F424326

General Info

Members Datasets Scaffolds Average Seq Length
367 211 734 138

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10260251|Ga0114129_102602511
Length 159
Sequence MLRIDARMRGHPHYLKGFPERRVMNMSLSRGQNIVSWILQLLAAVVLFQTLFFKFTGAKESVYIFSALGLEPWGRIGSGVVELIASVLLVIPSTVTFGAILSLGVISGAIFSHLTKLGIALPAVNDRGELFALAVLVFVCSAAVLVLHRREIPLIGSRF

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 0.82
Rhizosphere 95.64
Stem 0
Stem Tuber 0
Unclassified 31.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10260251 3300009147 Unclassified 2326
2 SwRhRL2b_contig_1536841 2162886007 Unclassified 952
3 rootH2_10043080 3300003320 Bacteria 1511
4 rootL2_10076430 3300003322 Bacteria 2156
5 Ga0065712_10347854 3300005290 Bacteria 781
6 Ga0065712_10540291 3300005290 Bacteria 624
7 Ga0065715_10661883 3300005293 Unclassified 673
8 Ga0065707_10304173 3300005295 Unclassified 998
9 Ga0070683_100128273 3300005329 Bacteria 2399
10 Ga0070683_100302058 3300005329 Bacteria 1523
11 Ga0070683_101360214 3300005329 Bacteria 682
12 Ga0068869_101706187 3300005334 Unclassified 562
13 Ga0070666_10288216 3300005335 Unclassified 1168
14 Ga0070680_100137058 3300005336 Bacteria 2051
15 Ga0070660_100034954 3300005339 Bacteria 3801
16 Ga0070689_100042666 3300005340 Bacteria 3483
17 Ga0070689_100255434 3300005340 Bacteria 1447
18 Ga0070689_100632907 3300005340 Bacteria 929
19 Ga0070661_100014781 3300005344 Bacteria 5504
20 Ga0070661_100015589 3300005344 Bacteria 5364
21 Ga0070661_100311346 3300005344 Bacteria 1228
22 Ga0070661_100330152 3300005344 Unclassified 1193
23 Ga0070668_100398359 3300005347 Bacteria 1175
24 Ga0070669_100323273 3300005353 Bacteria 1246
25 Ga0070669_100819050 3300005353 Bacteria 792
26 Ga0070675_100266954 3300005354 Bacteria 1501
27 Ga0070675_100740638 3300005354 Unclassified 896
28 Ga0070671_100015762 3300005355 Bacteria 6107
29 Ga0070671_100030872 3300005355 Unclassified 4423
30 Ga0070671_100216044 3300005355 Bacteria 1627
31 Ga0070674_100015883 3300005356 Bacteria 4710
32 Ga0070673_100230309 3300005364 Unclassified 1607
33 Ga0070688_100302183 3300005365 Bacteria 1157
34 Ga0070659_100014659 3300005366 Bacteria 5862
35 Ga0070659_101373966 3300005366 Unclassified 627
36 Ga0070667_100056530 3300005367 Bacteria 3315
37 Ga0070667_100309760 3300005367 Bacteria 1423
38 Ga0070667_100358526 3300005367 Bacteria 1321
39 Ga0070709_10448622 3300005434 Unclassified 971
40 Ga0070714_100001370 3300005435 Bacteria 17640
41 Ga0070713_100005520 3300005436 Bacteria 8660
42 Ga0070710_10477819 3300005437 Unclassified 849
43 Ga0070711_101418950 3300005439 Bacteria 604
44 Ga0070694_100566737 3300005444 Unclassified 911
45 Ga0070694_100635045 3300005444 Unclassified 863
46 Ga0070663_100696248 3300005455 Unclassified 863
47 Ga0070678_101819791 3300005456 Bacteria 574
48 Ga0070662_100003325 3300005457 Bacteria 10026
49 Ga0070681_10428055 3300005458 Bacteria 1235
50 Ga0068867_100798920 3300005459 Unclassified 841
51 Ga0070685_11435066 3300005466 Unclassified 530
52 Ga0070706_100135812 3300005467 Bacteria 2296
53 Ga0070706_100661000 3300005467 Unclassified 970
54 Ga0070698_101446556 3300005471 Bacteria 638
55 Ga0070699_100000004 3300005518 Bacteria 404262
56 Ga0070684_100090273 3300005535 Bacteria 2724
57 Ga0070684_100926116 3300005535 Unclassified 817
58 Ga0068853_100092074 3300005539 Unclassified 2667
59 Ga0070686_100045476 3300005544 Bacteria 2765
60 Ga0070696_100000002 3300005546 Bacteria 168761
61 Ga0070665_102151401 3300005548 Bacteria 562
62 Ga0070704_100293875 3300005549 Bacteria 1351
63 Ga0068855_100191564 3300005563 Unclassified 2306
