F424297

General Info

Members Datasets Scaffolds Average Seq Length
367 182 367 108

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10010312|Ga0075365_100103122
Length 126
Sequence MLTPGGSYVEYGLESILSMAKGFLTYSTTVILQAIANGYLYGFDIIDVTGMPGGTVYPALRRLDDAGYLTSEWEKPSIAQSEPRPPRKYYELTRAGREVLAEAVKRYRLVDQAQPQRKRAARPSRA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
142 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0
Rhizoplane 1.36
Rhizosphere 91.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10340630 2162886012 Bacteria 980
2 Ga0065704_10119357 3300005289 Unclassified 1801
3 Ga0065704_10240267 3300005289 Unclassified 1017
4 Ga0065715_10176154 3300005293 Bacteria 1510
5 Ga0065715_10445453 3300005293 Unclassified 831
6 Ga0065707_10037866 3300005295 Bacteria 1074
7 Ga0065707_10097789 3300005295 Bacteria 3141
8 Ga0065707_10730604 3300005295 Bacteria 626
9 Ga0065707_10825619 3300005295 Unclassified 590
10 Ga0070676_10178304 3300005328 Unclassified 1379
11 Ga0068869_101088329 3300005334 Unclassified 699
12 Ga0070666_10075562 3300005335 Bacteria 2297
13 Ga0070680_100063023 3300005336 Bacteria 3036
14 Ga0070680_100125762 3300005336 Bacteria 2142
15 Ga0070689_100120083 3300005340 Bacteria 2099
16 Ga0070687_100152128 3300005343 Bacteria 1359
17 Ga0070687_100167438 3300005343 Unclassified 1305
18 Ga0070687_101163614 3300005343 Unclassified 567
19 Ga0070692_10285494 3300005345 Unclassified 1002
20 Ga0070668_100152139 3300005347 Unclassified 1872
21 Ga0070668_100357022 3300005347 Bacteria 1238
22 Ga0070669_100002576 3300005353 Bacteria 13113
23 Ga0070669_100034095 3300005353 Bacteria 3685
24 Ga0070669_100330395 3300005353 Unclassified 1233
25 Ga0070675_100558082 3300005354 Unclassified 1036
26 Ga0070671_100104418 3300005355 Unclassified 2378
27 Ga0070671_100992429 3300005355 Unclassified 735
28 Ga0070674_100054720 3300005356 Bacteria 2761
29 Ga0070673_100175902 3300005364 Bacteria 1829
30 Ga0070688_100384289 3300005365 Bacteria 1035
31 Ga0070701_10271439 3300005438 Unclassified 1032
32 Ga0070701_10756978 3300005438 Unclassified 659
33 Ga0070700_100040723 3300005441 Unclassified 2845
34 Ga0070700_101366876 3300005441 Unclassified 597
35 Ga0070694_100522868 3300005444 Unclassified 947
36 Ga0070694_101004245 3300005444 Unclassified 693
37 Ga0070708_100020833 3300005445 Bacteria 5535
38 Ga0070708_100225350 3300005445 Bacteria 1759
39 Ga0070662_100727604 3300005457 Bacteria 841
40 Ga0070681_10001694 3300005458 Bacteria 19718
41 Ga0068867_100862261 3300005459 Unclassified 812
42 Ga0070706_100568675 3300005467 Bacteria 1054
43 Ga0070706_100638254 3300005467 Bacteria 989
44 Ga0070706_101178071 3300005467 Unclassified 704
45 Ga0070698_100713842 3300005471 Unclassified 945
46 Ga0070698_100838957 3300005471 Bacteria 864
47 Ga0070699_100029889 3300005518 Bacteria 4700
48 Ga0070699_100072190 3300005518 Bacteria 3002
49 Ga0070699_100077920 3300005518 Unclassified 2886
50 Ga0070699_100607259 3300005518 Archaea 998
51 Ga0070699_101093714 3300005518 Bacteria 731
52 Ga0070699_102211615 3300005518 Unclassified 502
53 Ga0070679_100001724 3300005530 Bacteria 19718
54 Ga0070672_100024692 3300005543 Bacteria 4446
55 Ga0070686_100820353 3300005544 Unclassified 751
56 Ga0070695_100081031 3300005545 Unclassified 2147
57 Ga0070696_100192955 3300005546 Bacteria 1517
58 Ga0070696_101070010 3300005546 Bacteria 677
59 Ga0070693_100250071 3300005547 Unclassified 1175
60 Ga0070693_100870575 3300005547 Unclassified 673
61 Ga0070665_101053756 3300005548 Bacteria 825
62 Ga0070704_100110812 3300005549 Unclassified 2088
63 Ga0070704_100563539 3300005549 Unclassified 997
64 Ga0070704_100695927 3300005549 Unclassified 901
65 Ga0070704_101165689 3300005549 Unclassified 702
66 Ga0070704_102116578 3300005549 Unclassified 523
67 Ga0070704_102166595 3300005549 Unclassified 517
68 Ga0068857_100025712 3300005577 Bacteria 5184
69 Ga0068857_100663582 3300005577 Unclassified 989
70 Ga0068854_100105770 3300005578 Bacteria 2116
71 Ga0068854_100323459 3300005578 Unclassified 1254
72 Ga0068852_101124465 3300005616 Bacteria 806
73 Ga0068859_100006122 3300005617 Bacteria 12222
74 Ga0068859_100073372 3300005617 Bacteria 3460
75 Ga0068859_100706427 3300005617 Bacteria 1099
76 Ga0068864_100555681 3300005618 Bacteria 1110
77 Ga0068864_101909718 3300005618 Unclassified 599
78 Ga0068861_100059151 3300005719 Bacteria 2933
79 Ga0068861_100278680 3300005719 Unclassified 1439
80 Ga0068861_101230672 3300005719 Bacteria 725
81 Ga0068861_101251510 3300005719 Bacteria 720
82 Ga0068861_101284480 3300005719 Unclassified 711
83 Ga0068861_102655546 3300005719 Unclassified 505
84 Ga0068870_10159539 3300005840 Bacteria 1336
85 Ga0068863_100123928 3300005841 Bacteria 2465
86 Ga0068858_100126226 3300005842 Bacteria 2396
87 Ga0068860_100017540 3300005843 Bacteria 6975
88 Ga0068860_100792171 3300005843 Unclassified 961
89 Ga0068860_101413226 3300005843 Unclassified 717
90 Ga0068860_102153134 3300005843 Bacteria 579
91 Ga0068862_100029995 3300005844 Bacteria 4582
92 Ga0068862_100044710 3300005844 Unclassified 3777
93 Ga0068862_100182217 3300005844 Bacteria 1886
94 Ga0068862_101045737 3300005844 Bacteria 809
95 Ga0068862_101313701 3300005844 Unclassified 725
96 Ga0081455_10002364 3300005937 Bacteria 22518
97 Ga0081455_10034984 3300005937 Bacteria 4495
98 Ga0081455_10073330 3300005937 Bacteria 2830
