F424301

General Info

Members Datasets Scaffolds Average Seq Length
367 250 734 514

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10025802|Ga0075366_100258024
Length 525
Sequence MSDKLDNHLGGRWIAGTAQGTALLDPVLGTELVRVDATGLDLRAGFAFAREQGGSALRSMSYAQRAAMLAAIVKVLQANRDAYYEIATANCGTVKSDSGIDIDGGIYTLSTYAKLGDKLAATAIHGRYLLDGDSAGLAKDNAFQSQHVLVPSRGLALFINAFNFPSWGLWEKAAPALLAGVPVVVKPATATAWLTQRMVQDVIAAGVLPQGALSVVCGSSAGLLDALEPFDVVSFTGSAETAAVIRSHPAVAQRSVRVNIEADSINSALLLPGHAQGSESFDLLVKEVMREMTQKSGQKCTAIRRVLVPEVVYASVAEAIGARLAKTTVGNPRNETVRMGSLVSRAQLVAVREGLAHLAGQAQVIHDGRSQALVDADPAVACCVGPTLLGTRDAAGSDASDRVHDTEVFGPVATLIPYRDLDHAHALVRRGQGSLVASLYGSDPEALAASAMELAPYHGRVHVISPDAAAVHTGHGNVMPQSLHGGPGRAGGGEELGGVRALNFYHRRAAIQAGASTIAALTQPD

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
104 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
105 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
108 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
109 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
124 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
128 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
129 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
130 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
131 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
132 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
133 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
180 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
181 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
182 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
183 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
186 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
192 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
193 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
194 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
195 2547132374 Acidovorax radicis N35 Isolate Unclassified
196 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
197 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
198 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
199 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
200 2643221570 Acidovorax sp. Root568 Isolate Unclassified
201 2643221596 Acidovorax sp. Root70 Isolate Unclassified
202 2643221609 Acidovorax sp. Root217 Isolate Unclassified
203 2643221611 Acidovorax sp. Root219 Isolate Unclassified
204 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
205 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
206 2643221652 Acidovorax sp. Root402 Isolate Unclassified
207 2643221658 Variovorax sp. Root411 Isolate Unclassified
208 2643221672 Variovorax sp. Root434 Isolate Unclassified
209 2643221683 Variovorax sp. Root473 Isolate Unclassified
210 2643221717 Acidovorax sp. Root267 Isolate Unclassified
211 2738541277 Variovorax sp. GV051 Isolate Unclassified
212 2738541307 Variovorax sp. GV008 Isolate Unclassified
213 2738543012 Acidovorax sp. CF301 Isolate Unclassified
214 2738543019 Variovorax sp. GV040 Isolate Unclassified
215 2816332133 Acidovorax radicis 2721A Isolate Unclassified
216 2818991446 Variovorax sp. 1180 Isolate Unclassified
217 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
218 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
219 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
220 2842677519 Variovorax sp. R-72495 Isolate Unclassified
221 2842733646 Variovorax sp. R-72446 Isolate Unclassified
222 2842747753 Variovorax sp. R-72060 Isolate Unclassified
223 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
224 2885198086 Variovorax sp. 679 Isolate Unclassified
225 2885211737 Variovorax sp. 553 Isolate Unclassified
226 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
227 2899924645 Variovorax sp. 369 Isolate Unclassified
228 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
229 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
230 2904456579 Variovorax sp. 2002 Isolate Unclassified
231 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