64 Ga0068855_101690751 3300005563 Bacteria 645
65 Ga0070664_100317992 3300005564 Bacteria 1410
66 Ga0070664_100727542 3300005564 Unclassified 925
67 Ga0070664_100856516 3300005564 Bacteria 851
68 Ga0068857_100076854 3300005577 Unclassified 2978
69 Ga0068857_100135147 3300005577 Unclassified 2226
70 Ga0068857_100207658 3300005577 Bacteria 1786
71 Ga0068852_100254719 3300005616 Unclassified 1683
72 Ga0068852_100665989 3300005616 Bacteria 1049
73 Ga0068859_100031479 3300005617 Bacteria 5327
74 Ga0068859_100087799 3300005617 Bacteria 3158
75 Ga0068859_100404688 3300005617 Bacteria 1461
76 Ga0068859_100518410 3300005617 Bacteria 1287
77 Ga0068859_100895040 3300005617 Bacteria 972
78 Ga0068859_102251075 3300005617 Unclassified 601
79 Ga0068864_100055227 3300005618 Bacteria 3428
80 Ga0068864_100275990 3300005618 Bacteria 1567
81 Ga0068864_100286775 3300005618 Bacteria 1538
82 Ga0068864_101688338 3300005618 Unclassified 638
83 Ga0068861_100123311 3300005719 Bacteria 2093
84 Ga0068851_10086700 3300005834 Bacteria 1643
85 Ga0068870_10223333 3300005840 Bacteria 1154
86 Ga0068863_100111909 3300005841 Bacteria 2600
87 Ga0068863_100424943 3300005841 Archaea 1302
88 Ga0068863_100559401 3300005841 Bacteria 1130
89 Ga0068863_101554394 3300005841 Bacteria 670
90 Ga0068858_100302229 3300005842 Bacteria 1527
91 Ga0068858_100488972 3300005842 Unclassified 1188
92 Ga0068858_100680396 3300005842 Bacteria 1000
93 Ga0068858_100712523 3300005842 Unclassified 977
94 Ga0068858_101072465 3300005842 Unclassified 790
95 Ga0068860_100004010 3300005843 Bacteria 15115
96 Ga0068860_100165690 3300005843 Bacteria 2133
97 Ga0068860_101032606 3300005843 Bacteria 840
98 Ga0068860_102082421 3300005843 Bacteria 589
99 Ga0070717_10018463 3300006028 Bacteria 5446
100 Ga0070717_10192809 3300006028 Bacteria 1781
101 Ga0070717_10228182 3300006028 Unclassified 1639
102 Ga0070717_10804213 3300006028 Unclassified 855
103 Ga0070717_11426370 3300006028 Bacteria 629
104 Ga0070715_10876827 3300006163 Unclassified 551
105 Ga0070712_100139696 3300006175 Bacteria 1847
106 Ga0075367_10039820 3300006178 Unclassified 2741
107 Ga0075427_10034905 3300006194 Unclassified 835
108 Ga0075366_10075496 3300006195 Unclassified 2011
109 Ga0097621_100170913 3300006237 Bacteria 1873
110 Ga0097621_100952081 3300006237 Bacteria 801
111 Ga0075433_10005436 3300006852 Bacteria 10008
112 Ga0075433_10146648 3300006852 Bacteria 2098
113 Ga0075433_11863131 3300006852 Unclassified 516
114 Ga0075434_100422390 3300006871 Bacteria 1354
115 Ga0075434_100433333 3300006871 Bacteria 1336
116 Ga0075434_101198846 3300006871 Bacteria 771
117 Ga0075429_100277703 3300006880 Unclassified 1467
118 Ga0068865_101323337 3300006881 Unclassified 641
119 Ga0075436_100000227 3300006914 Bacteria 34999
120 Ga0075436_100213695 3300006914 Bacteria 1368
121 Ga0097620_100031482 3300006931 Bacteria 5327
122 Ga0097620_100087802 3300006931 Bacteria 3158
123 Ga0097620_100404696 3300006931 Bacteria 1461
124 Ga0097620_100518412 3300006931 Bacteria 1287
125 Ga0097620_100895055 3300006931 Bacteria 972
126 Ga0097620_102251472 3300006931 Unclassified 601
127 Ga0105240_10073688 3300009093 Unclassified 4216
128 Ga0105240_10120512 3300009093 Bacteria 3159
129 Ga0105240_10150571 3300009093 Bacteria 2771
130 Ga0111539_10019381 3300009094 Bacteria 8398
131 Ga0111539_10634689 3300009094 Bacteria 1244
132 Ga0105245_10070296 3300009098 Bacteria 3176
133 Ga0105245_10680575 3300009098 Bacteria 1061
134 Ga0105245_11914619 3300009098 Bacteria 646
135 Ga0105247_10054888 3300009101 Unclassified 2458
