260
345 3300025909 Ga0207705_10036168 Ga0207705_100361682 260
346 3300025920 Ga0207649_10056910 Ga0207649_100569103 260
347 3300025935 Ga0207709_10000225 Ga0207709_1000022535 260
348 3300025942 Ga0207689_10433133 Ga0207689_104331331 260
349 3300025945 Ga0207679_10002347 Ga0207679_100023476 260
350 3300026035 Ga0207703_10256572 Ga0207703_102565722 260
351 3300026089 Ga0207648_10000328 Ga0207648_1000032815 260
352 3300026116 Ga0207674_10127609 Ga0207674_101276092 260
353 3300028381 Ga0268264_10000341 Ga0268264_1000034161 260
354 3300031251 Ga0265327_10005311 Ga0265327_100053114 260
355 3300031548 Ga0307408_100000015 Ga0307408_100000015267 260
356 3300031548 Ga0307408_100011181 Ga0307408_1000111815 260
357 3300031901 Ga0307406_10003002 Ga0307406_100030024 260
358 3300031903 Ga0307407_10000799 Ga0307407_100007999 260
359 3300031911 Ga0307412_10000080 Ga0307412_1000008035 260
360 3300031995 Ga0307409_100012027 Ga0307409_1000120274 260
361 3300032002 Ga0307416_100201839 Ga0307416_1002018392 260
362 3300032004 Ga0307414_10000003 Ga0307414_10000003210 260
363 3300032004 Ga0307414_10093558 Ga0307414_100935582 260
364 3300041408 Ga0439453_0016773 Ga0439453_0016773_448_1230 260
365 3300042127 Ga0450890_000007 Ga0450890_000007_54343_55125 260
366 3300042129 Ga0450891_000399 Ga0450891_000399_2403_3185 260
367 3300053136 Ga0500559_0000424 Ga0500559_0000424_12800_13588 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13614

AAA_31

AAA domain

54

232

0.97

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

57

283

0.94

PF09140

MipZ

ATPase MipZ

55

101

0.92

PF00142

Fer4_NifH

4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family

55

122

0.91

PF02374

ArsA_ATPase

Anion-transporting ATPase

54

111

0.83

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

52

199

0.74

PF06564

CBP_BcsQ

Cellulose biosynthesis protein BcsQ

54

203

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iud-assembly1.cif.gz_A structure of helicobacter pylori soj-adp complex bound to dna 0.9452 2 251
2bek-assembly2.cif.gz_D structure of the bacterial chromosome segregation protein soj 0.9437 2 253
2bej-assembly1.cif.gz_A structure of the bacterial chromosome segregation protein soj 0.9432 2 255
5ihp-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium 0.9271 2 255
5ihp-assembly2.cif.gz_B crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium 0.9258 1 255
ID Description Score Start End Superfamily
af_Q1LVD4_80_340_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9537 2 253 3.40.50.300
2bekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 2 253 3.40.50.300
af_P9WLT1_58_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9296 2 253 3.40.50.300
5ihpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9271 2 255 3.40.50.300
af_Q60283_1_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9256 1 251 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3E1EN97-F1-model_v4 Chromosome partitioning protein 0.986 1 253
AF-A0A1G0YBG8-F1-model_v4 Sporulation initiation inhibitor Soj 0.9843 27 257
AF-A0A6N6Z1F7-F1-model_v4 Chromosome partitioning protein 0.9818 2 255
AF-A0A848WZ07-F1-model_v4 ParA family protein 0.981 83 254
AF-A0A7X6UNZ4-F1-model_v4 AAA family ATPase 0.9805 2 258

Feature Viewer

pLDDT pTM Quality
92.62 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map