99 Ga0081455_10716257 3300005937 Unclassified 636
100 Ga0081540_1152819 3300005983 Unclassified 908
101 Ga0081539_10021960 3300005985 Bacteria 4240
102 Ga0075365_10010312 3300006038 Bacteria 5429
103 Ga0075364_10001881 3300006051 Bacteria 11663
104 Ga0070716_101710325 3300006173 Unclassified 519
105 Ga0075362_10015780 3300006177 Bacteria 3079
106 Ga0075367_10041681 3300006178 Bacteria 2685
107 Ga0075367_10502244 3300006178 Bacteria 769
108 Ga0075366_10003642 3300006195 Bacteria 8166
109 Ga0075366_10004473 3300006195 Bacteria 7500
110 Ga0075366_10034582 3300006195 Bacteria 2977
111 Ga0097621_100506459 3300006237 Bacteria 1094
112 Ga0075370_10233617 3300006353 Bacteria 1088
113 Ga0068871_101371992 3300006358 Bacteria 666
114 Ga0068871_101667967 3300006358 Unclassified 604
115 Ga0075428_100003277 3300006844 Bacteria 17706
116 Ga0075428_100387915 3300006844 Bacteria 1497
117 Ga0075428_100919504 3300006844 Unclassified 928
118 Ga0075428_101249606 3300006844 Unclassified 782
119 Ga0075430_101502872 3300006846 Unclassified 553
120 Ga0075431_100028590 3300006847 Bacteria 5731
121 Ga0075431_100028769 3300006847 Bacteria 5714
122 Ga0075431_100031050 3300006847 Bacteria 5503
123 Ga0075431_100065727 3300006847 Bacteria 3745
124 Ga0075431_100574327 3300006847 Unclassified 1113
125 Ga0075431_100599122 3300006847 Bacteria 1086
126 Ga0075431_101449570 3300006847 Unclassified 645
127 Ga0075433_10265675 3300006852 Bacteria 1521
128 Ga0075433_10312456 3300006852 Bacteria 1391
129 Ga0075433_10743869 3300006852 Unclassified 858
130 Ga0075433_10923337 3300006852 Unclassified 761
131 Ga0075433_11600851 3300006852 Unclassified 562
132 Ga0075433_11932650 3300006852 Unclassified 506
133 Ga0075434_100253606 3300006871 Bacteria 1778
134 Ga0075429_100277464 3300006880 Bacteria 1468
135 Ga0075429_100348592 3300006880 Bacteria 1296
136 Ga0075429_100494713 3300006880 Unclassified 1071
137 Ga0075429_100553951 3300006880 Bacteria 1008
138 Ga0075429_100602824 3300006880 Bacteria 962
139 Ga0097620_100006122 3300006931 Bacteria 12222
140 Ga0097620_100073372 3300006931 Bacteria 3460
141 Ga0097620_100706437 3300006931 Bacteria 1099
142 Ga0075435_100247887 3300007076 Unclassified 1516
143 Ga0075435_100501948 3300007076 Unclassified 1049
144 Ga0075435_100530367 3300007076 Unclassified 1019
145 Ga0075435_101646835 3300007076 Unclassified 563
146 Ga0111539_10014809 3300009094 Bacteria 9727
147 Ga0111539_10041551 3300009094 Bacteria 5528
148 Ga0111539_10108268 3300009094 Bacteria 3261
149 Ga0111539_10560911 3300009094 Bacteria 1330
150 Ga0111539_10942207 3300009094 Unclassified 1004
151 Ga0111539_11345427 3300009094 Bacteria 829
152 Ga0111539_12121471 3300009094 Unclassified 652
153 Ga0105245_11207078 3300009098 Unclassified 804
154 Ga0105247_10574389 3300009101 Bacteria 832
155 Ga0114129_10024022 3300009147 Bacteria 8638
156 Ga0114129_10031513 3300009147 Bacteria 7494
157 Ga0114129_10072870 3300009147 Plasmid 4786
158 Ga0114129_10078541 3300009147 Unclassified 4591
159 Ga0114129_10087427 3300009147 Bacteria 4322
160 Ga0114129_10135545 3300009147 Bacteria 3378
161 Ga0114129_10205732 3300009147 Unclassified 2663
162 Ga0114129_10242463 3300009147 Bacteria 2423
163 Ga0114129_10852873 3300009147 Unclassified 1158
164 Ga0114129_10974278 3300009147 Bacteria 1070
165 Ga0114129_13261484 3300009147 Unclassified 526
166 Ga0105243_12685953 3300009148 Unclassified 538
167 Ga0105241_11810612 3300009174 Unclassified 596
168 Ga0105242_10562860 3300009176 Unclassified 1095
169 Ga0105242_10566459 3300009176 Bacteria 1092
170 Ga0105242_10788887 3300009176 Bacteria 939
171 Ga0105242_11364160 3300009176 Unclassified 735
172 Ga0105248_10042758 3300009177 Bacteria 5081
173 Ga0105248_10921887 3300009177 Unclassified 986
174 Ga0105249_10030828 3300009553 Bacteria 4848
175 Ga0105249_10891105 3300009553 Unclassified 956
176 Ga0105249_11375826 3300009553 Unclassified 778
177 Ga0105249_11781277 3300009553 Bacteria 688
178 Ga0105239_10431541 3300010375 Bacteria 1494
179 Ga0105239_11523537 3300010375 Unclassified 773
180 Ga0105239_12425317 3300010375 Bacteria 611
181 Ga0105246_10067627 3300011119 Unclassified 2504
182 Ga0105246_12220136 3300011119 Unclassified 535
183 Ga0157378_10066973 3300013297 Bacteria 3217
184 Ga0157378_10093777 3300013297 Bacteria 2733
185 Ga0157378_10120570 3300013297 Unclassified 2417
186 Ga0163162_11645705 3300013306 Unclassified 733
187 Ga0163162_12916023 3300013306 Unclassified 550
188 Ga0157372_10290511 3300013307 Unclassified 1901
189 Ga0157375_10321605 3300013308 Bacteria 1712
190 Ga0157375_10353175 3300013308 Bacteria 1636
191 Ga0157375_11040919 3300013308 Unclassified 957
192 Ga0157375_11533049 3300013308 Unclassified 787
193 Ga0163163_10818673 3300014325 Unclassified 995
194 Ga0163163_11505111 3300014325 Unclassified 734
195 Ga0163163_12925873 3300014325 Bacteria 533
196 Ga0157380_10002657 3300014326 Bacteria 12117
197 Ga0157380_10016161 3300014326 Bacteria 5499
198 Ga0157379_10012268 3300014968 Bacteria 7484
199 Ga0157376_11404656 3300014969 Unclassified 730
200 Ga0207653_10376168 3300025885 Bacteria 556
201 Ga0207642_10372955 3300025899 Bacteria 847
202 Ga0207680_10067939 3300025903 Bacteria 2197
203 Ga0207645_10217547 3300025907 Unclassified 1259
204 Ga0207645_10342248 3300025907 Unclassified 1000
205 Ga0207654_10434467 3300025911 Unclassified 918