136 Ga0105247_10165500 3300009101 Bacteria 1467
137 Ga0114129_10192878 3300009147 Bacteria 2765
138 Ga0114129_11308888 3300009147 Unclassified 898
139 Ga0105241_10031265 3300009174 Bacteria 3986
140 Ga0105241_10036008 3300009174 Bacteria 3724
141 Ga0105242_10163752 3300009176 Bacteria 1949
142 Ga0105242_10487481 3300009176 Bacteria 1170
143 Ga0105242_11158521 3300009176 Bacteria 790
144 Ga0105248_10141668 3300009177 Bacteria 2712
145 Ga0105248_10160096 3300009177 Bacteria 2540
146 Ga0105248_10394900 3300009177 Bacteria 1557
147 Ga0105248_10489985 3300009177 Bacteria 1386
148 Ga0105248_10723545 3300009177 Bacteria 1123
149 Ga0105248_11303438 3300009177 Bacteria 821
150 Ga0105248_12204128 3300009177 Unclassified 627
151 Ga0105237_10026539 3300009545 Bacteria 5920
152 Ga0105237_10057712 3300009545 Unclassified 3884
153 Ga0105237_10485755 3300009545 Bacteria 1241
154 Ga0105237_12349961 3300009545 Unclassified 543
155 Ga0105238_10726394 3300009551 Bacteria 1006
156 Ga0105249_10077022 3300009553 Bacteria 3092
157 Ga0105249_11150631 3300009553 Unclassified 847
158 Ga0105239_10035011 3300010375 Bacteria 5515
159 Ga0105239_10192450 3300010375 Bacteria 2283
160 Ga0105239_11387574 3300010375 Unclassified 811
161 Ga0105239_11826348 3300010375 Bacteria 704
162 Ga0157370_10087489 3300013104 Bacteria 2927
163 Ga0157370_10132655 3300013104 Bacteria 2323
164 Ga0157370_10224584 3300013104 Unclassified 1739
165 Ga0157369_10130487 3300013105 Bacteria 2664
166 Ga0157374_10785691 3300013296 Unclassified 967
167 Ga0157374_11122641 3300013296 Unclassified 807
168 Ga0157374_11463895 3300013296 Bacteria 706
169 Ga0157378_10204306 3300013297 Unclassified 1870
170 Ga0157378_10369093 3300013297 Bacteria 1406
171 Ga0163162_10020013 3300013306 Bacteria 6573
172 Ga0163162_10064741 3300013306 Bacteria 3701
173 Ga0163162_11330349 3300013306 Unclassified 817
174 Ga0157372_11353320 3300013307 Unclassified 821
175 Ga0157375_10009200 3300013308 Bacteria 8661
176 Ga0157375_10010743 3300013308 Bacteria 8068
177 Ga0157375_10088369 3300013308 Bacteria 3154
178 Ga0157375_10688076 3300013308 Bacteria 1177
179 Ga0157375_10748292 3300013308 Bacteria 1129
180 Ga0157375_11535410 3300013308 Unclassified 786
181 Ga0163163_10000868 3300014325 Bacteria 25773
182 Ga0163163_10027377 3300014325 Bacteria 5460
183 Ga0163163_10045262 3300014325 Unclassified 4319
184 Ga0163163_10851461 3300014325 Unclassified 975
185 Ga0157380_10085327 3300014326 Bacteria 2591
186 Ga0157380_10434220 3300014326 Unclassified 1256
187 Ga0157380_10696511 3300014326 Unclassified 1020
188 Ga0157379_10076504 3300014968 Bacteria 2997
189 Ga0157376_10106446 3300014969 Bacteria 2460
190 Ga0157376_10335356 3300014969 Bacteria 1442
191 Ga0163161_10175968 3300017792 Bacteria 1638
192 Ga0163161_10483364 3300017792 Bacteria 1006
193 Ga0207697_10196336 3300025315 Bacteria 887
194 Ga0207656_10057918 3300025321 Bacteria 1691
195 Ga0207710_10180905 3300025900 Bacteria 1034
196 Ga0207710_10383347 3300025900 Bacteria 720
197 Ga0207645_10728844 3300025907 Bacteria 674
198 Ga0207643_10180495 3300025908 Bacteria 1277
199 Ga0207684_10292445 3300025910 Bacteria 1405
200 Ga0207654_11265115 3300025911 Bacteria 538
201 Ga0207707_10359736 3300025912 Bacteria 1253
202 Ga0207695_10039433 3300025913 Bacteria 5077
203 Ga0207695_10091949 3300025913 Bacteria 3046
204 Ga0207671_10305093 3300025914 Bacteria 1258
205 Ga0207693_10048303 3300025915 Bacteria 3341
206 Ga0207663_10000022 3300025916 Bacteria 134855
207 Ga0207663_10478242 3300025916 Unclassified 965
208 Ga0207660_10836676 3300025917 Unclassified 751
