F424353

General Info

Members Datasets Scaffolds Average Seq Length
367 192 357 165

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10030620|Ga0157376_100306201
Length 194
Sequence MPVALPSSTDEASVMRVAEIGFEAPAKLLARYGLALERVAPGAAIPGSFWGDEEAGIIGTTVYARDDTPVHSLLHEAGHLIVLPPERRSQVHTDATDSIAEEDATCYLQIVLADELPGVGRARLMADMDAWGYTFRLGSAQAWFGEDAANARQWLVEHGLLDPQGRPVSANRRRFGASKTLLLSHVDTTPAGAV

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
3 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
6 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
7 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
64 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
76 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
77 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
81 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
191 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
192 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 0.82
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.16
Nodule 0
Rhizoplane 2.72
Rhizosphere 64.03
Stem 0
Stem Tuber 0
Unclassified 13.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022400 3300001979 Bacteria 2175
2 JGI24739J22299_10000089 3300001989 Bacteria 26418
3 JGI24735J21928_10002530 3300002067 Bacteria 6323
4 JGI25156J39149_1001534 3300002705 Bacteria 9572
5 JGI25156J39149_1001864 3300002705 Bacteria 8246
6 JGI25156J39149_1002490 3300002705 Bacteria 6564
7 JGI25162J39368_1000057 3300002737 Bacteria 145686
8 JGI25162J39368_1000338 3300002737 Bacteria 40747
9 JGI25154J39366_1006259 3300002738 Bacteria 1768
10 JGI25157J39369_1000182 3300002741 Bacteria 53311
11 JGI25157J39369_1001918 3300002741 Bacteria 6287
12 JGI25157J39369_1007373 3300002741 Bacteria 1591
13 JGI25164J39214_1000032 3300002772 Bacteria 144465
14 JGI25164J39214_1000043 3300002772 Bacteria 126257
15 JGI25164J39214_1001119 3300002772 Bacteria 7640
16 JGI25164J39214_1013601 3300002772 Bacteria 761
17 JGI25165J46597_1000113 3300003214 Bacteria 145686
18 JGI25165J46597_1000136 3300003214 Bacteria 122521
19 JGI25165J46597_1002037 3300003214 Bacteria 7651
20 rootH1_10132142 3300003316 Bacteria 1178
21 rootH1_10166365 3300003316 Bacteria 1159
22 Ga0006562J51391_1011821 3300003578 Bacteria 850
23 Ga0055538_1001003 3300003751 Bacteria 6516
24 Ga0055533_1000782 3300003756 Bacteria 9978
25 Ga0055525_1000164 3300003759 Bacteria 85555
26 Ga0055527_1000065 3300003760 Bacteria 88416
27 Ga0055527_1000317 3300003760 Bacteria 25995
28 Ga0055527_1002917 3300003760 Bacteria 2703
29 Ga0055527_1003327 3300003760 Bacteria 2421
30 Ga0055535_1000043 3300003761 Bacteria 145953
31 Ga0055535_1000690 3300003761 Bacteria 25995
32 Ga0055535_1000754 3300003761 Bacteria 24119
33 Ga0055535_1001562 3300003761 Bacteria 11138
34 Ga0055542_1000067 3300003762 Bacteria 154585
35 Ga0055542_1000072 3300003762 Bacteria 145686
36 Ga0055542_1000140 3300003762 Bacteria 90195
37 Ga0055542_1000224 3300003762 Bacteria 67911
38 Ga0055542_1001528 3300003762 Bacteria 11142
39 Ga0055529_1000339 3300003763 Bacteria 52374
40 Ga0055529_1000451 3300003763 Bacteria 40551
41 Ga0055529_1000822 3300003763 Bacteria 18554
42 Ga0055529_1002055 3300003763 Bacteria 4354
43 Ga0065165_1013513 3300005262 Bacteria 3240
44 Ga0065715_10137965 3300005293 Bacteria 1899
45 Ga0070683_100597717 3300005329 Bacteria 1056
46 Ga0070680_100381121 3300005336 Bacteria 1201
47 Ga0070682_100178658 3300005337 Bacteria 1481
48 Ga0070660_100015685 3300005339 Bacteria 5478
49 Ga0070660_100228905 3300005339 Bacteria 1512
50 Ga0070689_100001462 3300005340 Bacteria 15069
51 Ga0070661_100007538 3300005344 Bacteria 7508
52 Ga0070661_100062948 3300005344 Bacteria 2724
53 Ga0070688_100028808 3300005365 Bacteria 3320
54 Ga0070659_100006933 3300005366 Bacteria 8203
55 Ga0070659_100133111 3300005366 Bacteria 2020
56 Ga0070659_100211253 3300005366 Bacteria 1599
57 Ga0070659_100213328 3300005366 Bacteria 1591
58 Ga0070659_100753843 3300005366 Bacteria 844
59 Ga0070714_100000088 3300005435 Bacteria 77301
60 Ga0070714_100002264 3300005435 Bacteria 14154
61 Ga0070713_100006101 3300005436 Bacteria 8312
62 Ga0070694_100163371 3300005444 Bacteria 1636
63 Ga0070663_100003752 3300005455 Bacteria 8816
64 Ga0070663_100818827 3300005455 Bacteria 799
65 Ga0070662_100151164 3300005457 Bacteria 1808
66 Ga0070662_100588615 3300005457 Bacteria 935
67 Ga0070681_10117473 3300005458 Bacteria 2596
68 Ga0070681_10191046 3300005458 Bacteria 1967
69 Ga0070685_10015608 3300005466 Bacteria 4037
70 Ga0070679_100017411 3300005530 Bacteria 6955
71 Ga0068853_100082525 3300005539 Bacteria 2815
72 Ga0068853_100253872 3300005539 Bacteria 1614
73 Ga0068853_100943368 3300005539 Bacteria 829
74 Ga0070696_100026950 3300005546 Bacteria 3912
75 Ga0070696_100313841 3300005546 Bacteria 1204
76 Ga0070693_100001999 3300005547 Bacteria 9336
77 Ga0070693_100291276 3300005547 Bacteria 1097
78 Ga0068855_100037446 3300005563 Bacteria 5767
79 Ga0068855_100160142 3300005563 Bacteria 2555
80 Ga0068855_100214682 3300005563 Bacteria 2160
81 Ga0068857_100004412 3300005577 Bacteria 11893
82 Ga0068857_100112428 3300005577 Bacteria 2448
83 Ga0068857_100414105 3300005577 Bacteria 1256
84 Ga0068854_100007475 3300005578 Bacteria 6982
85 Ga0068854_100147198 3300005578 Bacteria 1813