206 Ga0207654_11256190 3300025911 Unclassified 540
207 Ga0207707_10000033 3300025912 Bacteria 158362
208 Ga0207660_10008540 3300025917 Bacteria 6627
209 Ga0207662_10186827 3300025918 Bacteria 1336
210 Ga0207662_10282408 3300025918 Unclassified 1099
211 Ga0207662_11184826 3300025918 Unclassified 543
212 Ga0207652_10000032 3300025921 Bacteria 143319
213 Ga0207681_10169970 3300025923 Unclassified 1651
214 Ga0207687_11239092 3300025927 Unclassified 641
215 Ga0207644_10458251 3300025931 Unclassified 1048
216 Ga0207706_10731764 3300025933 Bacteria 844
217 Ga0207686_10185414 3300025934 Bacteria 1479
218 Ga0207686_10893474 3300025934 Bacteria 716
219 Ga0207669_10270947 3300025937 Bacteria 1275
220 Ga0207704_11942729 3300025938 Unclassified 506
221 Ga0207691_10165659 3300025940 Bacteria 1937
222 Ga0207711_10119021 3300025941 Bacteria 2356
223 Ga0207711_11518071 3300025941 Unclassified 613
224 Ga0207651_10204165 3300025960 Unclassified 1586
225 Ga0207712_10164612 3300025961 Unclassified 1727
226 Ga0207712_10269855 3300025961 Bacteria 1383
227 Ga0207712_10711738 3300025961 Unclassified 877
228 Ga0207668_10230534 3300025972 Unclassified 1493
229 Ga0207668_11005027 3300025972 Bacteria 745
230 Ga0207640_10051397 3300025981 Bacteria 2679
231 Ga0207677_10314570 3300026023 Bacteria 1299
232 Ga0207677_12100350 3300026023 Unclassified 525
233 Ga0207703_10142758 3300026035 Bacteria 2080
234 Ga0207708_10004921 3300026075 Bacteria 9850
235 Ga0207708_10996174 3300026075 Unclassified 728
236 Ga0207708_11500478 3300026075 Bacteria 592
237 Ga0207641_11030467 3300026088 Bacteria 820
238 Ga0207676_11833725 3300026095 Unclassified 605
239 Ga0207676_12329121 3300026095 Unclassified 533
240 Ga0207674_10029939 3300026116 Bacteria 5727
241 Ga0207674_10666937 3300026116 Unclassified 1004
242 Ga0207674_10947974 3300026116 Unclassified 829
243 Ga0207675_100691439 3300026118 Bacteria 1028
244 Ga0207675_101264092 3300026118 Unclassified 758
245 Ga0207675_102089843 3300026118 Bacteria 583
246 Ga0207683_11489078 3300026121 Unclassified 625
247 Ga0207698_10509576 3300026142 Bacteria 1172
248 Ga0207428_10053934 3300027907 Bacteria 3204
249 Ga0207428_10519809 3300027907 Bacteria 863
250 Ga0268266_10748385 3300028379 Bacteria 943
251 Ga0268266_11209899 3300028379 Unclassified 731
252 Ga0268265_10017504 3300028380 Unclassified 4947
253 Ga0268265_10064966 3300028380 Bacteria 2814
254 Ga0268265_10713704 3300028380 Unclassified 970
255 Ga0268265_10877781 3300028380 Unclassified 879
256 Ga0268264_10013616 3300028381 Bacteria 6694
257 Ga0268264_11234669 3300028381 Unclassified 757
258 Ga0268264_12415738 3300028381 Bacteria 531
259 Ga0307408_100204339 3300031548 Bacteria 1601
260 Ga0307408_100572806 3300031548 Bacteria 999
261 Ga0307408_101821994 3300031548 Unclassified 582
262 Ga0307405_10272373 3300031731 Bacteria 1270
263 Ga0307413_10173267 3300031824 Bacteria 1530
264 Ga0307406_10773718 3300031901 Bacteria 808
265 Ga0307406_11144297 3300031901 Bacteria 674
266 Ga0307407_10474861 3300031903 Bacteria 912
267 Ga0307407_10825171 3300031903 Unclassified 707
268 Ga0307407_11441963 3300031903 Unclassified 543
269 Ga0307412_10287377 3300031911 Unclassified 1294
270 Ga0307412_10368934 3300031911 Bacteria 1158
271 Ga0307409_100209873 3300031995 Bacteria 1749
272 Ga0307416_101279720 3300032002 Bacteria 839
273 Ga0307411_10138684 3300032005 Unclassified 1790
274 Ga0307411_10167700 3300032005 Bacteria 1652
275 Ga0307415_100327961 3300032126 Bacteria 1279
276 Ga0373958_0064359 3300034819 Unclassified 801
277 Ga0373940_0206479 3300035088 Bacteria 648
278 Ga0373939_0283865 3300035114 Unclassified 655
279 Ga0373962_0023752 3300035242 Unclassified 1635
280 Ga0373962_0364900 3300035242 Unclassified 525
281 Ga0373931_0383685 3300035691 Bacteria 886
282 Ga0373931_0683236 3300035691 Unclassified 677
283 Ga0373931_1172442 3300035691 Unclassified 525
284 Ga0395900_0817894 3300037418 Bacteria 859
285 Ga0395900_1275018 3300037418 Bacteria 649
286 Ga0395900_1553886 3300037418 Unclassified 573
287 Ga0395898_0963972 3300037466 Unclassified 790
288 Ga0395905_0445965 3300037471 Bacteria 1192
289 Ga0395901_0782485 3300038443 Bacteria 945
290 Ga0242420_030983 3300038996 Bacteria 992
291 Ga0439453_0030286 3300041408 Unclassified 1022
292 Ga0439441_161006 3300042001 Unclassified 533
293 Ga0439446_0262434 3300042156 Unclassified 598
294 Ga0451577_1412071 3300042876 Bacteria 617
295 Ga0451576_0589185 3300045051 Unclassified 1169
296 Ga0495621_0082006 3300046539 Unclassified 1204
297 Ga0495669_0114023 3300046684 Bacteria 1264
298 Ga0495670_0528028 3300046691 Bacteria 642
299 Ga0496100_0805631 3300048903 Bacteria 736
300 Ga0496104_0899897 3300048907 Unclassified 790
301 Ga0496106_0095305 3300048909 Bacteria 2302
302 Ga0496109_0000065 3300048912 Bacteria 112104
303 Ga0496109_0166305 3300048912 Unclassified 2068
304 Ga0501071_0618773 3300049587 Bacteria 833
305 Ga0501074_0195769 3300049590 Bacteria 1441
306 Ga0501075_0042841 3300049591 Bacteria 3395
307 Ga0501080_0308563 3300049742 Bacteria 1434
308 Ga0501081_0848055 3300049743 Unclassified 688
309 Ga0501081_0897643 3300049743 Unclassified 668
310 Ga0501270_095692 3300049767 Unclassified 613
311 Ga0501045_0421855 3300049824 Bacteria 992
312 nmdc:mga03683_3788_c1 3300050489 Bacteria 4407
313 nmdc:mga00v17_297270_c1 3300050491 Unclassified 1049
314 nmdc:mga00v17_51871_c1 3300050491 Bacteria 2494