232 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
233 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
234 2928037797 Variovorax sp. 1126 Isolate Unclassified
235 2928044640 Variovorax sp. 1128 Isolate Unclassified
236 2928051484 Variovorax sp. 1133 Isolate Unclassified
237 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
238 2928070936 Variovorax gossypii 1167 Isolate Unclassified
239 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
240 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
241 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
242 2929520902 Variovorax beijingensis 502 Isolate Unclassified
243 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
244 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
245 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
246 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
247 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
248 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
249 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
250 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.83
Metatranscriptomes 1.09
Isolates 16.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.15
Nodule 2.45
Rhizoplane 1.63
Rhizosphere 40.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10025802 3300006195 Bacteria 3437
2 JGI24740J21852_10007031 3300001979 Bacteria 4613
3 JGI25152J39213_1003817 3300002773 Bacteria 4992
4 JGI25150J39212_1002157 3300002774 Bacteria 5065
5 JGI25151J46595_10004003 3300003187 Bacteria 7917
6 JGI25151J46595_10006105 3300003187 Bacteria 6117
7 JGI25151J46595_10009248 3300003187 Bacteria 4681
8 JGI25151J46595_10011976 3300003187 Bacteria 3961
9 JGI25153J46596_10009044 3300003215 Bacteria 4681
10 JGI26128J50194_1000773 3300003347 Bacteria 1893
11 JGI25160J50197_1007356 3300003354 Bacteria 4321
12 JGI25160J50197_1015873 3300003354 Bacteria 2453
13 JGI25161J50226_1002753 3300003374 Bacteria 4336
14 JGI25161J50226_1004868 3300003374 Bacteria 2734
15 Ga0006562J51391_1034775 3300003578 Bacteria 3890
16 Ga0006562J51391_1034776 3300003578 Bacteria 6818
17 Ga0006562J51391_1082964 3300003578 Bacteria 4597
18 Ga0006562J51391_1082965 3300003578 Bacteria 4180
19 Ga0055535_1000214 3300003761 Bacteria 61307
20 Ga0055542_1000003 3300003762 Bacteria 582721
21 Ga0055526_1010433 3300003771 Bacteria 4321
22 Ga0055526_1010520 3300003771 Bacteria 4289
23 Ga0055537_1000032 3300003773 Bacteria 98934
24 Ga0055537_1003314 3300003773 Bacteria 4992
25 Ga0055524_1008315 3300003775 Bacteria 4321
26 Ga0055524_1008409 3300003775 Bacteria 4289
27 Ga0055536_1003441 3300003781 Bacteria 8490
28 Ga0055536_1004202 3300003781 Bacteria 7444
29 Ga0055536_1004522 3300003781 Bacteria 7075
30 Ga0055534_1000060 3300003784 Bacteria 83797
31 Ga0055534_1005443 3300003784 Bacteria 3404
32 Ga0055528_1005183 3300003790 Bacteria 6128
33 Ga0055528_1005620 3300003790 Bacteria 5796
34 Ga0055530_10005093 3300003791 Bacteria 6438
35 Ga0055540_1006206 3300003792 Bacteria 4801
36 Ga0055540_1006664 3300003792 Bacteria 4532
37 Ga0055540_1007612 3300003792 Bacteria 4047
38 Ga0055531_10009861 3300003794 Bacteria 4834
39 Ga0055531_10009866 3300003794 Bacteria 4832
40 Ga0055543_1005116 3300004625 Bacteria 3411
41 Ga0065165_1008055 3300005262 Bacteria 5030
42 Ga0065714_10010741 3300005288 Bacteria 3966
43 Ga0070676_10053180 3300005328 Bacteria 2384
44 Ga0068869_100017788 3300005334 Bacteria 4828
45 Ga0068868_100027883 3300005338 Bacteria 4311
46 Ga0070669_100014067 3300005353 Bacteria 5691
47 Ga0070671_100047665 3300005355 Bacteria 3563
48 Ga0070667_100018787 3300005367 Bacteria 5732
49 Ga0070667_100182281 3300005367 Bacteria 1857
50 Ga0070663_100035058 3300005455 Bacteria 3479
51 Ga0068867_100000035 3300005459 Bacteria 81202
52 Ga0068867_100151410 3300005459 Bacteria 1822
53 Ga0070664_100006403 3300005564 Bacteria 9495
54 Ga0068857_100040252 3300005577 Bacteria 4145
55 Ga0068857_100048590 3300005577 Bacteria 3766
56 Ga0068859_100165087 3300005617 Bacteria 2294
57 Ga0068861_100005111 3300005719 Bacteria 8846