86 Ga0068854_100155724 3300005578 Bacteria 1765
87 Ga0068854_100746509 3300005578 Bacteria 849
88 Ga0068856_100000447 3300005614 Bacteria 45620
89 Ga0068856_100116668 3300005614 Bacteria 2670
90 Ga0068852_100121517 3300005616 Bacteria 2392
91 Ga0068859_100497687 3300005617 Bacteria 1314
92 Ga0068851_10056948 3300005834 Bacteria 1995
93 Ga0068858_100480092 3300005842 Bacteria 1200
94 Ga0068860_100430450 3300005843 Bacteria 1309
95 Ga0068862_100035072 3300005844 Bacteria 4247
96 Ga0075364_10067670 3300006051 Bacteria 2348
97 Ga0097620_100497741 3300006931 Bacteria 1314
98 Ga0105240_10019235 3300009093 Bacteria 9128
99 Ga0105240_10065905 3300009093 Bacteria 4494
100 Ga0105240_10128740 3300009093 Bacteria 3039
101 Ga0105240_10185474 3300009093 Bacteria 2451
102 Ga0105240_10429365 3300009093 Bacteria 1483
103 Ga0105241_10245941 3300009174 Bacteria 1514
104 Ga0105237_10000007 3300009545 Bacteria 367690
105 Ga0105237_10000063 3300009545 Bacteria 141759
106 Ga0105237_10421291 3300009545 Bacteria 1340
107 Ga0105238_10140924 3300009551 Bacteria 2388
108 Ga0105238_10317843 3300009551 Bacteria 1543
109 Ga0105238_10982216 3300009551 Bacteria 865
110 Ga0105238_11126064 3300009551 Bacteria 808
111 Ga0157314_1000730 3300012500 Bacteria 2882
112 Ga0157347_1024315 3300012502 Bacteria 727
113 Ga0157373_10014081 3300013100 Bacteria 5862
114 Ga0157373_10103514 3300013100 Bacteria 2002
115 Ga0157373_10191560 3300013100 Bacteria 1441
116 Ga0157373_10505280 3300013100 Bacteria 874
117 Ga0157371_10010685 3300013102 Bacteria 7129
118 Ga0157371_10236462 3300013102 Bacteria 1313
119 Ga0157371_10394269 3300013102 Bacteria 1012
120 Ga0157370_10002036 3300013104 Bacteria 24836
121 Ga0157370_10004621 3300013104 Bacteria 15745
122 Ga0157370_10026436 3300013104 Bacteria 5731
123 Ga0157370_11792214 3300013104 Bacteria 551
124 Ga0157369_10070852 3300013105 Bacteria 3744
125 Ga0157369_10518763 3300013105 Bacteria 1233
126 Ga0163162_10043913 3300013306 Bacteria 4475
127 Ga0157372_10126650 3300013307 Bacteria 2937
128 Ga0157372_10266920 3300013307 Bacteria 1988
129 Ga0157372_10311548 3300013307 Bacteria 1832
130 Ga0157372_10600585 3300013307 Bacteria 1283
131 Ga0157372_10674915 3300013307 Bacteria 1203
132 Ga0182008_10048730 3300014497 Bacteria 2104
133 Ga0157376_10030620 3300014969 Bacteria 4299
134 Ga0182006_1145095 3300015261 Bacteria 808
135 Ga0182007_10012840 3300015262 Bacteria 3212
136 Ga0183369_1007 3300015685 Bacteria 414878
137 Ga0183368_1002 3300015687 Bacteria 1865598
138 Ga0183361_15013 3300016635 Bacteria 719
139 Ga0206356_10569860 3300020070 Bacteria 3765
140 Ga0206353_10004922 3300020082 Bacteria 4078
141 Ga0209435_103523 3300025206 Bacteria 1787
142 Ga0209760_103980 3300025207 Bacteria 1288
143 Ga0209784_100073 3300025224 Bacteria 146019
144 Ga0209566_101719 3300025225 Bacteria 5324
145 Ga0209674_100043 3300025226 Bacteria 369728
146 Ga0209674_100678 3300025226 Bacteria 12135
147 Ga0209672_100049 3300025228 Bacteria 238787
148 Ga0209672_100058 3300025228 Bacteria 211992
149 Ga0209672_101032 3300025228 Bacteria 12045
150 Ga0209672_101104 3300025228 Bacteria 11422
151 Ga0209563_100051 3300025230 Bacteria 340545
152 Ga0207427_100013 3300025231 Bacteria 581419
153 Ga0207427_100069 3300025231 Bacteria 161547
154 Ga0207427_100081 3300025231 Bacteria 144588
155 Ga0207427_100224 3300025231 Bacteria 48341
156 Ga0207427_102570 3300025231 Bacteria 4702
157 Ga0209437_100015 3300025233 Bacteria 713457
158 Ga0209437_100168 3300025233 Bacteria 144520
159 Ga0209437_100273 3300025233 Bacteria 76643
160 Ga0209437_100287 3300025233 Bacteria 74024
161 Ga0209437_102587 3300025233 Bacteria 3475
162 Ga0209258_100049 3300025242 Bacteria 358328
163 Ga0209258_100087 3300025242 Bacteria 238787
164 Ga0209258_100149 3300025242 Bacteria 162184
165 Ga0209258_100164 3300025242 Bacteria 148838
166 Ga0209258_100551 3300025242 Bacteria 33759
167 Ga0209646_1000393 3300025246 Bacteria 26898
168 Ga0209646_1001743 3300025246 Bacteria 5487
169 Ga0209646_1004069 3300025246 Bacteria 2733
170 Ga0209646_1006511 3300025246 Bacteria 1958
171 Ga0209026_1000060 3300025250 Bacteria 220052
172 Ga0209026_1000094 3300025250 Bacteria 169671
173 Ga0209026_1000145 3300025250 Bacteria 111490
174 Ga0209026_1000866 3300025250 Bacteria 15820
175 Ga0209026_1001725 3300025250 Bacteria 9108
176 Ga0209026_1001959 3300025250 Bacteria 8284
177 Ga0209148_1000002 3300025254 Bacteria 2399500
178 Ga0209148_1000010 3300025254 Bacteria 1265567
179 Ga0209148_1000039 3300025254 Bacteria 482479
180 Ga0209148_1000096 3300025254 Bacteria 238787
181 Ga0209148_1000143 3300025254 Bacteria 162184
182 Ga0209759_1000249 3300025256 Bacteria 80341
183 Ga0209759_1000295 3300025256 Bacteria 69093
184 Ga0209759_1000761 3300025256 Bacteria 27563
185 Ga0209759_1003734 3300025256 Bacteria 5954
186 Ga0209759_1009407 3300025256 Bacteria 2957
187 Ga0209129_1010470 3300025258 Bacteria 2308
188 Ga0209233_1000009 3300025261 Bacteria 1265567
189 Ga0209233_1000083 3300025261 Bacteria 336016
190 Ga0209233_1000092 3300025261 Bacteria 308668
191 Ga0209233_1000151 3300025261 Bacteria 176515
192 Ga0209455_1000034 3300025272 Bacteria 483129
193 Ga0209455_1000082 3300025272 Bacteria 257909
194 Ga0209455_1000088 3300025272 Bacteria 238787