209 Ga0207657_10059006 3300025919 Bacteria 3300
210 Ga0207649_10176224 3300025920 Bacteria 1493
211 Ga0207649_10485920 3300025920 Bacteria 937
212 Ga0207652_10897412 3300025921 Unclassified 783
213 Ga0207694_11376238 3300025924 Bacteria 596
214 Ga0207659_10389867 3300025926 Bacteria 1163
215 Ga0207687_11181249 3300025927 Unclassified 657
216 Ga0207700_10000864 3300025928 Bacteria 17442
217 Ga0207664_10004595 3300025929 Bacteria 9354
218 Ga0207644_10033918 3300025931 Unclassified 3571
219 Ga0207690_10072521 3300025932 Bacteria 2378
220 Ga0207690_11173143 3300025932 Unclassified 641
221 Ga0207706_10003327 3300025933 Bacteria 15380
222 Ga0207686_10469227 3300025934 Unclassified 971
223 Ga0207670_10336016 3300025936 Bacteria 1192
224 Ga0207670_10761810 3300025936 Unclassified 805
225 Ga0207704_11344979 3300025938 Bacteria 611
226 Ga0207711_10057864 3300025941 Bacteria 3333
227 Ga0207711_10146859 3300025941 Bacteria 2125
228 Ga0207689_10585650 3300025942 Bacteria 938
229 Ga0207661_10215388 3300025944 Bacteria 1695
230 Ga0207679_10308406 3300025945 Bacteria 1367
231 Ga0207679_11407903 3300025945 Unclassified 640
232 Ga0207667_10151915 3300025949 Unclassified 2383
233 Ga0207667_10186466 3300025949 Bacteria 2129
234 Ga0207651_10043142 3300025960 Bacteria 3008
235 Ga0207651_10511400 3300025960 Bacteria 1040
236 Ga0207712_10122623 3300025961 Bacteria 1969
237 Ga0207640_10395061 3300025981 Bacteria 1124
238 Ga0207658_10070768 3300025986 Bacteria 2640
239 Ga0207658_10127021 3300025986 Bacteria 2043
240 Ga0207658_10332034 3300025986 Bacteria 1319
241 Ga0207677_10800801 3300026023 Unclassified 843
242 Ga0207703_10016657 3300026035 Bacteria 5733
243 Ga0207703_10265486 3300026035 Bacteria 1553
244 Ga0207703_10350668 3300026035 Bacteria 1359
245 Ga0207703_10466906 3300026035 Unclassified 1181
246 Ga0207639_10178012 3300026041 Bacteria 1807
247 Ga0207641_10028272 3300026088 Unclassified 4632
248 Ga0207641_10064556 3300026088 Bacteria 3129
249 Ga0207641_10094653 3300026088 Bacteria 2620
250 Ga0207641_10508176 3300026088 Bacteria 1171
251 Ga0207648_10331093 3300026089 Bacteria 1370
252 Ga0207648_10880529 3300026089 Unclassified 836
253 Ga0207676_10080228 3300026095 Bacteria 2648
254 Ga0207676_10347587 3300026095 Bacteria 1370
255 Ga0207676_10448864 3300026095 Bacteria 1215
256 Ga0207676_11184575 3300026095 Bacteria 757
257 Ga0207676_11585026 3300026095 Unclassified 652
258 Ga0207674_10034556 3300026116 Bacteria 5282
259 Ga0207674_10043499 3300026116 Unclassified 4631
260 Ga0207674_10057795 3300026116 Bacteria 3932
261 Ga0207675_100201419 3300026118 Bacteria 1912
262 Ga0207683_10472957 3300026121 Bacteria 1156
263 Ga0207683_12092545 3300026121 Bacteria 514
264 Ga0207698_10110036 3300026142 Unclassified 2307
265 Ga0209813_10024229 3300027866 Bacteria 1734
266 Ga0207428_10058280 3300027907 Bacteria 3065
267 Ga0268266_10000087 3300028379 Bacteria 199089
268 Ga0268266_10302320 3300028379 Unclassified 1493
269 Ga0268264_10148031 3300028381 Bacteria 2102
270 Ga0268264_10176167 3300028381 Bacteria 1938
271 Ga0268264_10584748 3300028381 Unclassified 1099
272 Ga0268264_10628227 3300028381 Bacteria 1061
273 Ga0268264_10742564 3300028381 Unclassified 977
274 Ga0307405_10413910 3300031731 Bacteria 1059
275 Ga0307405_11540821 3300031731 Bacteria 585
276 Ga0307413_11318837 3300031824 Bacteria 632
277 Ga0307413_11864666 3300031824 Unclassified 539
278 Ga0307413_11917030 3300031824 Unclassified 533
279 Ga0307410_10252499 3300031852 Unclassified 1372
280 Ga0307410_10859337 3300031852 Bacteria 775
281 Ga0307406_10437993 3300031901 Bacteria 1045