58 Ga0068851_10012736 3300005834 Bacteria 3971
59 Ga0068862_100032104 3300005844 Bacteria 4436
60 Ga0075365_10007482 3300006038 Bacteria 6121
61 Ga0075432_10001434 3300006058 Bacteria 7776
62 Ga0075362_10000620 3300006177 Bacteria 10385
63 Ga0075362_10003190 3300006177 Bacteria 5676
64 Ga0075362_10006379 3300006177 Bacteria 4395
65 Ga0075367_10025957 3300006178 Bacteria 3317
66 Ga0075366_10005017 3300006195 Bacteria 7149
67 Ga0075366_10013354 3300006195 Bacteria 4673
68 Ga0075366_10031192 3300006195 Bacteria 3136
69 Ga0075366_10036419 3300006195 Bacteria 2901
70 Ga0075370_10002256 3300006353 Bacteria 8875
71 Ga0075370_10016282 3300006353 Bacteria 3999
72 Ga0075370_10028343 3300006353 Bacteria 3112
73 Ga0068871_100049955 3300006358 Bacteria 3382
74 Ga0075428_100111195 3300006844 Bacteria 2985
75 Ga0075430_100116342 3300006846 Bacteria 2228
76 Ga0075429_100020000 3300006880 Bacteria 5805
77 Ga0097620_100165096 3300006931 Bacteria 2294
78 Ga0099823_1000745 3300006944 Bacteria 23838
79 Ga0099826_10071699 3300006948 Bacteria 2197
80 Ga0105244_10019945 3300009036 Bacteria 3727
81 Ga0105240_10020324 3300009093 Bacteria 8860
82 Ga0105245_10152741 3300009098 Bacteria 2184
83 Ga0105243_10001526 3300009148 Bacteria 20237
84 Ga0105243_10010595 3300009148 Bacteria 6999
85 Ga0105237_10002593 3300009545 Bacteria 22302
86 Ga0105239_10072301 3300010375 Bacteria 3791
87 Ga0157370_10017294 3300013104 Bacteria 7279
88 Ga0157369_10118154 3300013105 Bacteria 2814
89 Ga0157369_10380519 3300013105 Bacteria 1465
90 Ga0157375_10043794 3300013308 Bacteria 4343
91 Ga0182008_10013138 3300014497 Bacteria 4354
92 Ga0182008_10048788 3300014497 Bacteria 2103
93 Ga0157377_10000064 3300014745 Bacteria 81208
94 Ga0157376_10205207 3300014969 Bacteria 1816
95 Ga0182006_1004752 3300015261 Bacteria 6632
96 Ga0182007_10003542 3300015262 Bacteria 7353
97 Ga0182007_10007729 3300015262 Bacteria 4475
98 Ga0183362_10004 3300015683 Bacteria 569303
99 Ga0163161_10000513 3300017792 Bacteria 31599
100 Ga0163161_10007500 3300017792 Bacteria 7538
101 Ga0209436_104148 3300025208 Bacteria 3643
102 Ga0209147_101588 3300025229 Bacteria 7667
103 Ga0209258_100015 3300025242 Bacteria 706310
104 Ga0207425_1003382 3300025245 Bacteria 5125
105 Ga0209148_1000028 3300025254 Bacteria 582773
106 Ga0209129_1001616 3300025258 Bacteria 12222
107 Ga0209129_1002351 3300025258 Bacteria 9348
108 Ga0209129_1007492 3300025258 Bacteria 3240
109 Ga0209565_1000144 3300025263 Bacteria 99074
110 Ga0209565_1000972 3300025263 Bacteria 14864
111 Ga0209565_1002411 3300025263 Bacteria 6768
112 Ga0209673_1000136 3300025273 Bacteria 159975
113 Ga0209673_1000293 3300025273 Bacteria 93142
114 Ga0209673_1000400 3300025273 Bacteria 77176
115 Ga0209673_1005077 3300025273 Bacteria 6768
116 Ga0209130_1000485 3300025284 Bacteria 40942
117 Ga0209130_1000542 3300025284 Bacteria 38002
118 Ga0209675_1000071 3300025291 Bacteria 168382
119 Ga0209675_1000369 3300025291 Bacteria 38317
120 Ga0209675_1003123 3300025291 Bacteria 8074
121 Ga0209675_1006197 3300025291 Bacteria 4852
122 Ga0209676_1000241 3300025292 Bacteria 117623
123 Ga0209676_1000575 3300025292 Bacteria 55372
124 Ga0209676_1003350 3300025292 Bacteria 9987
125 Ga0209025_1000098 3300025294 Bacteria 233886
126 Ga0209025_1000305 3300025294 Bacteria 109479
127 Ga0209025_1000499 3300025294 Bacteria 75420
128 Ga0209025_1001135 3300025294 Bacteria 38119
129 Ga0209025_1007310 3300025294 Bacteria 8279
130 Ga0209025_1028247 3300025294 Bacteria 2756
131 Ga0209564_1000110 3300025295 Bacteria 212842
132 Ga0209564_1000123 3300025295 Bacteria 202487
133 Ga0209758_1000039 3300025297 Bacteria 428951
134 Ga0209758_1005047 3300025297 Bacteria 10486
135 Ga0209050_1000015 3300025298 Bacteria 759102
136 Ga0209050_1001757 3300025298 Bacteria 21484
137 Ga0209050_1007268 3300025298 Bacteria 6267
138 Ga0209256_1000074 3300025299 Bacteria 236893
139 Ga0209256_1000082 3300025299 Bacteria 221491
140 Ga0209256_1001143 3300025299 Bacteria 30119
141 Ga0207426_1000112 3300025302 Bacteria 231436
142 Ga0207426_1000121 3300025302 Bacteria 219007