315 nmdc:mga0yw44_54562_c1 3300050492 Bacteria 2429
316 nmdc:mga0k408_27335_c1 3300050493 Bacteria 3240
317 nmdc:mga0k408_4204_c1 3300050493 Bacteria 7639
318 nmdc:mga0k408_50284_c1 3300050493 Bacteria 2413
319 nmdc:mga06z11_182820_c1 3300050494 Bacteria 1210
320 nmdc:mga06z11_570718_c1 3300050494 Bacteria 688
321 nmdc:mga06z11_97113_c1 3300050494 Bacteria 1610
322 nmdc:mga04h51_432418_c1 3300050495 Bacteria 555
323 nmdc:mga07m45_444208_c1 3300050496 Bacteria 752
324 nmdc:mga05p37_1292453_c1 3300050507 Unclassified 744
325 nmdc:mga05p37_2134242_c1 3300050507 Unclassified 523
326 nmdc:mga05p37_33694_c1 3300050507 Bacteria 6273
327 nmdc:mga05p37_444221_c1 3300050507 Bacteria 1503
328 nmdc:mga05p37_470693_c1 3300050507 Unclassified 1450
329 nmdc:mga05p37_613144_c1 3300050507 Bacteria 1226
330 nmdc:mga05p37_88681_c1 3300050507 Unclassified 3812
331 nmdc:mga09592_185779_c1 3300050508 Bacteria 1798
332 nmdc:mga09592_272743_c1 3300050508 Bacteria 1467
333 nmdc:mga09592_385692_c1 3300050508 Unclassified 1211
334 nmdc:mga0qj67_485524_c1 3300050509 Bacteria 994
335 nmdc:mga0qj67_755003_c1 3300050509 Bacteria 772
336 nmdc:mga06r32_11752_c1 3300050510 Bacteria 7882
337 nmdc:mga06r32_180004_c1 3300050510 Bacteria 2099
338 nmdc:mga06r32_2274_c1 3300050510 Bacteria 17178
339 nmdc:mga06r32_275516_c1 3300050510 Unclassified 1670
340 nmdc:mga06r32_361363_c1 3300050510 Unclassified 1436
341 nmdc:mga06r32_93839_c1 3300050510 Bacteria 2936
342 nmdc:mga08y16_195832_c1 3300050511 Bacteria 2095
343 nmdc:mga08y16_37974_c1 3300050511 Bacteria 5056
344 nmdc:mga08y16_4775_c1 3300050511 Bacteria 14140
345 nmdc:mga08y16_61987_c1 3300050511 Bacteria 3905
346 nmdc:mga08y16_88748_c1 3300050511 Bacteria 3222
347 nmdc:mga0n895_1249976_c1 3300050512 Unclassified 715
348 nmdc:mga0n895_26322_c1 3300050512 Bacteria 5507
349 nmdc:mga0n895_601624_c1 3300050512 Bacteria 1102
350 nmdc:mga0rr50_1122886_c1 3300050513 Bacteria 668
351 nmdc:mga0rr50_1538458_c1 3300050513 Unclassified 562
352 nmdc:mga0rr50_271118_c1 3300050513 Bacteria 1414
353 nmdc:mga0rr50_667629_c1 3300050513 Bacteria 887
354 nmdc:mga0a205_113306_c1 3300050515 Bacteria 2611
355 nmdc:mga0a205_1253111_c1 3300050515 Unclassified 589
356 nmdc:mga0a205_13173_c1 3300050515 Bacteria 7684
357 nmdc:mga0a205_29882_c1 3300050515 Bacteria 5215
358 nmdc:mga0a205_458072_c1 3300050515 Bacteria 1135
359 Ga0500641_0009312 3300053096 Bacteria 3530
360 Ga0500555_082117 3300053103 Bacteria 837
361 Ga0500556_0179839 3300053104 Unclassified 836
362 Ga0500627_0245430 3300053158 Bacteria 794
363 Ga0501084_0115329 3300054114 Unclassified 2258
364 Ga0501082_0120844 3300060353 Unclassified 2271
365 Ga0501082_1387093 3300060353 Unclassified 614
366 Ga0530510_0144776 3300061734 Bacteria 1753
367 Ga0530510_1105756 3300061734 Unclassified 607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10001881 Ga0075364_100018811 102
2 3300006177 Ga0075362_10015780 Ga0075362_100157802 102
3 3300006178 Ga0075367_10041681 Ga0075367_100416812 102
4 3300006195 Ga0075366_10003642 Ga0075366_100036428 102
5 3300006195 Ga0075366_10004473 Ga0075366_100044732 102
6 3300050489 nmdc:mga03683_3788_c1 nmdc:mga03683_3788_c1_1255_1563 102
7 3300050491 nmdc:mga00v17_297270_c1 nmdc:mga00v17_297270_c1_448_756 102
8 3300050493 nmdc:mga0k408_27335_c1 nmdc:mga0k408_27335_c1_1396_1704 102
9 3300050493 nmdc:mga0k408_4204_c1 nmdc:mga0k408_4204_c1_6577_6885 102
10 3300050494 nmdc:mga06z11_182820_c1 nmdc:mga06z11_182820_c1_444_752 102
11 3300009094 Ga0111539_10942207 Ga0111539_109422072 103
12 3300005618 Ga0068864_100555681 Ga0068864_1005556812 105
13 3300006178 Ga0075367_10502244 Ga0075367_105022442 105
14 3300006195 Ga0075366_10034582 Ga0075366_100345822 105
15 3300013306 Ga0163162_11645705 Ga0163162_116457052 105
16 3300014325 Ga0163163_11505111 Ga0163163_115051111 105
17 3300026088 Ga0207641_11030467 Ga0207641_110304672 105
18 3300050493 nmdc:mga0k408_50284_c1 nmdc:mga0k408_50284_c1_506_829 105
19 3300050494 nmdc:mga06z11_570718_c1 nmdc:mga06z11_570718_c1_263_586 105
20 3300050495 nmdc:mga04h51_432418_c1 nmdc:mga04h51_432418_c1_184_507 105
21 3300005328 Ga0070676_10178304 Ga0070676_101783042 106
22 3300005353 Ga0070669_100330395 Ga0070669_1003303951 106
23 3300005354 Ga0070675_100558082 Ga0070675_1005580822 106
24 3300009147 Ga0114129_10974278 Ga0114129_109742782 106
25 3300009553 Ga0105249_10891105 Ga0105249_108911052 106
26 3300013308 Ga0157375_11040919 Ga0157375_110409192 106
27 3300014326 Ga0157380_10016161 Ga0157380_100161615 106
28 3300025907 Ga0207645_10342248 Ga0207645_103422482 106
29 3300026023 Ga0207677_10314570 Ga0207677_103145701 106
30 3300035242 Ga0373962_0364900 Ga0373962_0364900_31_357 106
31 3300035691 Ga0373931_1172442 Ga0373931_1172442_147_473 106
32 3300005336 Ga0070680_100063023 Ga0070680_1000630234 107
33 3300005458 Ga0070681_10001694 Ga0070681_100016944 107
34 3300005530 Ga0070679_100001724 Ga0070679_10000172417 107
35 3300005548 Ga0070665_101053756 Ga0070665_1010537562 107
36 3300006844 Ga0075428_100387915 Ga0075428_1003879152 107
37 3300006846 Ga0075430_101502872 Ga0075430_1015028721 107
38 3300006847 Ga0075431_100028769 Ga0075431_1000287693 107
39 3300007076 Ga0075435_100247887 Ga0075435_1002478872 107
40 3300009094 Ga0111539_10108268 Ga0111539_101082682 107
41 3300010375 Ga0105239_10431541 Ga0105239_104315412 107