195 Ga0209455_1010397 3300025272 Bacteria 2368
196 Ga0209758_1005240 3300025297 Bacteria 10158
197 Ga0207647_10006001 3300025904 Bacteria 8850
198 Ga0207647_10006719 3300025904 Bacteria 8351
199 Ga0207705_10008157 3300025909 Bacteria 7669
200 Ga0207654_10093148 3300025911 Bacteria 1841
201 Ga0207707_10164449 3300025912 Bacteria 1939
202 Ga0207695_10005651 3300025913 Bacteria 16501
203 Ga0207695_10015963 3300025913 Bacteria 8815
204 Ga0207695_10017386 3300025913 Bacteria 8367
205 Ga0207695_10042408 3300025913 Bacteria 4860
206 Ga0207695_10402970 3300025913 Bacteria 1252
207 Ga0207671_10000021 3300025914 Bacteria 300409
208 Ga0207671_10000074 3300025914 Bacteria 156482
209 Ga0207671_10271724 3300025914 Bacteria 1335
210 Ga0207660_10082373 3300025917 Bacteria 2367
211 Ga0207657_10107836 3300025919 Bacteria 2303
212 Ga0207657_10130005 3300025919 Bacteria 2064
213 Ga0207657_10162614 3300025919 Bacteria 1813
214 Ga0207657_10368396 3300025919 Bacteria 1132
215 Ga0207649_10016099 3300025920 Bacteria 4211
216 Ga0207694_10213209 3300025924 Bacteria 1573
217 Ga0207694_10377509 3300025924 Bacteria 1176
218 Ga0207694_10416113 3300025924 Bacteria 1119
219 Ga0207700_10006249 3300025928 Bacteria 7184
220 Ga0207664_10000066 3300025929 Bacteria 109573
221 Ga0207664_10000315 3300025929 Bacteria 36069
222 Ga0207664_10744324 3300025929 Bacteria 881
223 Ga0207690_10004293 3300025932 Bacteria 8411
224 Ga0207690_10012344 3300025932 Bacteria 5110
225 Ga0207690_10114807 3300025932 Bacteria 1945
226 Ga0207706_10017342 3300025933 Bacteria 6486
227 Ga0207706_10195663 3300025933 Bacteria 1774
228 Ga0207706_10355319 3300025933 Bacteria 1274
229 Ga0207670_10001715 3300025936 Bacteria 11438
230 Ga0207667_10000141 3300025949 Bacteria 109666
231 Ga0207667_10001686 3300025949 Bacteria 27833
232 Ga0207667_10022326 3300025949 Bacteria 6992
233 Ga0207640_10005354 3300025981 Bacteria 6996
234 Ga0207640_10012031 3300025981 Bacteria 4918
235 Ga0207640_10255295 3300025981 Bacteria 1363
236 Ga0207639_10063648 3300026041 Bacteria 2857
237 Ga0207639_10305497 3300026041 Bacteria 1408
238 Ga0207678_10001930 3300026067 Bacteria 18917
239 Ga0207678_10098268 3300026067 Bacteria 2501
240 Ga0207702_10000644 3300026078 Bacteria 38190
241 Ga0207674_10000168 3300026116 Bacteria 78785
242 Ga0207674_10182013 3300026116 Bacteria 2053
243 Ga0268264_10287619 3300028381 Bacteria 1542
244 Ga0265340_10142311 3300031247 Unclassified 1096
245 Ga0307516_10269343 3300031730 Bacteria 1390
246 Ga0307414_10134537 3300032004 Bacteria 1925
247 Ga0395899_0000068 3300037312 Bacteria 202264
248 Ga0395899_0003472 3300037312 Bacteria 12490
249 Ga0395900_0000012 3300037418 Bacteria 401198
250 Ga0395900_0084262 3300037418 Bacteria 3266
251 Ga0395898_0000144 3300037466 Bacteria 187889
252 Ga0395898_0000278 3300037466 Bacteria 124490
253 Ga0395898_1327594 3300037466 Bacteria 648
254 Ga0395901_0001173 3300038443 Bacteria 27860
255 Ga0395901_0323462 3300038443 Bacteria 1595
256 Ga0436361_0755138 3300039447 Bacteria 1043
257 Ga0451793_1877366 3300041452 Bacteria 1509
258 Ga0451853_1577216 3300041512 Bacteria 596
259 Ga0439437_012721 3300042000 Bacteria 974
260 Ga0439448_0138534 3300042005 Bacteria 841
261 Ga0466988_0131779 3300044536 Bacteria 1466
262 Ga0466969_0000538 3300044656 Bacteria 20767
263 Ga0466969_0017506 3300044656 Bacteria 3739
264 Ga0466969_0055681 3300044656 Bacteria 1933
265 Ga0466972_0181250 3300044658 Bacteria 987
266 Ga0466982_0000004 3300044672 Bacteria 386724
267 Ga0466965_0010378 3300044683 Bacteria 4344
268 Ga0466965_0344206 3300044683 Bacteria 815
269 Ga0466966_0003574 3300044684 Bacteria 10260
270 Ga0466966_0005847 3300044684 Bacteria 8109
271 Ga0466961_0015318 3300044693 Bacteria 4924
272 Ga0466961_0034067 3300044693 Bacteria 3270
273 Ga0466963_0736767 3300044694 Bacteria 695
274 Ga0466964_0058382 3300044706 Bacteria 1599
275 Ga0466964_0073804 3300044706 Bacteria 1449
276 Ga0466971_0003256 3300044719 Bacteria 6927
277 Ga0466971_0019109 3300044719 Bacteria 3041
278 Ga0466971_0027097 3300044719 Bacteria 2565
279 Ga0466968_0243922 3300044735 Bacteria 851
280 Ga0466970_0013242 3300044765 Bacteria 4227
281 Ga0466970_0037021 3300044765 Bacteria 2585
282 Ga0466970_0092781 3300044765 Bacteria 1640
283 Ga0466957_0002918 3300044842 Bacteria 9264
284 Ga0466957_0008967 3300044842 Bacteria 5702
285 Ga0466960_0007681 3300044901 Bacteria 4391
286 Ga0466959_0000204 3300045049 Bacteria 38407
287 Ga0466959_0009505 3300045049 Bacteria 6918
288 Ga0466959_0033034 3300045049 Bacteria 3828
289 Ga0466958_0013023 3300045836 Bacteria 4725
290 Ga0466958_0038045 3300045836 Bacteria 2885
291 Ga0466958_0319713 3300045836 Bacteria 997
292 Ga0466967_0145910 3300045976 Bacteria 2208
293 Ga0495638_0000007 3300046460 Bacteria 602783
294 Ga0495638_0000343 3300046460 Bacteria 58771
295 Ga0495638_0005670 3300046460 Bacteria 9198
296 Ga0495650_0000078 3300046471 Bacteria 245487
297 Ga0495606_0000242 3300046507 Bacteria 96491
298 Ga0495606_0015919 3300046507 Bacteria 5767
299 Ga0495631_0217566 3300046518 Bacteria 816
300 Ga0495597_0157985 3300046542 Bacteria 927
301 Ga0495622_0116978 3300046557 Bacteria 1218
302 Ga0495625_0355160 3300046660 Bacteria 925
303 Ga0495588_0170905 3300046674 Bacteria 1149
304 Ga0495649_0005342 3300046694 Bacteria 8196