143 Ga0209051_1000081 3300025303 Bacteria 195619
144 Ga0209051_1000120 3300025303 Bacteria 147281
145 Ga0209051_1001260 3300025303 Bacteria 22631
146 Ga0209051_1003831 3300025303 Bacteria 9630
147 Ga0209051_1024386 3300025303 Bacteria 2489
148 Ga0209257_1000026 3300025304 Bacteria 723225
149 Ga0209257_1000607 3300025304 Bacteria 58779
150 Ga0209257_1001634 3300025304 Bacteria 25690
151 Ga0209257_1008753 3300025304 Bacteria 5632
152 Ga0207645_10001801 3300025907 Bacteria 17298
153 Ga0207694_10036867 3300025924 Bacteria 3753
154 Ga0207659_10028403 3300025926 Bacteria 3802
155 Ga0207687_10032118 3300025927 Bacteria 3553
156 Ga0207706_10002999 3300025933 Bacteria 16269
157 Ga0207709_10000229 3300025935 Bacteria 70907
158 Ga0207709_10000680 3300025935 Bacteria 27456
159 Ga0207709_10001484 3300025935 Bacteria 16247
160 Ga0207691_10002671 3300025940 Bacteria 17429
161 Ga0207691_10057266 3300025940 Bacteria 3548
162 Ga0207689_10060419 3300025942 Bacteria 3117
163 Ga0207679_10013168 3300025945 Bacteria 5418
164 Ga0207667_10026377 3300025949 Bacteria 6350
165 Ga0207651_10003387 3300025960 Bacteria 7828
166 Ga0207658_10069990 3300025986 Bacteria 2653
167 Ga0207678_10165031 3300026067 Bacteria 1891
168 Ga0207648_10000127 3300026089 Bacteria 75361
169 Ga0207648_10089596 3300026089 Bacteria 2688
170 Ga0207674_10010169 3300026116 Bacteria 10690
171 Ga0207674_10050780 3300026116 Bacteria 4235
172 Ga0207675_100001370 3300026118 Bacteria 24426
173 Ga0207698_10027199 3300026142 Bacteria 4057
174 Ga0209389_1000105 3300027296 Bacteria 74417
175 Ga0209282_1026596 3300027666 Bacteria 3603
176 Ga0209966_1000036 3300027695 Bacteria 55883
177 Ga0307515_10000085 3300028794 Bacteria 220502
178 Ga0307515_10000204 3300028794 Bacteria 145075
179 Ga0307515_10000572 3300028794 Bacteria 86935
180 Ga0307515_10000578 3300028794 Bacteria 86019
181 Ga0307515_10002443 3300028794 Bacteria 40478
182 Ga0307515_10048568 3300028794 Bacteria 6413
183 Ga0316177_1141117 3300030731 Bacteria 2615
184 Ga0316179_1021442 3300030734 Bacteria 3030
185 Ga0316178_1018214 3300030735 Bacteria 3754
186 Ga0307513_10011094 3300031456 Bacteria 11233
187 Ga0307513_10012002 3300031456 Bacteria 10728
188 Ga0307513_10046139 3300031456 Bacteria 4756
189 Ga0307509_10130014 3300031507 Bacteria 2476
190 Ga0307514_10001068 3300031649 Bacteria 38913
191 Ga0307514_10001927 3300031649 Bacteria 22735
192 Ga0307514_10134862 3300031649 Bacteria 1692
193 Ga0307516_10000290 3300031730 Bacteria 65231
194 Ga0307516_10000326 3300031730 Bacteria 61941
195 Ga0307406_10028736 3300031901 Bacteria 3361
196 Ga0307412_10015474 3300031911 Bacteria 4525
197 Ga0307510_10098849 3300033180 Bacteria 2720
198 Ga0395900_0017681 3300037418 Bacteria 7278
199 Ga0395900_0018400 3300037418 Bacteria 7125
200 Ga0395898_0014794 3300037466 Bacteria 8009
201 Ga0395898_0029307 3300037466 Bacteria 5515
202 Ga0395905_0000856 3300037471 Bacteria 39764
203 Ga0395905_0006473 3300037471 Bacteria 11787
204 Ga0395905_0097548 3300037471 Bacteria 2760
205 Ga0395901_0019639 3300038443 Bacteria 6907
206 Ga0395901_0027388 3300038443 Bacteria 5856
207 Ga0400487_15861 3300039110 Bacteria 2071
208 Ga0439436_0006039 3300041404 Bacteria 3712
209 Ga0439436_0015751 3300041404 Bacteria 2271
210 Ga0439433_0005203 3300041999 Bacteria 2793
211 Ga0439442_000595 3300042002 Bacteria 7829
212 Ga0439445_0001671 3300042004 Bacteria 4855
213 Ga0439449_0010321 3300042007 Bacteria 3525
214 Ga0439449_0014592 3300042007 Bacteria 2953
215 Ga0439452_006745 3300042010 Bacteria 3572
216 Ga0439457_004392 3300042014 Bacteria 3681
217 Ga0450911_000710 3300042115 Bacteria 9698
218 Ga0450923_000195 3300042125 Bacteria 5795
219 Ga0450902_003753 3300042137 Bacteria 2240
220 Ga0450910_000366 3300042147 Bacteria 5268
221 Ga0450908_001431 3300042184 Bacteria 4637
222 Ga0439434_0005161 3300042435 Bacteria 3819
223 Ga0439464_0025360 3300042439 Bacteria 1641
224 Ga0451577_0000235 3300042876 Bacteria 109693
225 Ga0451577_0000771 3300042876 Bacteria 48361
226 Ga0451577_0014445 3300042876 Bacteria 7362