42 3300025912 Ga0207707_10000033 Ga0207707_1000003356 107
43 3300025917 Ga0207660_10008540 Ga0207660_100085404 107
44 3300025921 Ga0207652_10000032 Ga0207652_1000003250 107
45 3300025938 Ga0207704_11942729 Ga0207704_119427292 107
46 3300028379 Ga0268266_10748385 Ga0268266_107483852 107
47 3300031548 Ga0307408_101821994 Ga0307408_1018219942 107
48 3300031903 Ga0307407_10825171 Ga0307407_108251712 107
49 3300031911 Ga0307412_10287377 Ga0307412_102873772 107
50 3300032005 Ga0307411_10138684 Ga0307411_101386842 107
51 3300035691 Ga0373931_0683236 Ga0373931_0683236_265_588 107
52 3300037418 Ga0395900_1553886 Ga0395900_1553886_183_506 107
53 3300037471 Ga0395905_0445965 Ga0395905_0445965_34_357 107
54 3300038443 Ga0395901_0782485 Ga0395901_0782485_84_407 107
55 3300042156 Ga0439446_0262434 Ga0439446_0262434_210_533 107
56 3300050507 nmdc:mga05p37_2134242_c1 nmdc:mga05p37_2134242_c1_63_386 107
57 3300050509 nmdc:mga0qj67_485524_c1 nmdc:mga0qj67_485524_c1_33_359 107
58 3300050510 nmdc:mga06r32_93839_c1 nmdc:mga06r32_93839_c1_895_1221 107
59 3300050513 nmdc:mga0rr50_271118_c1 nmdc:mga0rr50_271118_c1_1065_1388 107
60 3300061734 Ga0530510_1105756 Ga0530510_1105756_71_394 107
61 2162886012 MBSR1b_contig_10340630 MBSR1b_0081.00003660 108
62 3300005289 Ga0065704_10119357 Ga0065704_101193572 108
63 3300005289 Ga0065704_10240267 Ga0065704_102402671 108
64 3300005293 Ga0065715_10176154 Ga0065715_101761542 108
65 3300005293 Ga0065715_10445453 Ga0065715_104454532 108
66 3300005295 Ga0065707_10037866 Ga0065707_100378661 108
67 3300005295 Ga0065707_10097789 Ga0065707_100977892 108
68 3300005295 Ga0065707_10730604 Ga0065707_107306041 108
69 3300005295 Ga0065707_10825619 Ga0065707_108256191 108
70 3300005334 Ga0068869_101088329 Ga0068869_1010883292 108
71 3300005335 Ga0070666_10075562 Ga0070666_100755622 108
72 3300005336 Ga0070680_100125762 Ga0070680_1001257624 108
73 3300005340 Ga0070689_100120083 Ga0070689_1001200832 108
74 3300005343 Ga0070687_100152128 Ga0070687_1001521282 108
75 3300005343 Ga0070687_100167438 Ga0070687_1001674382 108
76 3300005343 Ga0070687_101163614 Ga0070687_1011636141 108
77 3300005345 Ga0070692_10285494 Ga0070692_102854942 108
78 3300005347 Ga0070668_100152139 Ga0070668_1001521391 108
79 3300005347 Ga0070668_100357022 Ga0070668_1003570222 108
80 3300005353 Ga0070669_100002576 Ga0070669_1000025768 108
81 3300005353 Ga0070669_100034095 Ga0070669_1000340952 108
82 3300005355 Ga0070671_100104418 Ga0070671_1001044181 108
83 3300005355 Ga0070671_100992429 Ga0070671_1009924291 108
84 3300005356 Ga0070674_100054720 Ga0070674_1000547203 108
85 3300005364 Ga0070673_100175902 Ga0070673_1001759022 108
86 3300005365 Ga0070688_100384289 Ga0070688_1003842892 108
87 3300005438 Ga0070701_10271439 Ga0070701_102714392 108
88 3300005438 Ga0070701_10756978 Ga0070701_107569781 108
89 3300005441 Ga0070700_100040723 Ga0070700_1000407232 108
90 3300005441 Ga0070700_101366876 Ga0070700_1013668762 108
91 3300005444 Ga0070694_100522868 Ga0070694_1005228682 108
92 3300005444 Ga0070694_101004245 Ga0070694_1010042451 108
93 3300005445 Ga0070708_100020833 Ga0070708_1000208332 108
94 3300005445 Ga0070708_100225350 Ga0070708_1002253502 108
95 3300005457 Ga0070662_100727604 Ga0070662_1007276042 108
96 3300005459 Ga0068867_100862261 Ga0068867_1008622612 108
97 3300005467 Ga0070706_100568675 Ga0070706_1005686751 108
98 3300005467 Ga0070706_100638254 Ga0070706_1006382541 108
99 3300005467 Ga0070706_101178071 Ga0070706_1011780711 108
100 3300005471 Ga0070698_100713842 Ga0070698_1007138421 108
101 3300005471 Ga0070698_100838957 Ga0070698_1008389572 108
102 3300005518 Ga0070699_100029889 Ga0070699_1000298893 108
103 3300005518 Ga0070699_100072190 Ga0070699_1000721902 108
104 3300005518 Ga0070699_100077920 Ga0070699_1000779202 108
105 3300005518 Ga0070699_100607259 Ga0070699_1006072591 108
106 3300005518 Ga0070699_101093714 Ga0070699_1010937141 108
107 3300005518 Ga0070699_102211615 Ga0070699_1022116151 108
108 3300005543 Ga0070672_100024692 Ga0070672_1000246922 108
109 3300005544 Ga0070686_100820353 Ga0070686_1008203532 108
110 3300005545 Ga0070695_100081031 Ga0070695_1000810313 108
111 3300005546 Ga0070696_100192955 Ga0070696_1001929551 108
112 3300005546 Ga0070696_101070010 Ga0070696_1010700102 108
113 3300005547 Ga0070693_100250071 Ga0070693_1002500711 108
114 3300005547 Ga0070693_100870575 Ga0070693_1008705751 108
115 3300005549 Ga0070704_100110812 Ga0070704_1001108122 108
116 3300005549 Ga0070704_100563539 Ga0070704_1005635391 108
117 3300005549 Ga0070704_100695927 Ga0070704_1006959272 108
118 3300005549 Ga0070704_101165689 Ga0070704_1011656892 108
119 3300005549 Ga0070704_102116578 Ga0070704_1021165781 108
120 3300005549 Ga0070704_102166595 Ga0070704_1021665951 108
121 3300005577 Ga0068857_100025712 Ga0068857_1000257123 108
122 3300005577 Ga0068857_100663582 Ga0068857_1006635821 108
123 3300005578 Ga0068854_100105770 Ga0068854_1001057701 108
124 3300005578 Ga0068854_100323459 Ga0068854_1003234591 108
125 3300005616 Ga0068852_101124465 Ga0068852_1011244652 108
126 3300005617 Ga0068859_100006122 Ga0068859_1000061229 108
127 3300005617 Ga0068859_100073372 Ga0068859_1000733721 108
128 3300005617 Ga0068859_100706427 Ga0068859_1007064272 108
129 3300005618 Ga0068864_101909718 Ga0068864_1019097182 108
130 3300005719 Ga0068861_100059151 Ga0068861_1000591513 108