305 Ga0495681_0079292 3300047470 Bacteria 1469
306 Ga0496104_1603930 3300048907 Bacteria 553
307 Ga0496108_0502612 3300048911 Bacteria 1059
308 Ga0496112_1738323 3300048915 Bacteria 536
309 Ga0496113_0005362 3300048916 Bacteria 7993
310 Ga0496114_0031218 3300048917 Bacteria 4383
311 Ga0496115_0000158 3300048918 Bacteria 63464
312 Ga0496115_0000177 3300048918 Bacteria 59539
313 Ga0496115_0070527 3300048918 Bacteria 2833
314 Ga0496115_0470912 3300048918 Bacteria 1012
315 Ga0496121_0074694 3300048924 Bacteria 2710
316 Ga0496121_0153138 3300048924 Bacteria 1694
317 Ga0496122_0158717 3300048925 Bacteria 1383
318 Ga0496123_0034574 3300048926 Bacteria 3617
319 Ga0496124_0000018 3300048927 Bacteria 442940
320 Ga0496125_0000517 3300048928 Bacteria 67165
321 Ga0496126_0012227 3300048929 Bacteria 8805
322 Ga0496126_0121963 3300048929 Bacteria 2259
323 Ga0496126_0159912 3300048929 Bacteria 1925
324 Ga0496126_0658420 3300048929 Bacteria 818
325 Ga0495682_0156794 3300049460 Bacteria 811
326 Ga0501032_0324943 3300049569 Bacteria 992
327 Ga0501033_0001185 3300049570 Bacteria 23529
328 Ga0501033_0434278 3300049570 Bacteria 913
329 Ga0501034_0004493 3300049571 Bacteria 15500
330 Ga0501036_0008195 3300049572 Bacteria 8565
331 Ga0501036_0309413 3300049572 Bacteria 1321
332 Ga0501037_0212686 3300049573 Bacteria 1363
333 Ga0501039_0774798 3300049575 Bacteria 749
334 Ga0501043_0167609 3300049579 Bacteria 1714
335 Ga0501043_0200613 3300049579 Bacteria 1548
336 Ga0501046_0119683 3300049580 Bacteria 2004
337 Ga0501046_0408153 3300049580 Bacteria 980
338 Ga0501047_0116423 3300049581 Bacteria 2554
339 Ga0501047_0660177 3300049581 Bacteria 865
340 Ga0501047_0835071 3300049581 Bacteria 735
341 Ga0501070_0001983 3300049586 Bacteria 18007
342 Ga0501077_0769662 3300049593 Bacteria 619
343 Ga0501080_0239872 3300049742 Bacteria 1655
344 Ga0501035_0043677 3300049822 Bacteria 4038
345 Ga0501035_0058432 3300049822 Bacteria 3436
346 Ga0501035_0107098 3300049822 Bacteria 2450
347 Ga0501035_0121014 3300049822 Bacteria 2288
348 Ga0501044_0039228 3300049823 Bacteria 4941
349 Ga0501044_0120077 3300049823 Bacteria 2630
350 Ga0501044_0148412 3300049823 Bacteria 2328
351 Ga0501044_0728146 3300049823 Bacteria 875
352 nmdc:mga00v17_38711_c1 3300050491 Bacteria 2853
353 Ga0500658_0116105 3300053134 Bacteria 1183
354 Ga0500627_0008393 3300053158 Bacteria 3667
355 Ga0466962_0001511 3300061719 Bacteria 10859
356 Ga0466962_0006237 3300061719 Bacteria 5725
357 Ga0466962_0226149 3300061719 Bacteria 917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0660177 Ga0501047_0660177_377_847 152
2 iso_pu_bacteria 2643221579 2643908934 152
3 iso_pu_bacteria 2643221581 2643915492 152
4 iso_pu_bacteria 8002869464 8002872690 152
5 3300032004 Ga0307414_10134537 Ga0307414_101345372 154
6 3300048917 Ga0496114_0031218 Ga0496114_0031218_3393_3878 154
7 3300048929 Ga0496126_0159912 Ga0496126_0159912_608_1093 154
8 iso_pu_bacteria 2842780639 2842781327 154
9 iso_pu_bacteria 2939611941 2939614143 154
10 3300005293 Ga0065715_10137965 Ga0065715_101379653 155
11 3300031247 Ga0265340_10142311 Ga0265340_101423112 155
12 3300049822 Ga0501035_0121014 Ga0501035_0121014_351_827 155
13 iso_pu_bacteria 2537561836 2538833171 155
14 3300003760 Ga0055527_1003327 Ga0055527_10033274 156
15 3300005340 Ga0070689_100001462 Ga0070689_1000014621 156
16 3300005344 Ga0070661_100007538 Ga0070661_1000075383 156
17 3300005455 Ga0070663_100818827 Ga0070663_1008188272 156
18 3300005843 Ga0068860_100430450 Ga0068860_1004304501 156
19 3300005844 Ga0068862_100035072 Ga0068862_1000350726 156
20 3300006051 Ga0075364_10067670 Ga0075364_100676703 156
21 3300025206 Ga0209435_103523 Ga0209435_1035232 156
22 3300025228 Ga0209672_101032 Ga0209672_10103211 156
23 3300025246 Ga0209646_1006511 Ga0209646_10065114 156
24 3300025250 Ga0209026_1001725 Ga0209026_10017259 156
25 3300025254 Ga0209148_1000002 Ga0209148_10000021571 156
26 3300025920 Ga0207649_10016099 Ga0207649_100160993 156
27 3300025936 Ga0207670_10001715 Ga0207670_100017157 156
28 3300028381 Ga0268264_10287619 Ga0268264_102876191 156
29 3300044536 Ga0466988_0131779 Ga0466988_0131779_886_1356 156
30 3300044694 Ga0466963_0736767 Ga0466963_0736767_213_683 156
31 3300044719 Ga0466971_0003256 Ga0466971_0003256_927_1397 156
32 3300045836 Ga0466958_0038045 Ga0466958_0038045_1367_1837 156
33 3300046460 Ga0495638_0000343 Ga0495638_0000343_58078_58548 156
34 3300046557 Ga0495622_0116978 Ga0495622_0116978_109_579 156
35 3300046660 Ga0495625_0355160 Ga0495625_0355160_431_901 156
36 3300048907 Ga0496104_1603930 Ga0496104_1603930_46_516 156
37 3300048915 Ga0496112_1738323 Ga0496112_1738323_39_509 156
38 3300048918 Ga0496115_0070527 Ga0496115_0070527_171_641 156
39 3300048918 Ga0496115_0470912 Ga0496115_0470912_161_631 156
40 3300048924 Ga0496121_0153138 Ga0496121_0153138_1012_1482 156
41 3300048929 Ga0496126_0121963 Ga0496126_0121963_190_660 156
42 3300048929 Ga0496126_0658420 Ga0496126_0658420_253_723 156
43 3300049460 Ga0495682_0156794 Ga0495682_0156794_49_519 156
44 3300050491 nmdc:mga00v17_38711_c1 nmdc:mga00v17_38711_c1_447_944 156
45 3300002705 JGI25156J39149_1002490 JGI25156J39149_10024907 157
46 3300002737 JGI25162J39368_1000338 JGI25162J39368_100033810 157
47 3300002738 JGI25154J39366_1006259 JGI25154J39366_10062592 157