227 Ga0453683_0001433 3300044673 Bacteria 20726
228 Ga0453684_0000906 3300044712 Bacteria 98768
229 Ga0453684_0027873 3300044712 Bacteria 8080
230 Ga0453684_0120046 3300044712 Bacteria 3176
231 Ga0453684_0126740 3300044712 Bacteria 3071
232 Ga0451576_0007521 3300045051 Bacteria 12996
233 Ga0451576_0040859 3300045051 Bacteria 4905
234 Ga0495627_006815 3300046453 Bacteria 4444
235 Ga0495638_0052001 3300046460 Bacteria 2553
236 Ga0495639_0003916 3300046475 Bacteria 6395
237 Ga0495610_0037327 3300046512 Bacteria 2474
238 Ga0495610_0050682 3300046512 Bacteria 2025
239 Ga0495616_0002269 3300046513 Bacteria 12855
240 Ga0495620_0041648 3300046515 Bacteria 2012
241 Ga0495631_0000453 3300046518 Bacteria 27874
242 Ga0495654_0006270 3300046530 Bacteria 6773
243 Ga0495654_0018067 3300046530 Bacteria 3699
244 Ga0495609_0017577 3300046538 Bacteria 3321
245 Ga0495597_0007518 3300046542 Bacteria 5526
246 Ga0495668_0021734 3300046616 Bacteria 3674
247 Ga0495625_0000114 3300046660 Bacteria 123268
248 Ga0495625_0026506 3300046660 Bacteria 4380
249 Ga0495658_0053851 3300046683 Bacteria 2287
250 Ga0495671_0009904 3300046692 Bacteria 5304
251 Ga0495687_001835 3300047443 Bacteria 18654
252 Ga0495593_0024480 3300047673 Bacteria 3345
253 Ga0496101_0013004 3300048904 Bacteria 5568
254 Ga0496104_0009166 3300048907 Bacteria 8802
255 Ga0496106_0048275 3300048909 Bacteria 3206
256 Ga0496116_0015697 3300048919 Bacteria 5973
257 Ga0496117_0015800 3300048920 Bacteria 6406
258 Ga0496118_0015712 3300048921 Bacteria 6990
259 Ga0496118_0016743 3300048921 Bacteria 6706
260 Ga0496119_0037810 3300048922 Bacteria 3129
261 Ga0496121_0016205 3300048924 Bacteria 7713
262 Ga0496121_0054982 3300048924 Bacteria 3321
263 Ga0496121_0056361 3300048924 Bacteria 3264
264 Ga0496122_0000618 3300048925 Bacteria 72850
265 Ga0496123_0002222 3300048926 Bacteria 24628
266 Ga0496124_0036288 3300048927 Bacteria 4302
267 Ga0496124_0069532 3300048927 Bacteria 2923
268 Ga0496124_0076683 3300048927 Bacteria 2758
269 Ga0496124_0113668 3300048927 Bacteria 2175
270 Ga0496125_0028982 3300048928 Bacteria 4985
271 Ga0496125_0035387 3300048928 Bacteria 4381
272 Ga0496125_0048046 3300048928 Bacteria 3562
273 Ga0496126_0189243 3300048929 Bacteria 1744
274 Ga0501034_0003332 3300049571 Bacteria 18336
275 Ga0501034_0103195 3300049571 Bacteria 2845
276 Ga0501225_0011160 3300049705 Bacteria 2531
277 nmdc:mga03683_4113_c1 3300050489 Bacteria 4784
278 nmdc:mga03683_9950_c1 3300050489 Bacteria 3398
279 nmdc:mga0k408_11653_c1 3300050493 Bacteria 4792
280 nmdc:mga0k408_12754_c1 3300050493 Bacteria 4597
281 nmdc:mga0k408_17438_c1 3300050493 Bacteria 4001
282 nmdc:mga0k408_6401_c2 3300050493 Bacteria 4894
283 nmdc:mga07m45_10441_c1 3300050496 Bacteria 4850
284 nmdc:mga07m45_11624_c1 3300050496 Bacteria 4629
285 nmdc:mga07m45_143_c1 3300050496 Bacteria 28092
286 nmdc:mga07m45_22996_c1 3300050496 Bacteria 3405
287 nmdc:mga07m45_3332_c1 3300050496 Bacteria 6835
288 nmdc:mga09592_163573_c1 3300050508 Bacteria 1923
289 nmdc:mga0sz30_19369_c1 3300050516 Bacteria 2735
290 Ga0495601_0019212 3300053077 Bacteria 4166
291 Ga0500610_0010200 3300053079 Bacteria 4214
292 Ga0500610_0011235 3300053079 Bacteria 4068
293 Ga0500651_0000287 3300053093 Bacteria 29280
294 Ga0500562_021024 3300053108 Bacteria 1695
295 Ga0500569_011431 3300053109 Bacteria 2121
296 Ga0500571_006814 3300053110 Bacteria 6189
297 Ga0500593_003420 3300053117 Bacteria 5996
298 Ga0500607_001396 3300053121 Bacteria 21858
299 Ga0500608_009593 3300053122 Bacteria 4118
300 Ga0500626_013234 3300053128 Bacteria 3549
301 Ga0500655_002603 3300053133 Bacteria 3273
302 Ga0500658_0000201 3300053134 Bacteria 28349
303 Ga0500658_0001964 3300053134 Bacteria 8037
304 Ga0500559_0000945 3300053136 Bacteria 18296
305 Ga0500559_0012533 3300053136 Bacteria 3600
306 Ga0500568_0000491 3300053139 Bacteria 29108
307 Ga0500627_0003496 3300053158 Bacteria 4868
308 Ga0500634_0027703 3300053161 Bacteria 3087
309 2513228890 2513020051 Bacteria 6053213
310 2513955376 2513237150 Bacteria 6553639