131 3300005719 Ga0068861_100278680 Ga0068861_1002786802 108
132 3300005719 Ga0068861_101230672 Ga0068861_1012306721 108
133 3300005719 Ga0068861_101251510 Ga0068861_1012515102 108
134 3300005719 Ga0068861_101284480 Ga0068861_1012844802 108
135 3300005719 Ga0068861_102655546 Ga0068861_1026555461 108
136 3300005840 Ga0068870_10159539 Ga0068870_101595392 108
137 3300005841 Ga0068863_100123928 Ga0068863_1001239282 108
138 3300005842 Ga0068858_100126226 Ga0068858_1001262262 108
139 3300005843 Ga0068860_100017540 Ga0068860_1000175403 108
140 3300005843 Ga0068860_100792171 Ga0068860_1007921711 108
141 3300005843 Ga0068860_101413226 Ga0068860_1014132262 108
142 3300005843 Ga0068860_102153134 Ga0068860_1021531341 108
143 3300005844 Ga0068862_100029995 Ga0068862_1000299952 108
144 3300005844 Ga0068862_100044710 Ga0068862_1000447102 108
145 3300005844 Ga0068862_100182217 Ga0068862_1001822174 108
146 3300005844 Ga0068862_101045737 Ga0068862_1010457372 108
147 3300005844 Ga0068862_101313701 Ga0068862_1013137011 108
148 3300005937 Ga0081455_10002364 Ga0081455_100023641 108
149 3300005937 Ga0081455_10034984 Ga0081455_100349842 108
150 3300005937 Ga0081455_10073330 Ga0081455_100733302 108
151 3300005937 Ga0081455_10716257 Ga0081455_107162571 108
152 3300005983 Ga0081540_1152819 Ga0081540_11528192 108
153 3300005985 Ga0081539_10021960 Ga0081539_100219602 108
154 3300006038 Ga0075365_10010312 Ga0075365_100103122 108
155 3300006173 Ga0070716_101710325 Ga0070716_1017103251 108
156 3300006237 Ga0097621_100506459 Ga0097621_1005064592 108
157 3300006353 Ga0075370_10233617 Ga0075370_102336172 108
158 3300006358 Ga0068871_101371992 Ga0068871_1013719922 108
159 3300006358 Ga0068871_101667967 Ga0068871_1016679672 108
160 3300006844 Ga0075428_100003277 Ga0075428_1000032778 108
161 3300006844 Ga0075428_100919504 Ga0075428_1009195042 108
162 3300006844 Ga0075428_101249606 Ga0075428_1012496062 108
163 3300006847 Ga0075431_100028590 Ga0075431_1000285901 108
164 3300006847 Ga0075431_100031050 Ga0075431_1000310503 108
165 3300006847 Ga0075431_100065727 Ga0075431_1000657271 108
166 3300006847 Ga0075431_100574327 Ga0075431_1005743272 108
167 3300006847 Ga0075431_100599122 Ga0075431_1005991223 108
168 3300006847 Ga0075431_101449570 Ga0075431_1014495702 108
169 3300006852 Ga0075433_10265675 Ga0075433_102656752 108
170 3300006852 Ga0075433_10312456 Ga0075433_103124562 108
171 3300006852 Ga0075433_10743869 Ga0075433_107438692 108
172 3300006852 Ga0075433_10923337 Ga0075433_109233372 108
173 3300006852 Ga0075433_11600851 Ga0075433_116008511 108
174 3300006852 Ga0075433_11932650 Ga0075433_119326501 108
175 3300006871 Ga0075434_100253606 Ga0075434_1002536062 108
176 3300006880 Ga0075429_100277464 Ga0075429_1002774641 108
177 3300006880 Ga0075429_100348592 Ga0075429_1003485922 108
178 3300006880 Ga0075429_100494713 Ga0075429_1004947131 108
179 3300006880 Ga0075429_100553951 Ga0075429_1005539512 108
180 3300006880 Ga0075429_100602824 Ga0075429_1006028242 108
181 3300006931 Ga0097620_100006122 Ga0097620_1000061229 108
182 3300006931 Ga0097620_100073372 Ga0097620_1000733721 108
183 3300006931 Ga0097620_100706437 Ga0097620_1007064372 108
184 3300007076 Ga0075435_100501948 Ga0075435_1005019482 108
185 3300007076 Ga0075435_100530367 Ga0075435_1005303672 108
186 3300007076 Ga0075435_101646835 Ga0075435_1016468351 108
187 3300009094 Ga0111539_10014809 Ga0111539_100148096 108
188 3300009094 Ga0111539_10041551 Ga0111539_100415512 108
189 3300009094 Ga0111539_10560911 Ga0111539_105609112 108
190 3300009094 Ga0111539_11345427 Ga0111539_113454271 108
191 3300009094 Ga0111539_12121471 Ga0111539_121214712 108
192 3300009098 Ga0105245_11207078 Ga0105245_112070782 108
193 3300009101 Ga0105247_10574389 Ga0105247_105743891 108
194 3300009147 Ga0114129_10024022 Ga0114129_100240226 108
195 3300009147 Ga0114129_10031513 Ga0114129_100315135 108
196 3300009147 Ga0114129_10072870 Ga0114129_100728704 108
197 3300009147 Ga0114129_10078541 Ga0114129_100785412 108
198 3300009147 Ga0114129_10087427 Ga0114129_100874275 108
199 3300009147 Ga0114129_10135545 Ga0114129_101355452 108
200 3300009147 Ga0114129_10205732 Ga0114129_102057323 108
201 3300009147 Ga0114129_10242463 Ga0114129_102424632 108
202 3300009147 Ga0114129_10852873 Ga0114129_108528732 108
203 3300009147 Ga0114129_13261484 Ga0114129_132614841 108
204 3300009148 Ga0105243_12685953 Ga0105243_126859531 108
205 3300009174 Ga0105241_11810612 Ga0105241_118106121 108
206 3300009176 Ga0105242_10562860 Ga0105242_105628602 108
207 3300009176 Ga0105242_10566459 Ga0105242_105664591 108
208 3300009176 Ga0105242_10788887 Ga0105242_107888872 108
209 3300009176 Ga0105242_11364160 Ga0105242_113641601 108
210 3300009177 Ga0105248_10042758 Ga0105248_100427584 108
211 3300009177 Ga0105248_10921887 Ga0105248_109218872 108
212 3300009553 Ga0105249_10030828 Ga0105249_100308284 108
213 3300009553 Ga0105249_11375826 Ga0105249_113758262 108
214 3300009553 Ga0105249_11781277 Ga0105249_117812772 108
215 3300010375 Ga0105239_11523537 Ga0105239_115235372 108
216 3300010375 Ga0105239_12425317 Ga0105239_124253171 108
217 3300011119 Ga0105246_10067627 Ga0105246_100676273 108
218 3300011119 Ga0105246_12220136 Ga0105246_122201362 108
219 3300013297 Ga0157378_10066973 Ga0157378_100669732 108
220 3300013297 Ga0157378_10093777 Ga0157378_100937772 108