48 3300002741 JGI25157J39369_1007373 JGI25157J39369_10073732 157
49 3300002772 JGI25164J39214_1000032 JGI25164J39214_100003276 157
50 3300002772 JGI25164J39214_1001119 JGI25164J39214_10011198 157
51 3300003214 JGI25165J46597_1000136 JGI25165J46597_100013641 157
52 3300003214 JGI25165J46597_1002037 JGI25165J46597_10020378 157
53 3300003759 Ga0055525_1000164 Ga0055525_100016466 157
54 3300003760 Ga0055527_1000065 Ga0055527_100006567 157
55 3300003760 Ga0055527_1000317 Ga0055527_10003175 157
56 3300003760 Ga0055527_1002917 Ga0055527_10029173 157
57 3300003761 Ga0055535_1000690 Ga0055535_10006905 157
58 3300003761 Ga0055535_1001562 Ga0055535_10015628 157
59 3300003762 Ga0055542_1000140 Ga0055542_100014066 157
60 3300003762 Ga0055542_1001528 Ga0055542_10015288 157
61 3300003763 Ga0055529_1000451 Ga0055529_100045118 157
62 3300003763 Ga0055529_1000822 Ga0055529_100082218 157
63 3300003763 Ga0055529_1002055 Ga0055529_10020555 157
64 3300005329 Ga0070683_100597717 Ga0070683_1005977171 157
65 3300005436 Ga0070713_100006101 Ga0070713_10000610110 157
66 3300009093 Ga0105240_10185474 Ga0105240_101854742 157
67 3300014497 Ga0182008_10048730 Ga0182008_100487302 157
68 3300015262 Ga0182007_10012840 Ga0182007_100128403 157
69 3300025226 Ga0209674_100678 Ga0209674_1006789 157
70 3300025228 Ga0209672_100049 Ga0209672_10004986 157
71 3300025228 Ga0209672_100058 Ga0209672_10005819 157
72 3300025230 Ga0209563_100051 Ga0209563_10005185 157
73 3300025231 Ga0207427_100069 Ga0207427_10006961 157
74 3300025231 Ga0207427_100081 Ga0207427_10008175 157
75 3300025231 Ga0207427_100224 Ga0207427_10022447 157
76 3300025233 Ga0209437_100168 Ga0209437_10016875 157
77 3300025233 Ga0209437_100273 Ga0209437_1002737 157
78 3300025233 Ga0209437_100287 Ga0209437_10028761 157
79 3300025242 Ga0209258_100087 Ga0209258_10008786 157
80 3300025242 Ga0209258_100164 Ga0209258_10016425 157
81 3300025246 Ga0209646_1001743 Ga0209646_10017433 157
82 3300025250 Ga0209026_1000145 Ga0209026_100014574 157
83 3300025250 Ga0209026_1001959 Ga0209026_10019599 157
84 3300025254 Ga0209148_1000039 Ga0209148_100003996 157
85 3300025254 Ga0209148_1000096 Ga0209148_100009686 157
86 3300025256 Ga0209759_1000249 Ga0209759_100024914 157
87 3300025261 Ga0209233_1000083 Ga0209233_100008361 157
88 3300025261 Ga0209233_1000092 Ga0209233_1000092121 157
89 3300025261 Ga0209233_1000151 Ga0209233_100015175 157
90 3300025272 Ga0209455_1000034 Ga0209455_100003497 157
91 3300025272 Ga0209455_1000088 Ga0209455_100008886 157
92 3300025928 Ga0207700_10006249 Ga0207700_100062497 157
93 3300025929 Ga0207664_10744324 Ga0207664_107443241 157
94 3300042005 Ga0439448_0138534 Ga0439448_0138534_345_818 157
95 3300044656 Ga0466969_0000538 Ga0466969_0000538_5994_6467 157
96 3300044656 Ga0466969_0055681 Ga0466969_0055681_445_918 157
97 3300044684 Ga0466966_0003574 Ga0466966_0003574_6325_6798 157
98 3300044693 Ga0466961_0015318 Ga0466961_0015318_1630_2103 157
99 3300044693 Ga0466961_0034067 Ga0466961_0034067_1562_2035 157
100 3300044765 Ga0466970_0013242 Ga0466970_0013242_1032_1505 157
101 3300044765 Ga0466970_0037021 Ga0466970_0037021_1141_1614 157
102 3300044842 Ga0466957_0002918 Ga0466957_0002918_3754_4227 157
103 3300045049 Ga0466959_0000204 Ga0466959_0000204_17591_18064 157
104 3300045049 Ga0466959_0009505 Ga0466959_0009505_5849_6322 157
105 3300045049 Ga0466959_0033034 Ga0466959_0033034_1258_1731 157
106 3300045836 Ga0466958_0319713 Ga0466958_0319713_438_911 157
107 3300046674 Ga0495588_0170905 Ga0495588_0170905_634_1131 157
108 3300049586 Ga0501070_0001983 Ga0501070_0001983_15380_15856 157
109 3300049742 Ga0501080_0239872 Ga0501080_0239872_216_692 157
110 3300061719 Ga0466962_0226149 Ga0466962_0226149_142_615 157
111 iso_pu_bacteria 2895395659 2895397060 157
112 iso_pu_bacteria 8021622325 8021626008 157
113 iso_pu_bacteria 8021648035 8021651747 157
114 3300002705 JGI25156J39149_1001864 JGI25156J39149_10018642 158
115 3300002741 JGI25157J39369_1000182 JGI25157J39369_100018227 158
116 3300005336 Ga0070680_100381121 Ga0070680_1003811212 158
117 3300005339 Ga0070660_100015685 Ga0070660_1000156855 158
118 3300005339 Ga0070660_100228905 Ga0070660_1002289051 158
119 3300005344 Ga0070661_100062948 Ga0070661_1000629483 158
120 3300005366 Ga0070659_100006933 Ga0070659_1000069339 158
121 3300005366 Ga0070659_100211253 Ga0070659_1002112531 158
122 3300005366 Ga0070659_100213328 Ga0070659_1002133281 158
123 3300005366 Ga0070659_100753843 Ga0070659_1007538431 158
124 3300005435 Ga0070714_100000088 Ga0070714_10000008819 158
125 3300005444 Ga0070694_100163371 Ga0070694_1001633713 158
126 3300005457 Ga0070662_100151164 Ga0070662_1001511643 158
127 3300005458 Ga0070681_10117473 Ga0070681_101174734 158
128 3300005458 Ga0070681_10191046 Ga0070681_101910462 158
129 3300005530 Ga0070679_100017411 Ga0070679_1000174113 158
130 3300005539 Ga0068853_100253872 Ga0068853_1002538721 158
131 3300005539 Ga0068853_100943368 Ga0068853_1009433681 158
132 3300005546 Ga0070696_100026950 Ga0070696_1000269501 158
133 3300005547 Ga0070693_100001999 Ga0070693_1000019995 158
134 3300005577 Ga0068857_100112428 Ga0068857_1001124283 158
135 3300005577 Ga0068857_100414105 Ga0068857_1004141051 158
136 3300005578 Ga0068854_100147198 Ga0068854_1001471982 158