311 2514040707 2513237165 Bacteria 6771773
312 2548501560 2547132374 Bacteria 5530232
313 2599621411 2599185214 Bacteria 8209958
314 2599670905 2599185226 Bacteria 8233575
315 2599679395 2599185227 Bacteria 8246414
316 2599690922 2599185229 Bacteria 8216126
317 2643867323 2643221570 Bacteria 5103772
318 2643990241 2643221596 Bacteria 5006805
319 2644059225 2643221609 Bacteria 6756331
320 2644075737 2643221611 Bacteria 6820941
321 2644163441 2643221628 Bacteria 5745828
322 2644246746 2643221644 Bacteria 6865017
323 2644295733 2643221652 Bacteria 5140275
324 2644327340 2643221658 Bacteria 6064537
325 2644401946 2643221672 Bacteria 6322190
326 2644465630 2643221683 Bacteria 5749203
327 2644645279 2643221717 Bacteria 5676132
328 2738722746 2738541277 Bacteria 7458140
329 2738883664 2738541307 Bacteria 8606193
330 2739240716 2738543012 Bacteria 7115078
331 2739283317 2738543019 Bacteria 7459457
332 2816472207 2816332133 Bacteria 7249298
333 2819597588 2818991446 Bacteria 7757362
334 2831268579 2831265667 Bacteria 7184833
335 2834643325 2834641062 Bacteria 5559922
336 2838058004 2838054893 Bacteria 7451788
337 2842681665 2842677519 Bacteria 5615038
338 2842735272 2842733646 Bacteria 5716726
339 2842749951 2842747753 Bacteria 5578255
340 2885195742 2885192300 Bacteria 5882526
341 2885200131 2885198086 Bacteria 7212419
342 2885213783 2885211737 Bacteria 7212420
343 2894024201 2894023352 Bacteria 5167372
344 2899929011 2899924645 Bacteria 7487985
345 2901301710 2901300506 Bacteria 8463898
346 2904451424 2904449895 Bacteria 6927402
347 2904458286 2904456579 Bacteria 6819253
348 2904543077 2904541872 Bacteria 8915136
349 2919466588 2919462493 Bacteria 5817112
350 2919706569 2919704043 Bacteria 5560311
351 2928040557 2928037797 Bacteria 7273642
352 2928046694 2928044640 Bacteria 7271509
353 2928058121 2928051484 Bacteria 7773759
354 2928067543 2928064002 Bacteria 7419480
355 2928072070 2928070936 Bacteria 8062541
356 2928085288 2928084124 Bacteria 7159212
357 2928116662 2928115317 Bacteria 6477646
358 2929160306 2929160207 Bacteria 9075316
359 2929526096 2929520902 Bacteria 6765052
360 2945915346 2945909444 Bacteria 7065066
361 2945950644 2945945610 Bacteria 5951079
362 2945974715 2945972063 Bacteria 6086495
363 2954769918 2954767861 Bacteria 5535784
364 2990711036 2990710928 Bacteria 5002431
365 644751644 644736347 Bacteria 6476522
366 8003402570 8003400568 Bacteria 5535898
367 8020945954 8020945358 Bacteria 8467355
368 Ga0075366_10025802
369 JGI24740J21852_10007031
370 JGI25152J39213_1003817
371 JGI25150J39212_1002157
372 JGI25151J46595_10004003
373 JGI25151J46595_10006105
374 JGI25151J46595_10009248
375 JGI25151J46595_10011976
376 JGI25153J46596_10009044
377 JGI26128J50194_1000773
378 JGI25160J50197_1007356
379 JGI25160J50197_1015873
380 JGI25161J50226_1002753
381 JGI25161J50226_1004868
382 Ga0006562J51391_1034775
383 Ga0006562J51391_1034776
384 Ga0006562J51391_1082964
385 Ga0006562J51391_1082965
386 Ga0055535_1000214
387 Ga0055542_1000003
388 Ga0055526_1010433
389 Ga0055526_1010520
390 Ga0055537_1000032
391 Ga0055537_1003314
392 Ga0055524_1008315
393 Ga0055524_1008409
394 Ga0055536_1003441
395 Ga0055536_1004202
396 Ga0055536_1004522
397 Ga0055534_1000060
398 Ga0055534_1005443
399 Ga0055528_1005183
400 Ga0055528_1005620
401 Ga0055530_10005093
402 Ga0055540_1006206
403 Ga0055540_1006664
404 Ga0055540_1007612
405 Ga0055531_10009861
406 Ga0055531_10009866
407 Ga0055543_1005116
408 Ga0065165_1008055
409 Ga0065714_10010741
410 Ga0070676_10053180
411 Ga0068869_100017788
412 Ga0068868_100027883
413 Ga0070669_100014067
414 Ga0070671_100047665
415 Ga0070667_100018787
416 Ga0070667_100182281
417 Ga0070663_100035058
418 Ga0068867_100000035
419 Ga0068867_100151410
420 Ga0070664_100006403
421 Ga0068857_100040252
422 Ga0068857_100048590
423 Ga0068859_100165087
424 Ga0068861_100005111
425 Ga0068851_10012736
426 Ga0068862_100032104
427 Ga0075365_10007482
428 Ga0075432_10001434
429 Ga0075362_10000620
430 Ga0075362_10003190
431 Ga0075362_10006379
432 Ga0075367_10025957