282 Ga0307406_12073391 3300031901 Bacteria 509
283 Ga0307407_10583924 3300031903 Bacteria 830
284 Ga0307412_10974206 3300031911 Bacteria 748
285 Ga0307409_100246734 3300031995 Unclassified 1630
286 Ga0307409_102185486 3300031995 Unclassified 583
287 Ga0307409_102628523 3300031995 Unclassified 532
288 Ga0307409_102793808 3300031995 Unclassified 516
289 Ga0307416_100825973 3300032002 Unclassified 1024
290 Ga0307416_101404338 3300032002 Unclassified 804
291 Ga0307414_10207787 3300032004 Unclassified 1598
292 Ga0307411_10109556 3300032005 Bacteria 1973
293 Ga0307415_100066891 3300032126 Bacteria 2510
294 Ga0307415_100296740 3300032126 Bacteria 1337
295 Ga0373936_0282710 3300035113 Unclassified 746
296 Ga0373954_0223675 3300035118 Bacteria 926
297 Ga0373943_0736720 3300035170 Bacteria 585
298 Ga0373927_1032605 3300035695 Unclassified 542
299 Ga0395900_0080376 3300037418 Bacteria 3350
300 Ga0395900_0272427 3300037418 Bacteria 1687
301 Ga0395900_1294149 3300037418 Bacteria 643
302 Ga0395898_0082300 3300037466 Bacteria 3103
303 Ga0395905_0141944 3300037471 Unclassified 2259
304 Ga0395905_1085182 3300037471 Unclassified 704
305 Ga0436364_0121831 3300037853 Unclassified 892
306 Ga0395901_0321039 3300038443 Bacteria 1602
307 Ga0395901_0874744 3300038443 Bacteria 882
308 Ga0436365_1313651 3300039437 Bacteria 133292
309 Ga0436365_1393531 3300039437 Bacteria 3350
310 Ga0436360_1040069 3300039438 Bacteria 1467
311 Ga0436363_0471530 3300039450 Bacteria 1493
312 Ga0439456_053535 3300042013 Bacteria 883
313 Ga0451577_0210961 3300042876 Bacteria 1754
314 Ga0451577_0418465 3300042876 Archaea 1217
315 Ga0439440_0171775 3300042993 Unclassified 631
316 Ga0453684_1857487 3300044712 Unclassified 611
317 Ga0451576_0924026 3300045051 Bacteria 915
318 Ga0495629_0098672 3300046459 Bacteria 2038
319 Ga0495580_0053251 3300046472 Bacteria 2857
320 Ga0495580_0443203 3300046472 Unclassified 872
321 Ga0495616_0143305 3300046513 Unclassified 1086
322 Ga0495628_0335383 3300046516 Bacteria 1114
323 Ga0495630_0097974 3300046517 Bacteria 2218
324 Ga0495643_0189897 3300046522 Bacteria 992
325 Ga0495640_0083206 3300046533 Bacteria 2124
326 Ga0495640_0156594 3300046533 Unclassified 1462
327 Ga0495586_0702567 3300046535 Bacteria 584
328 Ga0495634_0276480 3300046642 Unclassified 1021
329 Ga0495613_0119594 3300046689 Bacteria 1892
330 Ga0495624_0095242 3300046690 Bacteria 1835
331 Ga0495600_0144236 3300046809 Bacteria 1544
332 Ga0495674_0105246 3300047319 Unclassified 2398
333 Ga0495674_0461865 3300047319 Unclassified 1019
334 Ga0495684_0372646 3300047471 Bacteria 1009
335 Ga0496104_0392802 3300048907 Unclassified 1299
336 Ga0496111_0595119 3300048914 Unclassified 810
337 Ga0496112_0915034 3300048915 Bacteria 799
338 Ga0501309_041494 3300049129 Unclassified 704
339 Ga0501309_066757 3300049129 Unclassified 586
340 Ga0501033_0734234 3300049570 Unclassified 670
341 Ga0501037_0016014 3300049573 Bacteria 5519
342 Ga0501038_1271739 3300049574 Unclassified 532
343 Ga0501040_0114839 3300049576 Bacteria 1885
344 Ga0501043_0358263 3300049579 Unclassified 1107
345 Ga0501046_0242772 3300049580 Bacteria 1328
346 Ga0501068_0056750 3300049584 Unclassified 2374
347 Ga0501225_0101354 3300049705 Bacteria 841
348 Ga0501080_1762783 3300049742 Bacteria 521
349 Ga0501044_0000971 3300049823 Bacteria 34481
350 Ga0501045_0395367 3300049824 Unclassified 1029
351 nmdc:mga0k408_17566_c3 3300050493 Bacteria 1905
352 nmdc:mga04h51_13131_c1 3300050495 Unclassified 2340
353 nmdc:mga07m45_302233_c1 3300050496 Bacteria 930
354 nmdc:mga05p37_3031_c1 3300050507 Bacteria 19512