221 3300013297 Ga0157378_10120570 Ga0157378_101205702 108
222 3300013306 Ga0163162_12916023 Ga0163162_129160231 108
223 3300013307 Ga0157372_10290511 Ga0157372_102905112 108
224 3300013308 Ga0157375_10321605 Ga0157375_103216052 108
225 3300013308 Ga0157375_10353175 Ga0157375_103531751 108
226 3300013308 Ga0157375_11533049 Ga0157375_115330492 108
227 3300014325 Ga0163163_10818673 Ga0163163_108186732 108
228 3300014325 Ga0163163_12925873 Ga0163163_129258731 108
229 3300014326 Ga0157380_10002657 Ga0157380_100026577 108
230 3300014968 Ga0157379_10012268 Ga0157379_100122682 108
231 3300014969 Ga0157376_11404656 Ga0157376_114046561 108
232 3300025885 Ga0207653_10376168 Ga0207653_103761681 108
233 3300025899 Ga0207642_10372955 Ga0207642_103729551 108
234 3300025903 Ga0207680_10067939 Ga0207680_100679392 108
235 3300025907 Ga0207645_10217547 Ga0207645_102175472 108
236 3300025911 Ga0207654_10434467 Ga0207654_104344671 108
237 3300025911 Ga0207654_11256190 Ga0207654_112561901 108
238 3300025918 Ga0207662_10186827 Ga0207662_101868271 108
239 3300025918 Ga0207662_10282408 Ga0207662_102824082 108
240 3300025918 Ga0207662_11184826 Ga0207662_111848261 108
241 3300025923 Ga0207681_10169970 Ga0207681_101699702 108
242 3300025927 Ga0207687_11239092 Ga0207687_112390922 108
243 3300025931 Ga0207644_10458251 Ga0207644_104582511 108
244 3300025933 Ga0207706_10731764 Ga0207706_107317642 108
245 3300025934 Ga0207686_10185414 Ga0207686_101854142 108
246 3300025934 Ga0207686_10893474 Ga0207686_108934742 108
247 3300025937 Ga0207669_10270947 Ga0207669_102709471 108
248 3300025940 Ga0207691_10165659 Ga0207691_101656593 108
249 3300025941 Ga0207711_10119021 Ga0207711_101190212 108
250 3300025941 Ga0207711_11518071 Ga0207711_115180712 108
251 3300025960 Ga0207651_10204165 Ga0207651_102041653 108
252 3300025961 Ga0207712_10164612 Ga0207712_101646122 108
253 3300025961 Ga0207712_10269855 Ga0207712_102698552 108
254 3300025961 Ga0207712_10711738 Ga0207712_107117382 108
255 3300025972 Ga0207668_10230534 Ga0207668_102305342 108
256 3300025972 Ga0207668_11005027 Ga0207668_110050272 108
257 3300025981 Ga0207640_10051397 Ga0207640_100513973 108
258 3300026023 Ga0207677_12100350 Ga0207677_121003501 108
259 3300026035 Ga0207703_10142758 Ga0207703_101427583 108
260 3300026075 Ga0207708_10004921 Ga0207708_100049218 108
261 3300026075 Ga0207708_10996174 Ga0207708_109961742 108
262 3300026075 Ga0207708_11500478 Ga0207708_115004781 108
263 3300026095 Ga0207676_11833725 Ga0207676_118337251 108
264 3300026095 Ga0207676_12329121 Ga0207676_123291211 108
265 3300026116 Ga0207674_10029939 Ga0207674_100299396 108
266 3300026116 Ga0207674_10666937 Ga0207674_106669371 108
267 3300026116 Ga0207674_10947974 Ga0207674_109479741 108
268 3300026118 Ga0207675_100691439 Ga0207675_1006914392 108
269 3300026118 Ga0207675_101264092 Ga0207675_1012640922 108
270 3300026118 Ga0207675_102089843 Ga0207675_1020898431 108
271 3300026121 Ga0207683_11489078 Ga0207683_114890781 108
272 3300026142 Ga0207698_10509576 Ga0207698_105095762 108
273 3300027907 Ga0207428_10053934 Ga0207428_100539342 108
274 3300027907 Ga0207428_10519809 Ga0207428_105198091 108
275 3300028379 Ga0268266_11209899 Ga0268266_112098991 108
276 3300028380 Ga0268265_10017504 Ga0268265_100175042 108
277 3300028380 Ga0268265_10064966 Ga0268265_100649662 108
278 3300028380 Ga0268265_10713704 Ga0268265_107137042 108
279 3300028380 Ga0268265_10877781 Ga0268265_108777812 108
280 3300028381 Ga0268264_10013616 Ga0268264_100136165 108
281 3300028381 Ga0268264_11234669 Ga0268264_112346691 108
282 3300028381 Ga0268264_12415738 Ga0268264_124157382 108
283 3300031548 Ga0307408_100204339 Ga0307408_1002043393 108
284 3300031548 Ga0307408_100572806 Ga0307408_1005728062 108
285 3300031731 Ga0307405_10272373 Ga0307405_102723732 108
286 3300031824 Ga0307413_10173267 Ga0307413_101732672 108
287 3300031901 Ga0307406_10773718 Ga0307406_107737182 108
288 3300031901 Ga0307406_11144297 Ga0307406_111442972 108
289 3300031903 Ga0307407_10474861 Ga0307407_104748612 108
290 3300031903 Ga0307407_11441963 Ga0307407_114419631 108
291 3300031911 Ga0307412_10368934 Ga0307412_103689342 108
292 3300031995 Ga0307409_100209873 Ga0307409_1002098732 108
293 3300032002 Ga0307416_101279720 Ga0307416_1012797202 108
294 3300032005 Ga0307411_10167700 Ga0307411_101677002 108
295 3300032126 Ga0307415_100327961 Ga0307415_1003279612 108
296 3300034819 Ga0373958_0064359 Ga0373958_0064359_338_664 108
297 3300035088 Ga0373940_0206479 Ga0373940_0206479_68_394 108
298 3300035114 Ga0373939_0283865 Ga0373939_0283865_192_518 108
299 3300035242 Ga0373962_0023752 Ga0373962_0023752_1279_1605 108
300 3300035691 Ga0373931_0383685 Ga0373931_0383685_149_475 108
301 3300037418 Ga0395900_0817894 Ga0395900_0817894_214_546 108
302 3300037418 Ga0395900_1275018 Ga0395900_1275018_252_578 108
303 3300037466 Ga0395898_0963972 Ga0395898_0963972_400_726 108
304 3300038996 Ga0242420_030983 Ga0242420_030983_647_973 108
305 3300041408 Ga0439453_0030286 Ga0439453_0030286_329_655 108
306 3300042001 Ga0439441_161006 Ga0439441_161006_15_341 108
307 3300042876 Ga0451577_1412071 Ga0451577_1412071_68_394 108
308 3300045051 Ga0451576_0589185 Ga0451576_0589185_354_680 108
309 3300046539 Ga0495621_0082006 Ga0495621_0082006_752_1078 108
310 3300046684 Ga0495669_0114023 Ga0495669_0114023_301_627 108