433 Ga0075366_10005017
434 Ga0075366_10013354
435 Ga0075366_10031192
436 Ga0075366_10036419
437 Ga0075370_10002256
438 Ga0075370_10016282
439 Ga0075370_10028343
440 Ga0068871_100049955
441 Ga0075428_100111195
442 Ga0075430_100116342
443 Ga0075429_100020000
444 Ga0097620_100165096
445 Ga0099823_1000745
446 Ga0099826_10071699
447 Ga0105244_10019945
448 Ga0105240_10020324
449 Ga0105245_10152741
450 Ga0105243_10001526
451 Ga0105243_10010595
452 Ga0105237_10002593
453 Ga0105239_10072301
454 Ga0157370_10017294
455 Ga0157369_10118154
456 Ga0157369_10380519
457 Ga0157375_10043794
458 Ga0182008_10013138
459 Ga0182008_10048788
460 Ga0157377_10000064
461 Ga0157376_10205207
462 Ga0182006_1004752
463 Ga0182007_10003542
464 Ga0182007_10007729
465 Ga0183362_10004
466 Ga0163161_10000513
467 Ga0163161_10007500
468 Ga0209436_104148
469 Ga0209147_101588
470 Ga0209258_100015
471 Ga0207425_1003382
472 Ga0209148_1000028
473 Ga0209129_1001616
474 Ga0209129_1002351
475 Ga0209129_1007492
476 Ga0209565_1000144
477 Ga0209565_1000972
478 Ga0209565_1002411
479 Ga0209673_1000136
480 Ga0209673_1000293
481 Ga0209673_1000400
482 Ga0209673_1005077
483 Ga0209130_1000485
484 Ga0209130_1000542
485 Ga0209675_1000071
486 Ga0209675_1000369
487 Ga0209675_1003123
488 Ga0209675_1006197
489 Ga0209676_1000241
490 Ga0209676_1000575
491 Ga0209676_1003350
492 Ga0209025_1000098
493 Ga0209025_1000305
494 Ga0209025_1000499
495 Ga0209025_1001135
496 Ga0209025_1007310
497 Ga0209025_1028247
498 Ga0209564_1000110
499 Ga0209564_1000123
500 Ga0209758_1000039
501 Ga0209758_1005047
502 Ga0209050_1000015
503 Ga0209050_1001757
504 Ga0209050_1007268
505 Ga0209256_1000074
506 Ga0209256_1000082
507 Ga0209256_1001143
508 Ga0207426_1000112
509 Ga0207426_1000121
510 Ga0209051_1000081
511 Ga0209051_1000120
512 Ga0209051_1001260
513 Ga0209051_1003831
514 Ga0209051_1024386
515 Ga0209257_1000026
516 Ga0209257_1000607
517 Ga0209257_1001634
518 Ga0209257_1008753
519 Ga0207645_10001801
520 Ga0207694_10036867
521 Ga0207659_10028403
522 Ga0207687_10032118
523 Ga0207706_10002999
524 Ga0207709_10000229
525 Ga0207709_10000680
526 Ga0207709_10001484
527 Ga0207691_10002671
528 Ga0207691_10057266
529 Ga0207689_10060419
530 Ga0207679_10013168
531 Ga0207667_10026377
532 Ga0207651_10003387
533 Ga0207658_10069990
534 Ga0207678_10165031
535 Ga0207648_10000127
536 Ga0207648_10089596
537 Ga0207674_10010169
538 Ga0207674_10050780
539 Ga0207675_100001370
540 Ga0207698_10027199
541 Ga0209389_1000105
542 Ga0209282_1026596
543 Ga0209966_1000036
544 Ga0307515_10000085
545 Ga0307515_10000204
546 Ga0307515_10000572
547 Ga0307515_10000578
548 Ga0307515_10002443
549 Ga0307515_10048568
550 Ga0316177_1141117
551 Ga0316179_1021442
552 Ga0316178_1018214
553 Ga0307513_10011094
554 Ga0307513_10012002
555 Ga0307513_10046139
556 Ga0307509_10130014
557 Ga0307514_10001068
558 Ga0307514_10001927
559 Ga0307514_10134862
560 Ga0307516_10000290
561 Ga0307516_10000326
562 Ga0307406_10028736
563 Ga0307412_10015474
564 Ga0307510_10098849
565 Ga0395900_0017681
566 Ga0395900_0018400
567 Ga0395898_0014794
568 Ga0395898_0029307
569 Ga0395905_0000856
570 Ga0395905_0006473
571 Ga0395905_0097548
572 Ga0395901_0019639
573 Ga0395901_0027388
574 Ga0400487_15861
575 Ga0439436_0006039
576 Ga0439436_0015751
577 Ga0439433_0005203
578 Ga0439442_000595
579 Ga0439445_0001671
580 Ga0439449_0010321
581 Ga0439449_0014592
582 Ga0439452_006745
583 Ga0439457_004392
584 Ga0450911_000710
585 Ga0450923_000195
586 Ga0450902_003753
587 Ga0450910_000366
588 Ga0450908_001431
589 Ga0439434_0005161
590 Ga0439464_0025360
591 Ga0451577_0000235
592 Ga0451577_0000771
593 Ga0451577_0014445
594 Ga0453683_0001433
595 Ga0453684_0000906
596 Ga0453684_0027873
597 Ga0453684_0120046
598 Ga0453684_0126740
599 Ga0451576_0007521
600 Ga0451576_0040859
601 Ga0495627_006815
602 Ga0495638_0052001
603 Ga0495639_0003916
604 Ga0495610_0037327
605 Ga0495610_0050682
606 Ga0495616_0002269
607 Ga0495620_0041648
608 Ga0495631_0000453
609 Ga0495654_0006270
610 Ga0495654_0018067
611 Ga0495609_0017577
612 Ga0495597_0007518