355 nmdc:mga05p37_331377_c1 3300050507 Bacteria 1798
356 nmdc:mga09592_321471_c1 3300050508 Unclassified 1340
357 nmdc:mga06r32_68871_c1 3300050510 Bacteria 3419
358 nmdc:mga08y16_349240_c1 3300050511 Bacteria 1520
359 nmdc:mga0n895_335083_c1 3300050512 Bacteria 1533
360 nmdc:mga0n895_485960_c1 3300050512 Bacteria 1245
361 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
362 nmdc:mga08x19_397921_c1 3300050514 Bacteria 966
363 nmdc:mga0a205_112131_c1 3300050515 Bacteria 2626
364 nmdc:mga0a205_564_c1 3300050515 Bacteria 29455
365 nmdc:mga0a205_734501_c1 3300050515 Bacteria 836
366 Ga0495619_0740413 3300053085 Unclassified 667
367 Ga0500616_0003627 3300053153 Bacteria 11622
368 Ga0114129_10260251
369 SwRhRL2b_contig_1536841
370 rootH2_10043080
371 rootL2_10076430
372 Ga0065712_10347854
373 Ga0065712_10540291
374 Ga0065715_10661883
375 Ga0065707_10304173
376 Ga0070683_100128273
377 Ga0070683_100302058
378 Ga0070683_101360214
379 Ga0068869_101706187
380 Ga0070666_10288216
381 Ga0070680_100137058
382 Ga0070660_100034954
383 Ga0070689_100042666
384 Ga0070689_100255434
385 Ga0070689_100632907
386 Ga0070661_100014781
387 Ga0070661_100015589
388 Ga0070661_100311346
389 Ga0070661_100330152
390 Ga0070668_100398359
391 Ga0070669_100323273
392 Ga0070669_100819050
393 Ga0070675_100266954
394 Ga0070675_100740638
395 Ga0070671_100015762
396 Ga0070671_100030872
397 Ga0070671_100216044
398 Ga0070674_100015883
399 Ga0070673_100230309
400 Ga0070688_100302183
401 Ga0070659_100014659
402 Ga0070659_101373966
403 Ga0070667_100056530
404 Ga0070667_100309760
405 Ga0070667_100358526
406 Ga0070709_10448622
407 Ga0070714_100001370
408 Ga0070713_100005520
409 Ga0070710_10477819
410 Ga0070711_101418950
411 Ga0070694_100566737
412 Ga0070694_100635045
413 Ga0070663_100696248
414 Ga0070678_101819791
415 Ga0070662_100003325
416 Ga0070681_10428055
417 Ga0068867_100798920
418 Ga0070685_11435066
419 Ga0070706_100135812
420 Ga0070706_100661000
421 Ga0070698_101446556
422 Ga0070699_100000004
423 Ga0070684_100090273
424 Ga0070684_100926116
425 Ga0068853_100092074
426 Ga0070686_100045476
427 Ga0070696_100000002
428 Ga0070665_102151401
429 Ga0070704_100293875
430 Ga0068855_100191564
431 Ga0068855_101690751
432 Ga0070664_100317992
433 Ga0070664_100727542
434 Ga0070664_100856516
435 Ga0068857_100076854
436 Ga0068857_100135147
437 Ga0068857_100207658
438 Ga0068852_100254719
439 Ga0068852_100665989
440 Ga0068859_100031479
441 Ga0068859_100087799
442 Ga0068859_100404688
443 Ga0068859_100518410
444 Ga0068859_100895040
445 Ga0068859_102251075
446 Ga0068864_100055227
447 Ga0068864_100275990
448 Ga0068864_100286775
449 Ga0068864_101688338
450 Ga0068861_100123311
451 Ga0068851_10086700
452 Ga0068870_10223333
453 Ga0068863_100111909
454 Ga0068863_100424943
455 Ga0068863_100559401
456 Ga0068863_101554394
457 Ga0068858_100302229
458 Ga0068858_100488972
459 Ga0068858_100680396
460 Ga0068858_100712523
461 Ga0068858_101072465
462 Ga0068860_100004010
463 Ga0068860_100165690
464 Ga0068860_101032606
465 Ga0068860_102082421
466 Ga0070717_10018463
467 Ga0070717_10192809
468 Ga0070717_10228182
469 Ga0070717_10804213
470 Ga0070717_11426370
471 Ga0070715_10876827
472 Ga0070712_100139696
473 Ga0075367_10039820
474 Ga0075427_10034905
475 Ga0075366_10075496
476 Ga0097621_100170913
477 Ga0097621_100952081
478 Ga0075433_10005436
479 Ga0075433_10146648
480 Ga0075433_11863131
481 Ga0075434_100422390
482 Ga0075434_100433333
483 Ga0075434_101198846
484 Ga0075429_100277703
485 Ga0068865_101323337
486 Ga0075436_100000227
487 Ga0075436_100213695
488 Ga0097620_100031482
489 Ga0097620_100087802