137 3300005614 Ga0068856_100116668 Ga0068856_1001166684 158
138 3300009545 Ga0105237_10421291 Ga0105237_104212912 158
139 3300009551 Ga0105238_11126064 Ga0105238_111260642 158
140 3300013100 Ga0157373_10103514 Ga0157373_101035144 158
141 3300013100 Ga0157373_10191560 Ga0157373_101915602 158
142 3300013100 Ga0157373_10505280 Ga0157373_105052802 158
143 3300013102 Ga0157371_10394269 Ga0157371_103942691 158
144 3300013104 Ga0157370_10002036 Ga0157370_1000203623 158
145 3300013104 Ga0157370_11792214 Ga0157370_117922141 158
146 3300013105 Ga0157369_10518763 Ga0157369_105187631 158
147 3300013307 Ga0157372_10266920 Ga0157372_102669203 158
148 3300013307 Ga0157372_10600585 Ga0157372_106005852 158
149 3300013307 Ga0157372_10674915 Ga0157372_106749153 158
150 3300025250 Ga0209026_1000060 Ga0209026_100006094 158
151 3300025256 Ga0209759_1000295 Ga0209759_100029545 158
152 3300025904 Ga0207647_10006719 Ga0207647_100067192 158
153 3300025909 Ga0207705_10008157 Ga0207705_100081578 158
154 3300025912 Ga0207707_10164449 Ga0207707_101644492 158
155 3300025914 Ga0207671_10271724 Ga0207671_102717242 158
156 3300025917 Ga0207660_10082373 Ga0207660_100823732 158
157 3300025919 Ga0207657_10107836 Ga0207657_101078363 158
158 3300025919 Ga0207657_10130005 Ga0207657_101300053 158
159 3300025919 Ga0207657_10162614 Ga0207657_101626143 158
160 3300025919 Ga0207657_10368396 Ga0207657_103683962 158
161 3300025924 Ga0207694_10213209 Ga0207694_102132093 158
162 3300025924 Ga0207694_10416113 Ga0207694_104161132 158
163 3300025929 Ga0207664_10000066 Ga0207664_1000006680 158
164 3300025932 Ga0207690_10004293 Ga0207690_100042934 158
165 3300025932 Ga0207690_10012344 Ga0207690_100123446 158
166 3300025932 Ga0207690_10114807 Ga0207690_101148073 158
167 3300025933 Ga0207706_10017342 Ga0207706_100173423 158
168 3300025933 Ga0207706_10195663 Ga0207706_101956632 158
169 3300026041 Ga0207639_10305497 Ga0207639_103054971 158
170 3300026116 Ga0207674_10182013 Ga0207674_101820134 158
171 3300037312 Ga0395899_0000068 Ga0395899_0000068_127031_127507 158
172 3300037418 Ga0395900_0000012 Ga0395900_0000012_134092_134568 158
173 3300037466 Ga0395898_0000278 Ga0395898_0000278_21947_22423 158
174 3300038443 Ga0395901_0323462 Ga0395901_0323462_869_1363 158
175 3300041512 Ga0451853_1577216 Ga0451853_1577216_45_533 158
176 3300042000 Ga0439437_012721 Ga0439437_012721_56_550 158
177 3300044706 Ga0466964_0073804 Ga0466964_0073804_940_1416 158
178 3300046507 Ga0495606_0015919 Ga0495606_0015919_1944_2468 158
179 3300046518 Ga0495631_0217566 Ga0495631_0217566_25_549 158
180 3300047470 Ga0495681_0079292 Ga0495681_0079292_212_736 158
181 3300048911 Ga0496108_0502612 Ga0496108_0502612_18_515 158
182 3300048927 Ga0496124_0000018 Ga0496124_0000018_72919_73443 158
183 3300005366 Ga0070659_100133111 Ga0070659_1001331112 159
184 3300005435 Ga0070714_100002264 Ga0070714_1000022643 159
185 3300005539 Ga0068853_100082525 Ga0068853_1000825253 159
186 3300005563 Ga0068855_100037446 Ga0068855_1000374466 159
187 3300009174 Ga0105241_10245941 Ga0105241_102459413 159
188 3300009551 Ga0105238_10982216 Ga0105238_109822162 159
189 3300013100 Ga0157373_10014081 Ga0157373_100140819 159
190 3300013102 Ga0157371_10010685 Ga0157371_1001068510 159
191 3300013104 Ga0157370_10026436 Ga0157370_100264368 159
192 3300013307 Ga0157372_10126650 Ga0157372_101266504 159
193 3300015261 Ga0182006_1145095 Ga0182006_11450952 159
194 3300016635 Ga0183361_15013 Ga0183361_150131 159
195 3300025911 Ga0207654_10093148 Ga0207654_100931483 159
196 3300025924 Ga0207694_10377509 Ga0207694_103775092 159
197 3300025929 Ga0207664_10000315 Ga0207664_1000031514 159
198 3300025949 Ga0207667_10022326 Ga0207667_100223265 159
199 3300026041 Ga0207639_10063648 Ga0207639_100636484 159
200 3300037312 Ga0395899_0003472 Ga0395899_0003472_4335_4814 159
201 3300037418 Ga0395900_0084262 Ga0395900_0084262_319_816 159
202 3300037466 Ga0395898_0000144 Ga0395898_0000144_163912_164391 159
203 3300037466 Ga0395898_1327594 Ga0395898_1327594_60_557 159
204 3300038443 Ga0395901_0001173 Ga0395901_0001173_15525_16022 159
205 3300044683 Ga0466965_0010378 Ga0466965_0010378_2212_2691 159
206 3300044719 Ga0466971_0027097 Ga0466971_0027097_1677_2156 159
207 3300044765 Ga0466970_0092781 Ga0466970_0092781_250_729 159
208 3300044842 Ga0466957_0008967 Ga0466957_0008967_1634_2113 159
209 3300045836 Ga0466958_0013023 Ga0466958_0013023_1541_2020 159
210 3300048925 Ga0496122_0158717 Ga0496122_0158717_799_1290 159
211 3300048926 Ga0496123_0034574 Ga0496123_0034574_71_562 159
212 3300049570 Ga0501033_0434278 Ga0501033_0434278_264_752 159
213 3300049571 Ga0501034_0004493 Ga0501034_0004493_6991_7488 159
214 3300049572 Ga0501036_0008195 Ga0501036_0008195_7045_7542 159
215 3300049579 Ga0501043_0167609 Ga0501043_0167609_15_512 159
216 3300049593 Ga0501077_0769662 Ga0501077_0769662_39_536 159
217 3300049822 Ga0501035_0058432 Ga0501035_0058432_1231_1728 159
218 3300049823 Ga0501044_0148412 Ga0501044_0148412_1463_1960 159
219 3300053134 Ga0500658_0116105 Ga0500658_0116105_634_1131 159
220 3300053158 Ga0500627_0008393 Ga0500627_0008393_2730_3227 159
221 3300061719 Ga0466962_0006237 Ga0466962_0006237_1846_2325 159
222 iso_pu_bacteria 2739367700 2739730383 159