613 Ga0495668_0021734
614 Ga0495625_0000114
615 Ga0495625_0026506
616 Ga0495658_0053851
617 Ga0495671_0009904
618 Ga0495687_001835
619 Ga0495593_0024480
620 Ga0496101_0013004
621 Ga0496104_0009166
622 Ga0496106_0048275
623 Ga0496116_0015697
624 Ga0496117_0015800
625 Ga0496118_0015712
626 Ga0496118_0016743
627 Ga0496119_0037810
628 Ga0496121_0016205
629 Ga0496121_0054982
630 Ga0496121_0056361
631 Ga0496122_0000618
632 Ga0496123_0002222
633 Ga0496124_0036288
634 Ga0496124_0069532
635 Ga0496124_0076683
636 Ga0496124_0113668
637 Ga0496125_0028982
638 Ga0496125_0035387
639 Ga0496125_0048046
640 Ga0496126_0189243
641 Ga0501034_0003332
642 Ga0501034_0103195
643 Ga0501225_0011160
644 nmdc:mga03683_4113_c1
645 nmdc:mga03683_9950_c1
646 nmdc:mga0k408_11653_c1
647 nmdc:mga0k408_12754_c1
648 nmdc:mga0k408_17438_c1
649 nmdc:mga0k408_6401_c2
650 nmdc:mga07m45_10441_c1
651 nmdc:mga07m45_11624_c1
652 nmdc:mga07m45_143_c1
653 nmdc:mga07m45_22996_c1
654 nmdc:mga07m45_3332_c1
655 nmdc:mga09592_163573_c1
656 nmdc:mga0sz30_19369_c1
657 Ga0495601_0019212
658 Ga0500610_0010200
659 Ga0500610_0011235
660 Ga0500651_0000287
661 Ga0500562_021024
662 Ga0500569_011431
663 Ga0500571_006814
664 Ga0500593_003420
665 Ga0500607_001396
666 Ga0500608_009593
667 Ga0500626_013234
668 Ga0500655_002603
669 Ga0500658_0000201
670 Ga0500658_0001964
671 Ga0500559_0000945
672 Ga0500559_0012533
673 Ga0500568_0000491
674 Ga0500627_0003496
675 Ga0500634_0027703
676 2513228890
677 2513955376
678 2514040707
679 2548501560
680 2599621411
681 2599670905
682 2599679395
683 2599690922
684 2643867323
685 2643990241
686 2644059225
687 2644075737
688 2644163441
689 2644246746
690 2644295733
691 2644327340
692 2644401946
693 2644465630
694 2644645279
695 2738722746
696 2738883664
697 2739240716
698 2739283317
699 2816472207
700 2819597588
701 2831268579
702 2834643325
703 2838058004
704 2842681665
705 2842735272
706 2842749951
707 2885195742
708 2885200131
709 2885213783
710 2894024201
711 2899929011
712 2901301710
713 2904451424
714 2904458286
715 2904543077
716 2919466588
717 2919706569
718 2928040557
719 2928046694
720 2928058121
721 2928067543
722 2928072070
723 2928085288
724 2928116662
725 2929160306
726 2929526096
727 2945915346
728 2945950644
729 2945974715
730 2954769918
731 2990711036
732 644751644
733 8003402570
734 8020945954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

13

510

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y5d-assembly1.cif.gz_B crystal structure of c296a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.9902 1 515
2vro-assembly1.cif.gz_B crystal structure of aldehyde dehydrogenase from burkholderia xenovorans lb400 0.99 1 515
2y51-assembly1.cif.gz_A crystal structure of e167a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.9898 1 515
2y5d-assembly1.cif.gz_A crystal structure of c296a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.9898 1 513
2vro-assembly1.cif.gz_A crystal structure of aldehyde dehydrogenase from burkholderia xenovorans lb400 0.9894 1 513
ID Description Score Start End Superfamily
2y52B01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9874 1 515 3.40.605.10
2y51B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.982 260 472 3.40.309.10
af_P77455_1_261_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9769 2 262 3.40.605.10
af_P77455_1_261_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9733 2 262 3.40.605.10
2y52B01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9652 1 515 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A0D8FS84-F1-model_v4 3,4-dehydroadipyl-CoA semialdehyde dehydrogenase (EC 1.2.1.77) 0.9882 2 514 GO:0016620
AF-A0A3D2CHA2-F1-model_v4 Aldehyde dehydrogenase 0.9868 2 170 GO:0016491
AF-A0A447RIR2-F1-model_v4 Bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase (EC 1.2.1.77) 0.9845 167 338 GO:0016620
AF-A0A382HC56-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9828 83 514 GO:0016620
AF-A0A2D0NCU6-F1-model_v4 Phenylacetic acid degradation bifunctional protein PaaZ 0.9813 1 514 GO:0016620

Map