490 Ga0097620_100404696
491 Ga0097620_100518412
492 Ga0097620_100895055
493 Ga0097620_102251472
494 Ga0105240_10073688
495 Ga0105240_10120512
496 Ga0105240_10150571
497 Ga0111539_10019381
498 Ga0111539_10634689
499 Ga0105245_10070296
500 Ga0105245_10680575
501 Ga0105245_11914619
502 Ga0105247_10054888
503 Ga0105247_10165500
504 Ga0114129_10192878
505 Ga0114129_11308888
506 Ga0105241_10031265
507 Ga0105241_10036008
508 Ga0105242_10163752
509 Ga0105242_10487481
510 Ga0105242_11158521
511 Ga0105248_10141668
512 Ga0105248_10160096
513 Ga0105248_10394900
514 Ga0105248_10489985
515 Ga0105248_10723545
516 Ga0105248_11303438
517 Ga0105248_12204128
518 Ga0105237_10026539
519 Ga0105237_10057712
520 Ga0105237_10485755
521 Ga0105237_12349961
522 Ga0105238_10726394
523 Ga0105249_10077022
524 Ga0105249_11150631
525 Ga0105239_10035011
526 Ga0105239_10192450
527 Ga0105239_11387574
528 Ga0105239_11826348
529 Ga0157370_10087489
530 Ga0157370_10132655
531 Ga0157370_10224584
532 Ga0157369_10130487
533 Ga0157374_10785691
534 Ga0157374_11122641
535 Ga0157374_11463895
536 Ga0157378_10204306
537 Ga0157378_10369093
538 Ga0163162_10020013
539 Ga0163162_10064741
540 Ga0163162_11330349
541 Ga0157372_11353320
542 Ga0157375_10009200
543 Ga0157375_10010743
544 Ga0157375_10088369
545 Ga0157375_10688076
546 Ga0157375_10748292
547 Ga0157375_11535410
548 Ga0163163_10000868
549 Ga0163163_10027377
550 Ga0163163_10045262
551 Ga0163163_10851461
552 Ga0157380_10085327
553 Ga0157380_10434220
554 Ga0157380_10696511
555 Ga0157379_10076504
556 Ga0157376_10106446
557 Ga0157376_10335356
558 Ga0163161_10175968
559 Ga0163161_10483364
560 Ga0207697_10196336
561 Ga0207656_10057918
562 Ga0207710_10180905
563 Ga0207710_10383347
564 Ga0207645_10728844
565 Ga0207643_10180495
566 Ga0207684_10292445
567 Ga0207654_11265115
568 Ga0207707_10359736
569 Ga0207695_10039433
570 Ga0207695_10091949
571 Ga0207671_10305093
572 Ga0207693_10048303
573 Ga0207663_10000022
574 Ga0207663_10478242
575 Ga0207660_10836676
576 Ga0207657_10059006
577 Ga0207649_10176224
578 Ga0207649_10485920
579 Ga0207652_10897412
580 Ga0207694_11376238
581 Ga0207659_10389867
582 Ga0207687_11181249
583 Ga0207700_10000864
584 Ga0207664_10004595
585 Ga0207644_10033918
586 Ga0207690_10072521
587 Ga0207690_11173143
588 Ga0207706_10003327
589 Ga0207686_10469227
590 Ga0207670_10336016
591 Ga0207670_10761810
592 Ga0207704_11344979
593 Ga0207711_10057864
594 Ga0207711_10146859
595 Ga0207689_10585650
596 Ga0207661_10215388
597 Ga0207679_10308406
598 Ga0207679_11407903
599 Ga0207667_10151915
600 Ga0207667_10186466
601 Ga0207651_10043142
602 Ga0207651_10511400
603 Ga0207712_10122623
604 Ga0207640_10395061
605 Ga0207658_10070768
606 Ga0207658_10127021
607 Ga0207658_10332034
608 Ga0207677_10800801
609 Ga0207703_10016657
610 Ga0207703_10265486
611 Ga0207703_10350668
612 Ga0207703_10466906
613 Ga0207639_10178012
614 Ga0207641_10028272
615 Ga0207641_10064556
616 Ga0207641_10094653
617 Ga0207641_10508176
618 Ga0207648_10331093
619 Ga0207648_10880529
620 Ga0207676_10080228
621 Ga0207676_10347587
622 Ga0207676_10448864
623 Ga0207676_11184575
624 Ga0207676_11585026
625 Ga0207674_10034556
626 Ga0207674_10043499
627 Ga0207674_10057795
628 Ga0207675_100201419
629 Ga0207683_10472957
630 Ga0207683_12092545
631 Ga0207698_10110036
632 Ga0209813_10024229
633 Ga0207428_10058280
634 Ga0268266_10000087
635 Ga0268266_10302320
636 Ga0268264_10148031
637 Ga0268264_10176167
638 Ga0268264_10584748
639 Ga0268264_10628227
640 Ga0268264_10742564
641 Ga0307405_10413910
642 Ga0307405_11540821
643 Ga0307413_11318837