223 3300031730 Ga0307516_10269343 Ga0307516_102693432 160
224 3300049579 Ga0501043_0200613 Ga0501043_0200613_684_1172 160
225 3300049580 Ga0501046_0408153 Ga0501046_0408153_468_956 160
226 3300049581 Ga0501047_0116423 Ga0501047_0116423_632_1120 160
227 3300049822 Ga0501035_0107098 Ga0501035_0107098_656_1144 160
228 3300049823 Ga0501044_0120077 Ga0501044_0120077_725_1213 160
229 3300003756 Ga0055533_1000782 Ga0055533_10007824 161
230 3300013102 Ga0157371_10236462 Ga0157371_102364623 161
231 3300025226 Ga0209674_100043 Ga0209674_100043135 161
232 3300046507 Ga0495606_0000242 Ga0495606_0000242_62707_63216 161
233 3300046542 Ga0495597_0157985 Ga0495597_0157985_295_804 161
234 3300046694 Ga0495649_0005342 Ga0495649_0005342_5854_6363 161
235 3300048918 Ga0496115_0000177 Ga0496115_0000177_58025_58534 161
236 3300048929 Ga0496126_0012227 Ga0496126_0012227_8102_8611 161
237 3300049569 Ga0501032_0324943 Ga0501032_0324943_237_737 161
238 3300049572 Ga0501036_0309413 Ga0501036_0309413_578_1078 161
239 3300049580 Ga0501046_0119683 Ga0501046_0119683_643_1143 161
240 3300049581 Ga0501047_0835071 Ga0501047_0835071_38_544 161
241 3300049822 Ga0501035_0043677 Ga0501035_0043677_417_905 161
242 3300049823 Ga0501044_0039228 Ga0501044_0039228_3492_3980 161
243 3300049823 Ga0501044_0728146 Ga0501044_0728146_325_831 161
244 3300039447 Ga0436361_0755138 Ga0436361_0755138_350_892 162
245 3300002737 JGI25162J39368_1000057 JGI25162J39368_100005735 163
246 3300002772 JGI25164J39214_1000043 JGI25164J39214_100004334 163
247 3300003214 JGI25165J46597_1000113 JGI25165J46597_1000113121 163
248 3300003751 Ga0055538_1001003 Ga0055538_10010036 163
249 3300003761 Ga0055535_1000043 Ga0055535_100004335 163
250 3300003762 Ga0055542_1000072 Ga0055542_1000072121 163
251 3300003763 Ga0055529_1000339 Ga0055529_100033922 163
252 3300005365 Ga0070688_100028808 Ga0070688_1000288083 163
253 3300005466 Ga0070685_10015608 Ga0070685_100156084 163
254 3300025207 Ga0209760_103980 Ga0209760_1039801 163
255 3300025224 Ga0209784_100073 Ga0209784_100073117 163
256 3300025225 Ga0209566_101719 Ga0209566_1017194 163
257 3300025231 Ga0207427_100013 Ga0207427_100013324 163
258 3300025233 Ga0209437_100015 Ga0209437_100015213 163
259 3300025233 Ga0209437_102587 Ga0209437_1025873 163
260 3300025242 Ga0209258_100049 Ga0209258_100049320 163
261 3300025246 Ga0209646_1000393 Ga0209646_10003934 163
262 3300025250 Ga0209026_1000094 Ga0209026_1000094136 163
263 3300025254 Ga0209148_1000010 Ga0209148_1000010701 163
264 3300025256 Ga0209759_1000761 Ga0209759_10007615 163
265 3300025256 Ga0209759_1009407 Ga0209759_10094073 163
266 3300025261 Ga0209233_1000009 Ga0209233_1000009470 163
267 3300025272 Ga0209455_1000082 Ga0209455_1000082213 163
268 3300003761 Ga0055535_1000754 Ga0055535_10007545 164
269 3300003762 Ga0055542_1000224 Ga0055542_100022459 164
270 3300015685 Ga0183369_1007 Ga0183369_1007242 164
271 3300025228 Ga0209672_101104 Ga0209672_1011048 164
272 3300025242 Ga0209258_100149 Ga0209258_10014960 164
273 3300025254 Ga0209148_1000143 Ga0209148_100014360 164
274 3300025272 Ga0209455_1010397 Ga0209455_10103973 164
275 3300049570 Ga0501033_0001185 Ga0501033_0001185_20234_20737 164
276 3300049573 Ga0501037_0212686 Ga0501037_0212686_389_967 164
277 3300049575 Ga0501039_0774798 Ga0501039_0774798_75_590 164
278 3300001989 JGI24739J22299_10000089 JGI24739J22299_100000891 165
279 3300003578 Ga0006562J51391_1011821 Ga0006562J51391_10118211 165
280 3300005616 Ga0068852_100121517 Ga0068852_1001215173 165
281 3300005834 Ga0068851_10056948 Ga0068851_100569482 165
282 3300009551 Ga0105238_10317843 Ga0105238_103178433 165
283 3300012502 Ga0157347_1024315 Ga0157347_10243151 165
284 3300013306 Ga0163162_10043913 Ga0163162_100439134 165
285 3300013307 Ga0157372_10311548 Ga0157372_103115483 165
286 3300014969 Ga0157376_10030620 Ga0157376_100306201 165
287 3300026067 Ga0207678_10098268 Ga0207678_100982682 165
288 3300046460 Ga0495638_0005670 Ga0495638_0005670_8242_8754 165
289 3300046471 Ga0495650_0000078 Ga0495650_0000078_173107_173619 165
290 3300001979 JGI24740J21852_10022400 JGI24740J21852_100224004 166
291 3300002067 JGI24735J21928_10002530 JGI24735J21928_100025304 166
292 3300002705 JGI25156J39149_1001534 JGI25156J39149_10015345 166
293 3300002741 JGI25157J39369_1001918 JGI25157J39369_10019183 166
294 3300002772 JGI25164J39214_1013601 JGI25164J39214_10136011 166
295 3300003316 rootH1_10132142 rootH1_101321422 166
296 3300003316 rootH1_10166365 rootH1_101663652 166
297 3300003762 Ga0055542_1000067 Ga0055542_100006735 166
298 3300005262 Ga0065165_1013513 Ga0065165_10135132 166
299 3300005337 Ga0070682_100178658 Ga0070682_1001786583 166
300 3300005455 Ga0070663_100003752 Ga0070663_1000037522 166
301 3300005457 Ga0070662_100588615 Ga0070662_1005886151 166
302 3300005546 Ga0070696_100313841 Ga0070696_1003138412 166
303 3300005547 Ga0070693_100291276 Ga0070693_1002912763 166
304 3300005563 Ga0068855_100160142 Ga0068855_1001601422 166
305 3300005563 Ga0068855_100214682 Ga0068855_1002146823 166
306 3300005577 Ga0068857_100004412 Ga0068857_1000044129 166
307 3300005578 Ga0068854_100007475 Ga0068854_1000074757 166
308 3300005578 Ga0068854_100155724 Ga0068854_1001557241 166
309 3300005578 Ga0068854_100746509 Ga0068854_1007465092 166