311 3300046691 Ga0495670_0528028 Ga0495670_0528028_220_546 108
312 3300048903 Ga0496100_0805631 Ga0496100_0805631_273_599 108
313 3300048907 Ga0496104_0899897 Ga0496104_0899897_169_495 108
314 3300048909 Ga0496106_0095305 Ga0496106_0095305_102_428 108
315 3300048912 Ga0496109_0000065 Ga0496109_0000065_5797_6123 108
316 3300048912 Ga0496109_0166305 Ga0496109_0166305_322_648 108
317 3300049587 Ga0501071_0618773 Ga0501071_0618773_265_591 108
318 3300049590 Ga0501074_0195769 Ga0501074_0195769_213_539 108
319 3300049591 Ga0501075_0042841 Ga0501075_0042841_1472_1798 108
320 3300049742 Ga0501080_0308563 Ga0501080_0308563_588_914 108
321 3300049743 Ga0501081_0848055 Ga0501081_0848055_267_593 108
322 3300049743 Ga0501081_0897643 Ga0501081_0897643_290_616 108
323 3300049767 Ga0501270_095692 Ga0501270_095692_10_336 108
324 3300049824 Ga0501045_0421855 Ga0501045_0421855_79_405 108
325 3300050491 nmdc:mga00v17_51871_c1 nmdc:mga00v17_51871_c1_40_366 108
326 3300050492 nmdc:mga0yw44_54562_c1 nmdc:mga0yw44_54562_c1_63_389 108
327 3300050494 nmdc:mga06z11_97113_c1 nmdc:mga06z11_97113_c1_273_599 108
328 3300050496 nmdc:mga07m45_444208_c1 nmdc:mga07m45_444208_c1_397_723 108
329 3300050507 nmdc:mga05p37_1292453_c1 nmdc:mga05p37_1292453_c1_135_461 108
330 3300050507 nmdc:mga05p37_33694_c1 nmdc:mga05p37_33694_c1_1980_2306 108
331 3300050507 nmdc:mga05p37_444221_c1 nmdc:mga05p37_444221_c1_1023_1355 108
332 3300050507 nmdc:mga05p37_470693_c1 nmdc:mga05p37_470693_c1_349_681 108
333 3300050507 nmdc:mga05p37_613144_c1 nmdc:mga05p37_613144_c1_478_804 108
334 3300050507 nmdc:mga05p37_88681_c1 nmdc:mga05p37_88681_c1_767_1093 108
335 3300050508 nmdc:mga09592_185779_c1 nmdc:mga09592_185779_c1_865_1191 108
336 3300050508 nmdc:mga09592_272743_c1 nmdc:mga09592_272743_c1_516_842 108
337 3300050508 nmdc:mga09592_385692_c1 nmdc:mga09592_385692_c1_165_491 108
338 3300050509 nmdc:mga0qj67_755003_c1 nmdc:mga0qj67_755003_c1_281_607 108
339 3300050510 nmdc:mga06r32_11752_c1 nmdc:mga06r32_11752_c1_1237_1563 108
340 3300050510 nmdc:mga06r32_180004_c1 nmdc:mga06r32_180004_c1_1345_1677 108
341 3300050510 nmdc:mga06r32_2274_c1 nmdc:mga06r32_2274_c1_684_1010 108
342 3300050510 nmdc:mga06r32_275516_c1 nmdc:mga06r32_275516_c1_1184_1510 108
343 3300050510 nmdc:mga06r32_361363_c1 nmdc:mga06r32_361363_c1_301_627 108
344 3300050511 nmdc:mga08y16_195832_c1 nmdc:mga08y16_195832_c1_1700_2026 108
345 3300050511 nmdc:mga08y16_37974_c1 nmdc:mga08y16_37974_c1_4587_4913 108
346 3300050511 nmdc:mga08y16_4775_c1 nmdc:mga08y16_4775_c1_4163_4489 108
347 3300050511 nmdc:mga08y16_61987_c1 nmdc:mga08y16_61987_c1_3090_3416 108
348 3300050511 nmdc:mga08y16_88748_c1 nmdc:mga08y16_88748_c1_2465_2791 108
349 3300050512 nmdc:mga0n895_1249976_c1 nmdc:mga0n895_1249976_c1_91_417 108
350 3300050512 nmdc:mga0n895_26322_c1 nmdc:mga0n895_26322_c1_1391_1717 108
351 3300050512 nmdc:mga0n895_601624_c1 nmdc:mga0n895_601624_c1_445_771 108
352 3300050513 nmdc:mga0rr50_1122886_c1 nmdc:mga0rr50_1122886_c1_175_504 108
353 3300050513 nmdc:mga0rr50_1538458_c1 nmdc:mga0rr50_1538458_c1_54_380 108
354 3300050513 nmdc:mga0rr50_667629_c1 nmdc:mga0rr50_667629_c1_463_789 108
355 3300050515 nmdc:mga0a205_113306_c1 nmdc:mga0a205_113306_c1_1828_2154 108
356 3300050515 nmdc:mga0a205_1253111_c1 nmdc:mga0a205_1253111_c1_149_475 108
357 3300050515 nmdc:mga0a205_13173_c1 nmdc:mga0a205_13173_c1_94_420 108
358 3300050515 nmdc:mga0a205_29882_c1 nmdc:mga0a205_29882_c1_450_776 108
359 3300050515 nmdc:mga0a205_458072_c1 nmdc:mga0a205_458072_c1_506_832 108
360 3300053096 Ga0500641_0009312 Ga0500641_0009312_599_925 108
361 3300053103 Ga0500555_082117 Ga0500555_082117_216_542 108
362 3300053104 Ga0500556_0179839 Ga0500556_0179839_11_337 108
363 3300053158 Ga0500627_0245430 Ga0500627_0245430_442_768 108
364 3300054114 Ga0501084_0115329 Ga0501084_0115329_291_617 108
365 3300060353 Ga0501082_0120844 Ga0501082_0120844_1743_2069 108
366 3300060353 Ga0501082_1387093 Ga0501082_1387093_127_453 108
367 3300061734 Ga0530510_0144776 Ga0530510_0144776_1368_1694 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

31

102

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9101 9 52
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.9032 7 75
3gfj-assembly1.cif.gz_A-2 crystal structure of the st1710 mutant (r89a) protein 0.8966 6 90
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.886 9 90
3gfl-assembly1.cif.gz_A-2 crystal structure of the st1710 mutant (r90a) protein 0.8857 6 90
ID Description Score Start End Superfamily
af_A0A144A2J0_58_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 6 49 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9141 7 77 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9017 7 75 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8932 5 75 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8895 6 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A352VHJ1-F1-model_v4 PadR family transcriptional regulator 0.9947 13 88
AF-A0A7W0YSC6-F1-model_v4 PadR family transcriptional regulator 0.9941 7 90
AF-A0A848XRE5-F1-model_v4 PadR family transcriptional regulator 0.9837 6 88
AF-A0A1F2TQI2-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9822 1 90
AF-A0A7W1DT94-F1-model_v4 Helix-turn-helix transcriptional regulator 0.976 2 90

Feature Viewer

pLDDT pTM Quality
79.85 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map