644 Ga0307413_11864666
645 Ga0307413_11917030
646 Ga0307410_10252499
647 Ga0307410_10859337
648 Ga0307406_10437993
649 Ga0307406_12073391
650 Ga0307407_10583924
651 Ga0307412_10974206
652 Ga0307409_100246734
653 Ga0307409_102185486
654 Ga0307409_102628523
655 Ga0307409_102793808
656 Ga0307416_100825973
657 Ga0307416_101404338
658 Ga0307414_10207787
659 Ga0307411_10109556
660 Ga0307415_100066891
661 Ga0307415_100296740
662 Ga0373936_0282710
663 Ga0373954_0223675
664 Ga0373943_0736720
665 Ga0373927_1032605
666 Ga0395900_0080376
667 Ga0395900_0272427
668 Ga0395900_1294149
669 Ga0395898_0082300
670 Ga0395905_0141944
671 Ga0395905_1085182
672 Ga0436364_0121831
673 Ga0395901_0321039
674 Ga0395901_0874744
675 Ga0436365_1313651
676 Ga0436365_1393531
677 Ga0436360_1040069
678 Ga0436363_0471530
679 Ga0439456_053535
680 Ga0451577_0210961
681 Ga0451577_0418465
682 Ga0439440_0171775
683 Ga0453684_1857487
684 Ga0451576_0924026
685 Ga0495629_0098672
686 Ga0495580_0053251
687 Ga0495580_0443203
688 Ga0495616_0143305
689 Ga0495628_0335383
690 Ga0495630_0097974
691 Ga0495643_0189897
692 Ga0495640_0083206
693 Ga0495640_0156594
694 Ga0495586_0702567
695 Ga0495634_0276480
696 Ga0495613_0119594
697 Ga0495624_0095242
698 Ga0495600_0144236
699 Ga0495674_0105246
700 Ga0495674_0461865
701 Ga0495684_0372646
702 Ga0496104_0392802
703 Ga0496111_0595119
704 Ga0496112_0915034
705 Ga0501309_041494
706 Ga0501309_066757
707 Ga0501033_0734234
708 Ga0501037_0016014
709 Ga0501038_1271739
710 Ga0501040_0114839
711 Ga0501043_0358263
712 Ga0501046_0242772
713 Ga0501068_0056750
714 Ga0501225_0101354
715 Ga0501080_1762783
716 Ga0501044_0000971
717 Ga0501045_0395367
718 nmdc:mga0k408_17566_c3
719 nmdc:mga04h51_13131_c1
720 nmdc:mga07m45_302233_c1
721 nmdc:mga05p37_3031_c1
722 nmdc:mga05p37_331377_c1
723 nmdc:mga09592_321471_c1
724 nmdc:mga06r32_68871_c1
725 nmdc:mga08y16_349240_c1
726 nmdc:mga0n895_335083_c1
727 nmdc:mga0n895_485960_c1
728 nmdc:mga08x19_2_c1
729 nmdc:mga08x19_397921_c1
730 nmdc:mga0a205_112131_c1
731 nmdc:mga0a205_564_c1
732 nmdc:mga0a205_734501_c1
733 Ga0495619_0740413
734 Ga0500616_0003627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13564

DoxX_2

DoxX-like family

38

117

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x90-assembly1.cif.gz_A crystal structure of mutant form b of a pectin methylesterase inhibitor from arabidopsis 0.588 2 131
1x90-assembly1.cif.gz_A crystal structure of mutant form b of a pectin methylesterase inhibitor from arabidopsis 0.5284 2 131
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.528 10 129
2jsw-assembly1.cif.gz_A solution structure of the r13 domain of talin 0.5265 8 132
5nqn-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.5219 20 124
ID Description Score Start End Superfamily
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.743 15 131 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7091 15 131 1.10.10.1740
af_B4FUV0_1_167_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6326 7 133 1.20.140.150
af_L7N692_9_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6304 24 124 1.20.120.550
af_Q8ILG1_854_1177_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.6251 18 140 3.40.50.1240
ID Description Score Start End GO Terms
AF-I4AQP8-F1-model_v4 DoxX protein 0.9884 13 131 GO:0016020
AF-A0A2E0VTK4-F1-model_v4 DoxX family protein 0.9837 13 134 GO:0016020
AF-A0A4V0XKT0-F1-model_v4 DoxX family protein 0.9825 12 133 GO:0016020
AF-A0A7Y5L5V5-F1-model_v4 DoxX family protein 0.9818 12 142 GO:0016020
AF-A0A495KK26-F1-model_v4 DoxX-like protein 0.9817 15 135 GO:0016020

Map