310 3300005614 Ga0068856_100000447 Ga0068856_10000044730 166
311 3300005617 Ga0068859_100497687 Ga0068859_1004976873 166
312 3300005842 Ga0068858_100480092 Ga0068858_1004800922 166
313 3300006931 Ga0097620_100497741 Ga0097620_1004977413 166
314 3300009093 Ga0105240_10019235 Ga0105240_100192355 166
315 3300009093 Ga0105240_10065905 Ga0105240_100659053 166
316 3300009093 Ga0105240_10128740 Ga0105240_101287402 166
317 3300009093 Ga0105240_10429365 Ga0105240_104293653 166
318 3300009545 Ga0105237_10000007 Ga0105237_10000007251 166
319 3300009545 Ga0105237_10000063 Ga0105237_100000637 166
320 3300009551 Ga0105238_10140924 Ga0105238_101409242 166
321 3300012500 Ga0157314_1000730 Ga0157314_10007301 166
322 3300013104 Ga0157370_10004621 Ga0157370_1000462110 166
323 3300013105 Ga0157369_10070852 Ga0157369_100708525 166
324 3300015687 Ga0183368_1002 Ga0183368_1002150 166
325 3300020070 Ga0206356_10569860 Ga0206356_105698605 166
326 3300020082 Ga0206353_10004922 Ga0206353_100049222 166
327 3300025231 Ga0207427_102570 Ga0207427_1025704 166
328 3300025242 Ga0209258_100551 Ga0209258_10055131 166
329 3300025246 Ga0209646_1004069 Ga0209646_10040693 166
330 3300025250 Ga0209026_1000866 Ga0209026_100086614 166
331 3300025256 Ga0209759_1003734 Ga0209759_10037343 166
332 3300025258 Ga0209129_1010470 Ga0209129_10104701 166
333 3300025297 Ga0209758_1005240 Ga0209758_10052408 166
334 3300025904 Ga0207647_10006001 Ga0207647_100060018 166
335 3300025913 Ga0207695_10005651 Ga0207695_1000565115 166
336 3300025913 Ga0207695_10015963 Ga0207695_100159633 166
337 3300025913 Ga0207695_10017386 Ga0207695_100173868 166
338 3300025913 Ga0207695_10042408 Ga0207695_100424084 166
339 3300025913 Ga0207695_10402970 Ga0207695_104029702 166
340 3300025914 Ga0207671_10000021 Ga0207671_10000021111 166
341 3300025914 Ga0207671_10000074 Ga0207671_100000748 166
342 3300025933 Ga0207706_10355319 Ga0207706_103553191 166
343 3300025949 Ga0207667_10000141 Ga0207667_1000014194 166
344 3300025949 Ga0207667_10001686 Ga0207667_1000168626 166
345 3300025981 Ga0207640_10005354 Ga0207640_100053543 166
346 3300025981 Ga0207640_10012031 Ga0207640_100120316 166
347 3300025981 Ga0207640_10255295 Ga0207640_102552953 166
348 3300026067 Ga0207678_10001930 Ga0207678_1000193013 166
349 3300026078 Ga0207702_10000644 Ga0207702_1000064425 166
350 3300026116 Ga0207674_10000168 Ga0207674_1000016879 166
351 3300041452 Ga0451793_1877366 Ga0451793_1877366_625_1125 166
352 3300044656 Ga0466969_0017506 Ga0466969_0017506_3007_3522 166
353 3300044658 Ga0466972_0181250 Ga0466972_0181250_212_727 166
354 3300044672 Ga0466982_0000004 Ga0466982_0000004_376774_377289 166
355 3300044683 Ga0466965_0344206 Ga0466965_0344206_40_555 166
356 3300044684 Ga0466966_0005847 Ga0466966_0005847_3118_3633 166
357 3300044706 Ga0466964_0058382 Ga0466964_0058382_440_955 166
358 3300044719 Ga0466971_0019109 Ga0466971_0019109_1664_2179 166
359 3300044735 Ga0466968_0243922 Ga0466968_0243922_27_542 166
360 3300044901 Ga0466960_0007681 Ga0466960_0007681_121_636 166
361 3300045976 Ga0466967_0145910 Ga0466967_0145910_1050_1559 166
362 3300046460 Ga0495638_0000007 Ga0495638_0000007_493380_493883 166
363 3300048916 Ga0496113_0005362 Ga0496113_0005362_7114_7626 166
364 3300048918 Ga0496115_0000158 Ga0496115_0000158_53497_54009 166
365 3300048924 Ga0496121_0074694 Ga0496121_0074694_2139_2639 166
366 3300048928 Ga0496125_0000517 Ga0496125_0000517_9570_10070 166
367 3300061719 Ga0466962_0001511 Ga0466962_0001511_2680_3195 166

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fex-assembly2.cif.gz_C-2 the crystal structure of dj-1 superfamily protein atu0886 from agrobacterium tumefaciens 0.5269 49 87
4q5g-assembly1.cif.gz_A-2 crystal structure of mouse serum amyloid a3 0.421 93 162
2h1j-assembly2.cif.gz_B 3.1 a x-ray structure of putative oligoendopeptidase f: crystals grown by microfluidic seeding 0.4108 19 127
7l7f-assembly1.cif.gz_D cryo-em structure of human ace2 receptor bound to protein encoded by vaccine candidate bnt162b1 0.3469 19 155
1npc-assembly1.cif.gz_A the structure of neutral protease from bacillus cereus at 0.2-nm resolution 0.3442 50 166
ID Description Score Start End Superfamily
af_A1ZAW0_568_674_3.30.160.380 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Dicer dimerisation domain 0.7625 144 164 3.30.160.380
af_Q2FXE0_43_154_1.10.10.2910 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.6829 23 78 1.10.10.2910
af_Q09884_534_629_3.30.160.380 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Dicer dimerisation domain 0.5906 135 165 3.30.160.380
af_Q5BJS0_244_335_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.5777 131 165 3.30.160.20
2fexA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5234 49 87 3.40.50.880
ID Description Score Start End GO Terms
AF-F0BGA3-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9996 11 156
AF-A0A0G9H6P7-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9987 11 166
AF-B0RY64-F1-model_v4 ImmA/IrrE family metallo-endopeptidase 0.9983 9 156
AF-A0A3S0PFY5-F1-model_v4 ImmA/IrrE family metallo-endopeptidase 0.9977 22 164
AF-A0A2W6VXR7-F1-model_v4 Uncharacterized protein 0.9977 11 157

Feature Viewer

pLDDT pTM Quality
91.8 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map